metagRoot

F440255

General Info

Members	Datasets	Scaffolds	Average Seq Length
422	256	422	70

Family's Representative Sequence

Representative Sequence	3300009177\|Ga0105248_10106424\|Ga0105248_101064244
Length	77
Sequence	MGHQTGWASTRAKKVYRALLRIGWREKSRVSKSGSHKQLEHPEYPYEFTWAFHDGDEIGPKMLARIAKRTGLKPEDI

Samples

	Sample ID	Description	Type	Environment
1	3300000549	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled	Metagenome	Rhizosphere
2	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
3	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
4	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
5	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
6	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
7	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
8	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
9	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
10	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
11	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
12	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
13	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
14	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
15	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
16	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
17	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
18	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
19	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
20	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
21	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
22	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
23	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
24	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
25	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
26	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
27	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
28	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
29	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
30	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
31	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
32	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
33	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
34	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
35	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
36	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
37	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
38	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
39	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
40	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
41	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
42	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
43	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
44	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
45	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
46	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
47	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
48	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
49	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
50	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
51	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
52	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
53	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
54	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
55	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
56	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
57	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
58	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
59	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
60	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
61	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
62	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
63	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
64	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
65	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
66	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
67	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
68	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
69	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
70	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
72	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
73	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
74	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
75	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
76	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
77	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
79	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
80	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
81	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
82	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
83	3300012485	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610	Metagenome	Rhizosphere
84	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
85	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
86	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
87	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
88	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
89	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
90	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
91	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
92	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
93	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
94	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
95	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
96	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
97	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
98	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
99	3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
100	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
101	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
102	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
103	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
139	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
142	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
143	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
144	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
145	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
146	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
147	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
148	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
149	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
150	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
151	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
152	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
153	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
154	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
155	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
156	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
157	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
158	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
159	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
160	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
161	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
162	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
163	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
164	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
165	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
166	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
167	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
168	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
169	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
170	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
171	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
172	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
173	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
174	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
175	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
176	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
177	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
178	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
179	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
180	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
181	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
182	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
183	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
184	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
185	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
186	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
187	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
188	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
189	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
190	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
191	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
192	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
193	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
194	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
195	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
196	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
197	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
198	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
199	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
200	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
201	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
202	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
203	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
204	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
205	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
206	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
207	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
208	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
209	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
210	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
211	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
212	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
213	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
214	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
215	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
216	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
217	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
220	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
221	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
222	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
223	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
224	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
225	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
226	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
227	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
228	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
229	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
230	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
231	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
232	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
233	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
234	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
235	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
236	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
237	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
238	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
239	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
240	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
241	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
242	3300049851	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought	Metagenome	Rhizosphere
243	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
244	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
245	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
246	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
247	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
248	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
249	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
250	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
251	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
252	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
253	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
254	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
255	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
256	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.87
Metatranscriptomes	2.13
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	2.61
Rhizosphere	97.16
Stem	0
Stem Tuber	0
Unclassified	0.24

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	LJQas_1000015	3300000549	Bacteria	25844
2	Ga0065707_10094391	3300005295	Bacteria	3504
3	Ga0070658_11943277	3300005327	Unclassified	508
4	Ga0070676_10314699	3300005328	Bacteria	1065
5	Ga0070676_10951807	3300005328	Bacteria	642
6	Ga0070683_100055880	3300005329	Bacteria	3664
7	Ga0070683_100298672	3300005329	Bacteria	1532
8	Ga0070683_100513052	3300005329	Bacteria	1146
9	Ga0070690_101072655	3300005330	Bacteria	638
10	Ga0070670_101071245	3300005331	Bacteria	734
11	Ga0070670_101688559	3300005331	Unclassified	583
12	Ga0070677_10034893	3300005333	Bacteria	1946
13	Ga0070677_10659136	3300005333	Unclassified	585
14	Ga0070677_10896080	3300005333	Bacteria	512
15	Ga0070666_11051031	3300005335	Bacteria	605
16	Ga0070689_101259658	3300005340	Bacteria	665
17	Ga0070691_10766495	3300005341	Unclassified	585
18	Ga0070687_101376976	3300005343	Unclassified	526
19	Ga0070661_100858147	3300005344	Bacteria	748
20	Ga0070661_101011925	3300005344	Bacteria	690
21	Ga0070661_101797741	3300005344	Bacteria	520
22	Ga0070669_101263160	3300005353	Unclassified	639
23	Ga0070675_100139052	3300005354	Bacteria	2074
24	Ga0070675_100604132	3300005354	Bacteria	995
25	Ga0070675_100757156	3300005354	Unclassified	886
26	Ga0070675_101192278	3300005354	Bacteria	701
27	Ga0070671_101272778	3300005355	Bacteria	648
28	Ga0070674_100259062	3300005356	Bacteria	1369
29	Ga0070673_100080420	3300005364	Bacteria	2640
30	Ga0070673_101037080	3300005364	Unclassified	764
31	Ga0070673_102386077	3300005364	Unclassified	503
32	Ga0070688_100681412	3300005365	Bacteria	794
33	Ga0070688_100895743	3300005365	Unclassified	699
34	Ga0070667_100850923	3300005367	Unclassified	848
35	Ga0070667_102369871	3300005367	Bacteria	500
36	Ga0070709_10174406	3300005434	Bacteria	1505
37	Ga0070713_100107324	3300005436	Bacteria	2429
38	Ga0070711_100480901	3300005439	Bacteria	1021
39	Ga0070705_100139576	3300005440	Bacteria	1593
40	Ga0070705_100876721	3300005440	Bacteria	720
41	Ga0070700_100490190	3300005441	Bacteria	943
42	Ga0070694_100003040	3300005444	Bacteria	9991
43	Ga0070694_100603096	3300005444	Unclassified	884
44	Ga0070694_100695426	3300005444	Bacteria	826
45	Ga0070708_100312703	3300005445	Bacteria	1480
46	Ga0070663_101295199	3300005455	Bacteria	643
47	Ga0070678_100063442	3300005456	Bacteria	2734
48	Ga0070678_100520809	3300005456	Bacteria	1052
49	Ga0070678_100976610	3300005456	Bacteria	777
50	Ga0070678_101632087	3300005456	Unclassified	606
51	Ga0070662_100401643	3300005457	Bacteria	1131
52	Ga0070662_100788889	3300005457	Bacteria	807
53	Ga0070662_101694640	3300005457	Unclassified	546
54	Ga0070681_11813737	3300005458	Unclassified	537
55	Ga0068867_100026630	3300005459	Bacteria	4152
56	Ga0068867_100805214	3300005459	Bacteria	838
57	Ga0068867_102095581	3300005459	Unclassified	536
58	Ga0070685_11522650	3300005466	Bacteria	516
59	Ga0070706_100527827	3300005467	Bacteria	1098
60	Ga0070706_100599724	3300005467	Bacteria	1023
61	Ga0070698_100110401	3300005471	Bacteria	2715
62	Ga0070698_100209826	3300005471	Bacteria	1882
63	Ga0070699_100004087	3300005518	Bacteria	12900
64	Ga0070699_100030384	3300005518	Bacteria	4663
65	Ga0070699_100625175	3300005518	Unclassified	982
66	Ga0070699_101376115	3300005518	Unclassified	647
67	Ga0070679_100222394	3300005530	Bacteria	1849
68	Ga0070684_100079383	3300005535	Unclassified	2901
69	Ga0070684_101582732	3300005535	Unclassified	618
70	Ga0070684_101995275	3300005535	Bacteria	548
71	Ga0070697_100081862	3300005536	Bacteria	2660
72	Ga0070697_100375693	3300005536	Unclassified	1230
73	Ga0070697_100401766	3300005536	Bacteria	1189
74	Ga0070672_100205242	3300005543	Bacteria	1649
75	Ga0070695_100686172	3300005545	Unclassified	812
76	Ga0070695_101305456	3300005545	Unclassified	599
77	Ga0070696_100048351	3300005546	Bacteria	2953
78	Ga0070696_100723259	3300005546	Bacteria	813
79	Ga0070693_101478521	3300005547	Unclassified	530
80	Ga0070665_100069291	3300005548	Bacteria	3535
81	Ga0070665_100376943	3300005548	Bacteria	1426
82	Ga0070704_101136202	3300005549	Unclassified	710
83	Ga0068855_100029473	3300005563	Bacteria	6560
84	Ga0068855_100164827	3300005563	Bacteria	2513
85	Ga0068855_100167046	3300005563	Bacteria	2493
86	Ga0068855_100980011	3300005563	Unclassified	889
87	Ga0068855_101340607	3300005563	Unclassified	739
88	Ga0070664_101443034	3300005564	Bacteria	651
89	Ga0070664_101749186	3300005564	Bacteria	589
90	Ga0068857_100022647	3300005577	Bacteria	5526
91	Ga0068857_100290912	3300005577	Unclassified	1504
92	Ga0068852_102283640	3300005616	Unclassified	562
93	Ga0068859_100793534	3300005617	Bacteria	1035
94	Ga0068864_100760677	3300005618	Bacteria	950
95	Ga0068866_10164149	3300005718	Bacteria	1298
96	Ga0068866_10534246	3300005718	Unclassified	781
97	Ga0068866_11157391	3300005718	Unclassified	557
98	Ga0068870_10099918	3300005840	Bacteria	1638
99	Ga0068870_10206273	3300005840	Bacteria	1194
100	Ga0068870_10484828	3300005840	Bacteria	821
101	Ga0068863_101021649	3300005841	Bacteria	830
102	Ga0068863_101297759	3300005841	Unclassified	735
103	Ga0068858_100317637	3300005842	Bacteria	1488
104	Ga0068858_101473965	3300005842	Unclassified	671
105	Ga0068860_100632226	3300005843	Bacteria	1077
106	Ga0081455_10516564	3300005937	Bacteria	798
107	Ga0081539_10010868	3300005985	Bacteria	7312
108	Ga0081539_10134960	3300005985	Unclassified	1207
109	Ga0070717_10055889	3300006028	Bacteria	3259
110	Ga0070717_10618014	3300006028	Bacteria	983
111	Ga0075432_10180245	3300006058	Unclassified	826
112	Ga0070712_100060820	3300006175	Unclassified	2665
113	Ga0070712_100126206	3300006175	Bacteria	1933
114	Ga0075428_100006780	3300006844	Bacteria	12743
115	Ga0075428_100135448	3300006844	Bacteria	2678
116	Ga0075428_100410272	3300006844	Bacteria	1451
117	Ga0075430_100009527	3300006846	Bacteria	8210
118	Ga0075430_100562976	3300006846	Viruses	940
119	Ga0075431_100002379	3300006847	Bacteria	18082
120	Ga0075431_100139189	3300006847	Bacteria	2502
121	Ga0075431_100166719	3300006847	Bacteria	2264
122	Ga0075431_100278052	3300006847	Unclassified	1695
123	Ga0075431_101289556	3300006847	Bacteria	691
124	Ga0075433_10067012	3300006852	Bacteria	3150
125	Ga0075433_10293164	3300006852	Bacteria	1441
126	Ga0075434_100038835	3300006871	Plasmid	4717
127	Ga0075434_100122494	3300006871	Unclassified	2616
128	Ga0075434_100180279	3300006871	Bacteria	2132
129	Ga0075434_101474437	3300006871	Bacteria	690
130	Ga0075434_102071700	3300006871	Bacteria	574
131	Ga0075429_100009758	3300006880	Bacteria	8322
132	Ga0075429_100268260	3300006880	Bacteria	1495
133	Ga0075429_100405123	3300006880	Unclassified	1194
134	Ga0075429_101961948	3300006880	Unclassified	507
135	Ga0068865_100130753	3300006881	Bacteria	1881
136	Ga0075436_101426537	3300006914	Bacteria	525
137	Ga0097620_100793506	3300006931	Bacteria	1035
138	Ga0075435_100142272	3300007076	Bacteria	2013
139	Ga0075435_100492787	3300007076	Bacteria	1059
140	Ga0099794_10364145	3300007265	Unclassified	753
141	Ga0105251_10535511	3300009011	Unclassified	550
142	Ga0105240_10102433	3300009093	Bacteria	3479
143	Ga0111539_10683149	3300009094	Bacteria	1195
144	Ga0111539_11267294	3300009094	Bacteria	856
145	Ga0111539_11327239	3300009094	Bacteria	835
146	Ga0105245_11286666	3300009098	Bacteria	780
147	Ga0114129_10018234	3300009147	Bacteria	9995
148	Ga0114129_10118629	3300009147	Unclassified	3645
149	Ga0114129_11013366	3300009147	Unclassified	1045
150	Ga0114129_11240479	3300009147	Unclassified	927
151	Ga0114129_12852882	3300009147	Unclassified	573
152	Ga0114129_12867641	3300009147	Bacteria	571
153	Ga0105248_10106424	3300009177	Bacteria	3162
154	Ga0105248_10557958	3300009177	Bacteria	1292
155	Ga0105248_12296583	3300009177	Bacteria	614
156	Ga0105237_10031129	3300009545	Bacteria	5411
157	Ga0105237_10383292	3300009545	Bacteria	1411
158	Ga0105238_10399988	3300009551	Unclassified	1367
159	Ga0105249_10339170	3300009553	Bacteria	1519
160	Ga0105249_12656830	3300009553	Bacteria	573
161	Ga0105239_10029273	3300010375	Bacteria	6056
162	Ga0105239_10326826	3300010375	Bacteria	1730
163	Ga0157325_1041523	3300012485	Bacteria	502
164	Ga0157373_10079686	3300013100	Unclassified	2310
165	Ga0157370_10372743	3300013104	Unclassified	1315
166	Ga0157370_11038710	3300013104	Unclassified	741
167	Ga0157370_11082806	3300013104	Bacteria	724
168	Ga0157370_11091271	3300013104	Unclassified	721
169	Ga0157370_11347989	3300013104	Unclassified	642
170	Ga0157369_10065955	3300013105	Bacteria	3895
171	Ga0157369_10075950	3300013105	Bacteria	3602
172	Ga0157369_10192354	3300013105	Unclassified	2144
173	Ga0157369_12435085	3300013105	Unclassified	530
174	Ga0157374_10757851	3300013296	Bacteria	986
175	Ga0163162_12217944	3300013306	Bacteria	631
176	Ga0157372_10092227	3300013307	Unclassified	3445
177	Ga0157372_10197663	3300013307	Unclassified	2329
178	Ga0157372_10231229	3300013307	Unclassified	2144
179	Ga0157372_11608897	3300013307	Bacteria	748
180	Ga0157372_11862220	3300013307	Bacteria	692
181	Ga0157375_10244577	3300013308	Bacteria	1954
182	Ga0163163_10268532	3300014325	Unclassified	1757
183	Ga0157380_10090590	3300014326	Bacteria	2523
184	Ga0157380_10131077	3300014326	Bacteria	2139
185	Ga0157380_10433381	3300014326	Bacteria	1257
186	Ga0157380_12131109	3300014326	Bacteria	624
187	Ga0182008_10535150	3300014497	Unclassified	649
188	Ga0157377_10768476	3300014745	Unclassified	707
189	Ga0157379_10164171	3300014968	Bacteria	2005
190	Ga0157379_10940759	3300014968	Bacteria	821
191	Ga0157376_10841309	3300014969	Bacteria	933
192	Ga0182007_10009243	3300015262	Bacteria	3992
193	Ga0206356_11777161	3300020070	Unclassified	584
194	Ga0206349_1883832	3300020075	Unclassified	541
195	Ga0206351_10679106	3300020077	Bacteria	1240
196	Ga0154015_1275301	3300020610	Bacteria	968
197	Ga0154015_1447290	3300020610	Unclassified	899
198	Ga0224712_10411092	3300022467	Bacteria	646
199	Ga0207682_10111052	3300025893	Unclassified	1207
200	Ga0207642_10045997	3300025899	Bacteria	1941
201	Ga0207642_10655633	3300025899	Unclassified	658
202	Ga0207688_10075408	3300025901	Bacteria	1919
203	Ga0207699_10127451	3300025906	Bacteria	1655
204	Ga0207643_10106887	3300025908	Bacteria	1645
205	Ga0207707_10184007	3300025912	Unclassified	1823
206	Ga0207707_11496392	3300025912	Unclassified	535
207	Ga0207695_10111756	3300025913	Bacteria	2711
208	Ga0207671_10053702	3300025914	Unclassified	2985
209	Ga0207671_10286874	3300025914	Bacteria	1299
210	Ga0207693_10105926	3300025915	Bacteria	2205
211	Ga0207660_10581786	3300025917	Unclassified	911
212	Ga0207660_11354414	3300025917	Bacteria	577
213	Ga0207649_10508088	3300025920	Bacteria	917
214	Ga0207649_10901204	3300025920	Bacteria	693
215	Ga0207649_11446063	3300025920	Bacteria	544
216	Ga0207652_10024545	3300025921	Bacteria	5003
217	Ga0207652_11755785	3300025921	Bacteria	525
218	Ga0207681_11021220	3300025923	Unclassified	694
219	Ga0207694_10377578	3300025924	Unclassified	1176
220	Ga0207650_10900724	3300025925	Bacteria	751
221	Ga0207659_10030537	3300025926	Bacteria	3683
222	Ga0207659_10110022	3300025926	Bacteria	2093
223	Ga0207700_10193914	3300025928	Unclassified	1708
224	Ga0207664_10423748	3300025929	Bacteria	1186
225	Ga0207644_11143838	3300025931	Bacteria	654
226	Ga0207669_10170111	3300025937	Bacteria	1550
227	Ga0207669_10289076	3300025937	Bacteria	1240
228	Ga0207669_10889808	3300025937	Bacteria	743
229	Ga0207704_10158019	3300025938	Bacteria	1609
230	Ga0207691_10274949	3300025940	Bacteria	1450
231	Ga0207691_11576170	3300025940	Bacteria	535
232	Ga0207711_10064591	3300025941	Bacteria	3162
233	Ga0207711_11212279	3300025941	Unclassified	696
234	Ga0207661_10225131	3300025944	Bacteria	1659
235	Ga0207661_11553181	3300025944	Bacteria	606
236	Ga0207679_11609937	3300025945	Bacteria	595
237	Ga0207679_12124443	3300025945	Unclassified	510
238	Ga0207667_10389225	3300025949	Bacteria	1420
239	Ga0207667_10430070	3300025949	Bacteria	1343
240	Ga0207651_10261053	3300025960	Bacteria	1422
241	Ga0207712_10424885	3300025961	Bacteria	1122
242	Ga0207640_10408666	3300025981	Unclassified	1107
243	Ga0207658_10618019	3300025986	Bacteria	975
244	Ga0207677_11273910	3300026023	Bacteria	675
245	Ga0207641_12279691	3300026088	Unclassified	541
246	Ga0207648_10037127	3300026089	Bacteria	4291
247	Ga0207674_10009032	3300026116	Bacteria	11452
248	Ga0207674_10341006	3300026116	Unclassified	1449
249	Ga0207683_10085153	3300026121	Bacteria	2810
250	Ga0207683_10493939	3300026121	Bacteria	1130
251	Ga0207683_10702457	3300026121	Bacteria	938
252	Ga0207683_11599658	3300026121	Unclassified	601
253	Ga0207428_10166993	3300027907	Bacteria	1668
254	Ga0207428_10283052	3300027907	Bacteria	1230
255	Ga0268266_10107512	3300028379	Bacteria	2467
256	Ga0268266_11112184	3300028379	Unclassified	764
257	Ga0268264_10746895	3300028381	Bacteria	974
258	Ga0265336_10075959	3300028666	Bacteria	1003
259	Ga0265338_10278120	3300028800	Bacteria	1224
260	Ga0316177_1079954	3300030731	Bacteria	936
261	Ga0265760_10038520	3300031090	Bacteria	1422
262	Ga0265328_10128089	3300031239	Unclassified	949
263	Ga0265320_10333456	3300031240	Bacteria	670
264	Ga0265325_10251561	3300031241	Unclassified	800
265	Ga0265340_10005195	3300031247	Bacteria	7235
266	Ga0265316_10074447	3300031344	Bacteria	2613
267	Ga0265316_10230510	3300031344	Bacteria	1364
268	Ga0265316_10457409	3300031344	Unclassified	915
269	Ga0307408_101501365	3300031548	Bacteria	637
270	Ga0265314_10152971	3300031711	Unclassified	1412
271	Ga0265314_10312144	3300031711	Bacteria	878
272	Ga0316576_10088029	3300031727	Bacteria	2311
273	Ga0316578_10076555	3300031728	Bacteria	1986
274	Ga0307413_10249581	3300031824	Bacteria	1316
275	Ga0307410_10648967	3300031852	Bacteria	885
276	Ga0307410_10869197	3300031852	Unclassified	771
277	Ga0307406_10161774	3300031901	Bacteria	1610
278	Ga0307406_10275082	3300031901	Bacteria	1281
279	Ga0307407_10720182	3300031903	Bacteria	753
280	Ga0307407_11628808	3300031903	Bacteria	513
281	Ga0307412_11012365	3300031911	Bacteria	735
282	Ga0307416_101069760	3300032002	Unclassified	911
283	Ga0307416_101120918	3300032002	Unclassified	892
284	Ga0307416_101873409	3300032002	Bacteria	703
285	Ga0307416_102819858	3300032002	Bacteria	581
286	Ga0307414_10204234	3300032004	Bacteria	1610
287	Ga0307411_11935647	3300032005	Unclassified	549
288	Ga0307415_100541190	3300032126	Bacteria	1026
289	Ga0316580_10066022	3300032139	Bacteria	1109
290	Ga0316592_1112340	3300033524	Unclassified	630
291	Ga0316588_1092303	3300033528	Unclassified	755
292	Ga0373944_0215023	3300035089	Bacteria	700
293	Ga0373951_0234536	3300035091	Bacteria	546
294	Ga0373961_0000011	3300035241	Bacteria	127972
295	Ga0373924_0113410	3300035410	Bacteria	1173
296	Ga0373931_0971187	3300035691	Bacteria	574
297	Ga0373935_1141700	3300035692	Bacteria	580
298	Ga0373947_0886446	3300035725	Bacteria	609
299	Ga0373937_0022223	3300036401	Bacteria	5701
300	Ga0373937_1667501	3300036401	Bacteria	584
301	Ga0316584_0040941	3300036712	Bacteria	3453
302	Ga0373925_0593287	3300037068	Bacteria	912
303	Ga0395905_0050201	3300037471	Bacteria	3909
304	Ga0395905_0373630	3300037471	Unclassified	1319
305	Ga0451807_2515797	3300041486	Unclassified	602
306	Ga0439441_138766	3300042001	Bacteria	567
307	Ga0439464_0329790	3300042439	Bacteria	501
308	Ga0453683_0587163	3300044673	Unclassified	726
309	Ga0466966_0701299	3300044684	Unclassified	610
310	Ga0451576_0038748	3300045051	Bacteria	5044
311	Ga0466958_0638972	3300045836	Unclassified	693
312	Ga0495592_0042470	3300046454	Bacteria	3405
313	Ga0495651_0430365	3300046462	Bacteria	856
314	Ga0495594_0028853	3300046499	Bacteria	2995
315	Ga0495608_0005371	3300046511	Bacteria	9154
316	Ga0495663_0156468	3300046525	Unclassified	780
317	Ga0495652_0208867	3300046529	Bacteria	1476
318	Ga0495665_0176899	3300046531	Bacteria	1109
319	Ga0495586_0436964	3300046535	Bacteria	754
320	Ga0495587_0141995	3300046536	Bacteria	1370
321	Ga0495609_0233121	3300046538	Unclassified	762
322	Ga0495621_0125418	3300046539	Unclassified	995
323	Ga0495622_0038576	3300046557	Bacteria	2224
324	Ga0495667_0303937	3300046559	Unclassified	1010
325	Ga0495656_0019394	3300046615	Bacteria	2625
326	Ga0495656_0207950	3300046615	Bacteria	974
327	Ga0495588_0027645	3300046674	Bacteria	2835
328	Ga0495599_0029357	3300046678	Bacteria	3448
329	Ga0495669_0622641	3300046684	Unclassified	525
330	Ga0495581_0211364	3300047315	Bacteria	1134
331	Ga0495676_0259655	3300047321	Bacteria	1182
332	Ga0495676_0333036	3300047321	Bacteria	1018
333	Ga0495680_0784637	3300047322	Bacteria	623
334	Ga0495684_0265156	3300047471	Bacteria	1245
335	Ga0495602_0528469	3300048088	Bacteria	821
336	Ga0495615_0256225	3300048090	Unclassified	556
337	Ga0496100_0420198	3300048903	Bacteria	1021
338	Ga0496102_1298620	3300048905	Unclassified	647
339	Ga0496102_1973735	3300048905	Bacteria	500
340	Ga0496103_0514427	3300048906	Unclassified	765
341	Ga0496104_0142591	3300048907	Bacteria	2302
342	Ga0496104_1241610	3300048907	Unclassified	648
343	Ga0496105_0818639	3300048908	Bacteria	707
344	Ga0496107_0995517	3300048910	Unclassified	608
345	Ga0496109_1602944	3300048912	Bacteria	585
346	Ga0496112_0167230	3300048915	Bacteria	2165
347	Ga0496126_0007559	3300048929	Bacteria	11887
348	Ga0501298_202647	3300049521	Bacteria	504
349	Ga0501032_0448678	3300049569	Unclassified	826
350	Ga0501032_0597661	3300049569	Bacteria	702
351	Ga0501033_0023632	3300049570	Bacteria	4636
352	Ga0501033_0725875	3300049570	Unclassified	675
353	Ga0501036_0121780	3300049572	Unclassified	2203
354	Ga0501037_0100007	3300049573	Unclassified	2094
355	Ga0501038_0140715	3300049574	Bacteria	1974
356	Ga0501038_0663354	3300049574	Bacteria	784
357	Ga0501039_0024342	3300049575	Unclassified	4650
358	Ga0501040_0867007	3300049576	Unclassified	654
359	Ga0501042_0537617	3300049578	Bacteria	849
360	Ga0501043_0215890	3300049579	Bacteria	1485
361	Ga0501046_0156306	3300049580	Bacteria	1717
362	Ga0501046_0354311	3300049580	Unclassified	1065
363	Ga0501047_0001948	3300049581	Bacteria	19838
364	Ga0501047_0893645	3300049581	Unclassified	702
365	Ga0501048_0213788	3300049582	Bacteria	1367
366	Ga0501067_0041506	3300049583	Unclassified	2555
367	Ga0501068_0102977	3300049584	Bacteria	1770
368	Ga0501068_0113272	3300049584	Bacteria	1688
369	Ga0501069_0226125	3300049585	Bacteria	1088
370	Ga0501070_0234216	3300049586	Bacteria	1504
371	Ga0501071_1068251	3300049587	Bacteria	624
372	Ga0501072_0812499	3300049588	Unclassified	732
373	Ga0501072_1245828	3300049588	Unclassified	577
374	Ga0501073_0079838	3300049589	Bacteria	2277
375	Ga0501073_0092701	3300049589	Unclassified	2099
376	Ga0501073_0719862	3300049589	Bacteria	688
377	Ga0501073_0898412	3300049589	Unclassified	610
378	Ga0501077_0041031	3300049593	Bacteria	2947
379	Ga0501077_0561835	3300049593	Unclassified	732
380	Ga0501202_027725	3300049652	Bacteria	1166
381	Ga0501080_0252648	3300049742	Bacteria	1607
382	Ga0501080_0322025	3300049742	Bacteria	1399
383	Ga0501083_0038420	3300049744	Bacteria	3254
384	Ga0501083_0078881	3300049744	Unclassified	2184
385	Ga0501083_0096639	3300049744	Bacteria	1949
386	Ga0501035_0500673	3300049822	Bacteria	1000
387	Ga0501035_0668115	3300049822	Bacteria	841
388	Ga0501044_0333822	3300049823	Bacteria	1438
389	Ga0501044_0671996	3300049823	Unclassified	923
390	Ga0501044_0691846	3300049823	Bacteria	906
391	Ga0501212_040465	3300049851	Bacteria	770
392	nmdc:mga05p37_214501_c1	3300050507	Bacteria	2325
393	nmdc:mga05p37_23741_c1	3300050507	Bacteria	7446
394	nmdc:mga05p37_762375_c1	3300050507	Bacteria	1065
395	nmdc:mga09592_136831_c1	3300050508	Unclassified	2110
396	nmdc:mga09592_1628968_c1	3300050508	Unclassified	522
397	nmdc:mga09592_7337_c1	3300050508	Bacteria	8962
398	nmdc:mga09592_88181_c1	3300050508	Bacteria	2649
399	nmdc:mga0qj67_581662_c1	3300050509	Viruses	897
400	nmdc:mga0qj67_619_c1	3300050509	Bacteria	24349
401	nmdc:mga0qj67_807984_c1	3300050509	Unclassified	742
402	nmdc:mga06r32_304576_c1	3300050510	Bacteria	1579
403	nmdc:mga06r32_30651_c1	3300050510	Bacteria	5048
404	nmdc:mga06r32_39678_c1	3300050510	Bacteria	4468
405	nmdc:mga06r32_66803_c1	3300050510	Bacteria	3470
406	nmdc:mga08y16_142237_c1	3300050511	Bacteria	2494
407	nmdc:mga08y16_287283_c1	3300050511	Bacteria	1696
408	nmdc:mga0n895_48307_c1	3300050512	Plasmid	4165
409	nmdc:mga0rr50_215057_c1	3300050513	Bacteria	1585
410	nmdc:mga08x19_1187216_c1	3300050514	Bacteria	541
411	nmdc:mga08x19_1232285_c1	3300050514	Unclassified	530
412	nmdc:mga08x19_7295_c1	3300050514	Bacteria	6564
413	nmdc:mga0a205_408720_c1	3300050515	Bacteria	1220
414	nmdc:mga0a205_44148_c1	3300050515	Bacteria	4296
415	Ga0495601_0001666	3300053077	Bacteria	12258
416	Ga0495619_0001840	3300053085	Bacteria	14113
417	Ga0501084_0000849	3300054114	Bacteria	23630
418	Ga0501084_0485412	3300054114	Bacteria	1044
419	Ga0501082_0909793	3300060353	Bacteria	769
420	Ga0501082_0916166	3300060353	Bacteria	767
421	Ga0530510_0356357	3300061734	Bacteria	1099
422	Ga0530510_1315484	3300061734	Unclassified	554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300006871	Ga0075434_100122494	Ga0075434_1001224942	56
2	3300009094	Ga0111539_11327239	Ga0111539_113272391	58
3	3300015262	Ga0182007_10009243	Ga0182007_100092433	58
4	3300044684	Ga0466966_0701299	Ga0466966_0701299_310_486	58
5	3300045836	Ga0466958_0638972	Ga0466958_0638972_387_563	58
6	3300005355	Ga0070671_101272778	Ga0070671_1012727782	59
7	3300047321	Ga0495676_0259655	Ga0495676_0259655_984_1163	59
8	3300049576	Ga0501040_0867007	Ga0501040_0867007_248_427	59
9	3300005518	Ga0070699_100030384	Ga0070699_1000303844	61
10	3300005343	Ga0070687_101376976	Ga0070687_1013769761	64
11	3300005365	Ga0070688_100895743	Ga0070688_1008957432	64
12	3300005441	Ga0070700_100490190	Ga0070700_1004901902	64
13	3300005842	Ga0068858_101473965	Ga0068858_1014739651	64
14	3300014326	Ga0157380_10433381	Ga0157380_104333813	64
15	3300035241	Ga0373961_0000011	Ga0373961_0000011_12921_13124	67
16	3300005365	Ga0070688_100681412	Ga0070688_1006814123	69
17	3300000549	LJQas_1000015	LJQas_100001518	70
18	3300005295	Ga0065707_10094391	Ga0065707_100943914	70
19	3300005327	Ga0070658_11943277	Ga0070658_119432771	70
20	3300005328	Ga0070676_10314699	Ga0070676_103146993	70
21	3300005328	Ga0070676_10951807	Ga0070676_109518071	70
22	3300005329	Ga0070683_100055880	Ga0070683_1000558804	70
23	3300005329	Ga0070683_100298672	Ga0070683_1002986723	70
24	3300005329	Ga0070683_100513052	Ga0070683_1005130522	70
25	3300005330	Ga0070690_101072655	Ga0070690_1010726552	70
26	3300005331	Ga0070670_101071245	Ga0070670_1010712451	70
27	3300005331	Ga0070670_101688559	Ga0070670_1016885591	70
28	3300005333	Ga0070677_10034893	Ga0070677_100348931	70
29	3300005333	Ga0070677_10659136	Ga0070677_106591362	70
30	3300005333	Ga0070677_10896080	Ga0070677_108960801	70
31	3300005335	Ga0070666_11051031	Ga0070666_110510312	70
32	3300005340	Ga0070689_101259658	Ga0070689_1012596582	70
33	3300005341	Ga0070691_10766495	Ga0070691_107664951	70
34	3300005344	Ga0070661_100858147	Ga0070661_1008581472	70
35	3300005344	Ga0070661_101011925	Ga0070661_1010119252	70
36	3300005344	Ga0070661_101797741	Ga0070661_1017977411	70
37	3300005353	Ga0070669_101263160	Ga0070669_1012631602	70
38	3300005354	Ga0070675_100139052	Ga0070675_1001390523	70
39	3300005354	Ga0070675_100604132	Ga0070675_1006041323	70
40	3300005354	Ga0070675_100757156	Ga0070675_1007571563	70
41	3300005354	Ga0070675_101192278	Ga0070675_1011922782	70
42	3300005356	Ga0070674_100259062	Ga0070674_1002590621	70
43	3300005364	Ga0070673_100080420	Ga0070673_1000804203	70
44	3300005364	Ga0070673_101037080	Ga0070673_1010370802	70
45	3300005364	Ga0070673_102386077	Ga0070673_1023860771	70
46	3300005367	Ga0070667_100850923	Ga0070667_1008509231	70
47	3300005367	Ga0070667_102369871	Ga0070667_1023698711	70
48	3300005434	Ga0070709_10174406	Ga0070709_101744062	70
49	3300005436	Ga0070713_100107324	Ga0070713_1001073242	70
50	3300005439	Ga0070711_100480901	Ga0070711_1004809012	70
51	3300005440	Ga0070705_100139576	Ga0070705_1001395762	70
52	3300005440	Ga0070705_100876721	Ga0070705_1008767213	70
53	3300005444	Ga0070694_100003040	Ga0070694_1000030405	70
54	3300005444	Ga0070694_100603096	Ga0070694_1006030961	70
55	3300005444	Ga0070694_100695426	Ga0070694_1006954262	70
56	3300005445	Ga0070708_100312703	Ga0070708_1003127032	70
57	3300005455	Ga0070663_101295199	Ga0070663_1012951991	70
58	3300005456	Ga0070678_100063442	Ga0070678_1000634425	70
59	3300005456	Ga0070678_100520809	Ga0070678_1005208092	70
60	3300005456	Ga0070678_100976610	Ga0070678_1009766101	70
61	3300005456	Ga0070678_101632087	Ga0070678_1016320871	70
62	3300005457	Ga0070662_100401643	Ga0070662_1004016431	70
63	3300005457	Ga0070662_100788889	Ga0070662_1007888891	70
64	3300005457	Ga0070662_101694640	Ga0070662_1016946401	70
65	3300005458	Ga0070681_11813737	Ga0070681_118137371	70
66	3300005459	Ga0068867_100026630	Ga0068867_1000266304	70
67	3300005459	Ga0068867_100805214	Ga0068867_1008052142	70
68	3300005459	Ga0068867_102095581	Ga0068867_1020955811	70
69	3300005466	Ga0070685_11522650	Ga0070685_115226501	70
70	3300005467	Ga0070706_100527827	Ga0070706_1005278272	70
71	3300005467	Ga0070706_100599724	Ga0070706_1005997242	70
72	3300005471	Ga0070698_100110401	Ga0070698_1001104012	70
73	3300005471	Ga0070698_100209826	Ga0070698_1002098262	70
74	3300005518	Ga0070699_100004087	Ga0070699_10000408725	70
75	3300005518	Ga0070699_100625175	Ga0070699_1006251751	70
76	3300005518	Ga0070699_101376115	Ga0070699_1013761152	70
77	3300005530	Ga0070679_100222394	Ga0070679_1002223943	70
78	3300005535	Ga0070684_100079383	Ga0070684_1000793833	70
79	3300005535	Ga0070684_101582732	Ga0070684_1015827321	70
80	3300005535	Ga0070684_101995275	Ga0070684_1019952752	70
81	3300005536	Ga0070697_100081862	Ga0070697_1000818624	70
82	3300005536	Ga0070697_100375693	Ga0070697_1003756932	70
83	3300005536	Ga0070697_100401766	Ga0070697_1004017662	70
84	3300005543	Ga0070672_100205242	Ga0070672_1002052423	70
85	3300005545	Ga0070695_100686172	Ga0070695_1006861722	70
86	3300005545	Ga0070695_101305456	Ga0070695_1013054562	70
87	3300005546	Ga0070696_100048351	Ga0070696_1000483514	70
88	3300005546	Ga0070696_100723259	Ga0070696_1007232592	70
89	3300005547	Ga0070693_101478521	Ga0070693_1014785212	70
90	3300005548	Ga0070665_100069291	Ga0070665_1000692916	70
91	3300005548	Ga0070665_100376943	Ga0070665_1003769434	70
92	3300005549	Ga0070704_101136202	Ga0070704_1011362021	70
93	3300005563	Ga0068855_100029473	Ga0068855_1000294738	70
94	3300005563	Ga0068855_100164827	Ga0068855_1001648275	70
95	3300005563	Ga0068855_100167046	Ga0068855_1001670463	70
96	3300005563	Ga0068855_100980011	Ga0068855_1009800113	70
97	3300005563	Ga0068855_101340607	Ga0068855_1013406071	70
98	3300005564	Ga0070664_101443034	Ga0070664_1014430341	70
99	3300005564	Ga0070664_101749186	Ga0070664_1017491861	70
100	3300005577	Ga0068857_100022647	Ga0068857_1000226478	70
101	3300005577	Ga0068857_100290912	Ga0068857_1002909122	70
102	3300005616	Ga0068852_102283640	Ga0068852_1022836402	70
103	3300005617	Ga0068859_100793534	Ga0068859_1007935342	70
104	3300005618	Ga0068864_100760677	Ga0068864_1007606771	70
105	3300005718	Ga0068866_10164149	Ga0068866_101641492	70
106	3300005718	Ga0068866_10534246	Ga0068866_105342462	70
107	3300005718	Ga0068866_11157391	Ga0068866_111573912	70
108	3300005840	Ga0068870_10099918	Ga0068870_100999182	70
109	3300005840	Ga0068870_10206273	Ga0068870_102062732	70
110	3300005840	Ga0068870_10484828	Ga0068870_104848283	70
111	3300005841	Ga0068863_101021649	Ga0068863_1010216492	70
112	3300005841	Ga0068863_101297759	Ga0068863_1012977592	70
113	3300005842	Ga0068858_100317637	Ga0068858_1003176372	70
114	3300005843	Ga0068860_100632226	Ga0068860_1006322263	70
115	3300005937	Ga0081455_10516564	Ga0081455_105165642	70
116	3300005985	Ga0081539_10010868	Ga0081539_100108686	70
117	3300005985	Ga0081539_10134960	Ga0081539_101349602	70
118	3300006028	Ga0070717_10055889	Ga0070717_100558893	70
119	3300006028	Ga0070717_10618014	Ga0070717_106180142	70
120	3300006058	Ga0075432_10180245	Ga0075432_101802452	70
121	3300006175	Ga0070712_100060820	Ga0070712_1000608202	70
122	3300006175	Ga0070712_100126206	Ga0070712_1001262063	70
123	3300006844	Ga0075428_100006780	Ga0075428_10000678014	70
124	3300006844	Ga0075428_100135448	Ga0075428_1001354483	70
125	3300006844	Ga0075428_100410272	Ga0075428_1004102722	70
126	3300006846	Ga0075430_100009527	Ga0075430_10000952712	70
127	3300006846	Ga0075430_100562976	Ga0075430_1005629763	70
128	3300006847	Ga0075431_100002379	Ga0075431_1000023799	70
129	3300006847	Ga0075431_100139189	Ga0075431_1001391895	70
130	3300006847	Ga0075431_100166719	Ga0075431_1001667194	70
131	3300006847	Ga0075431_100278052	Ga0075431_1002780524	70
132	3300006847	Ga0075431_101289556	Ga0075431_1012895562	70
133	3300006852	Ga0075433_10067012	Ga0075433_100670124	70
134	3300006852	Ga0075433_10293164	Ga0075433_102931642	70
135	3300006871	Ga0075434_100038835	Ga0075434_1000388356	70
136	3300006871	Ga0075434_100180279	Ga0075434_1001802793	70
137	3300006871	Ga0075434_101474437	Ga0075434_1014744372	70
138	3300006871	Ga0075434_102071700	Ga0075434_1020717002	70
139	3300006880	Ga0075429_100009758	Ga0075429_1000097588	70
140	3300006880	Ga0075429_100268260	Ga0075429_1002682603	70
141	3300006880	Ga0075429_100405123	Ga0075429_1004051232	70
142	3300006880	Ga0075429_101961948	Ga0075429_1019619482	70
143	3300006881	Ga0068865_100130753	Ga0068865_1001307533	70
144	3300006914	Ga0075436_101426537	Ga0075436_1014265371	70
145	3300006931	Ga0097620_100793506	Ga0097620_1007935062	70
146	3300007076	Ga0075435_100142272	Ga0075435_1001422722	70
147	3300007076	Ga0075435_100492787	Ga0075435_1004927872	70
148	3300007265	Ga0099794_10364145	Ga0099794_103641452	70
149	3300009011	Ga0105251_10535511	Ga0105251_105355111	70
150	3300009093	Ga0105240_10102433	Ga0105240_101024335	70
151	3300009094	Ga0111539_10683149	Ga0111539_106831492	70
152	3300009094	Ga0111539_11267294	Ga0111539_112672942	70
153	3300009098	Ga0105245_11286666	Ga0105245_112866662	70
154	3300009147	Ga0114129_10018234	Ga0114129_1001823416	70
155	3300009147	Ga0114129_10118629	Ga0114129_101186293	70
156	3300009147	Ga0114129_11013366	Ga0114129_110133661	70
157	3300009147	Ga0114129_11240479	Ga0114129_112404792	70
158	3300009147	Ga0114129_12852882	Ga0114129_128528822	70
159	3300009147	Ga0114129_12867641	Ga0114129_128676412	70
160	3300009177	Ga0105248_10106424	Ga0105248_101064244	70
161	3300009177	Ga0105248_10557958	Ga0105248_105579583	70
162	3300009177	Ga0105248_12296583	Ga0105248_122965831	70
163	3300009545	Ga0105237_10031129	Ga0105237_100311297	70
164	3300009545	Ga0105237_10383292	Ga0105237_103832923	70
165	3300009551	Ga0105238_10399988	Ga0105238_103999882	70
166	3300009553	Ga0105249_10339170	Ga0105249_103391703	70
167	3300009553	Ga0105249_12656830	Ga0105249_126568301	70
168	3300010375	Ga0105239_10029273	Ga0105239_100292738	70
169	3300010375	Ga0105239_10326826	Ga0105239_103268263	70
170	3300012485	Ga0157325_1041523	Ga0157325_10415232	70
171	3300013100	Ga0157373_10079686	Ga0157373_100796862	70
172	3300013104	Ga0157370_10372743	Ga0157370_103727431	70
173	3300013104	Ga0157370_11038710	Ga0157370_110387101	70
174	3300013104	Ga0157370_11082806	Ga0157370_110828062	70
175	3300013104	Ga0157370_11091271	Ga0157370_110912712	70
176	3300013104	Ga0157370_11347989	Ga0157370_113479893	70
177	3300013105	Ga0157369_10065955	Ga0157369_100659554	70
178	3300013105	Ga0157369_10075950	Ga0157369_100759504	70
179	3300013105	Ga0157369_10192354	Ga0157369_101923543	70
180	3300013105	Ga0157369_12435085	Ga0157369_124350852	70
181	3300013296	Ga0157374_10757851	Ga0157374_107578513	70
182	3300013306	Ga0163162_12217944	Ga0163162_122179442	70
183	3300013307	Ga0157372_10092227	Ga0157372_100922274	70
184	3300013307	Ga0157372_10197663	Ga0157372_101976635	70
185	3300013307	Ga0157372_10231229	Ga0157372_102312292	70
186	3300013307	Ga0157372_11608897	Ga0157372_116088972	70
187	3300013307	Ga0157372_11862220	Ga0157372_118622202	70
188	3300013308	Ga0157375_10244577	Ga0157375_102445773	70
189	3300014325	Ga0163163_10268532	Ga0163163_102685322	70
190	3300014326	Ga0157380_10090590	Ga0157380_100905904	70
191	3300014326	Ga0157380_10131077	Ga0157380_101310772	70
192	3300014326	Ga0157380_12131109	Ga0157380_121311092	70
193	3300014497	Ga0182008_10535150	Ga0182008_105351502	70
194	3300014745	Ga0157377_10768476	Ga0157377_107684762	70
195	3300014968	Ga0157379_10164171	Ga0157379_101641712	70
196	3300014968	Ga0157379_10940759	Ga0157379_109407593	70
197	3300014969	Ga0157376_10841309	Ga0157376_108413092	70
198	3300020070	Ga0206356_11777161	Ga0206356_117771612	70
199	3300020075	Ga0206349_1883832	Ga0206349_18838321	70
200	3300020077	Ga0206351_10679106	Ga0206351_106791063	70
201	3300020610	Ga0154015_1275301	Ga0154015_12753011	70
202	3300020610	Ga0154015_1447290	Ga0154015_14472903	70
203	3300022467	Ga0224712_10411092	Ga0224712_104110922	70
204	3300025893	Ga0207682_10111052	Ga0207682_101110522	70
205	3300025899	Ga0207642_10045997	Ga0207642_100459972	70
206	3300025899	Ga0207642_10655633	Ga0207642_106556332	70
207	3300025901	Ga0207688_10075408	Ga0207688_100754083	70
208	3300025906	Ga0207699_10127451	Ga0207699_101274512	70
209	3300025908	Ga0207643_10106887	Ga0207643_101068873	70
210	3300025912	Ga0207707_10184007	Ga0207707_101840072	70
211	3300025912	Ga0207707_11496392	Ga0207707_114963921	70
212	3300025913	Ga0207695_10111756	Ga0207695_101117565	70
213	3300025914	Ga0207671_10053702	Ga0207671_100537024	70
214	3300025914	Ga0207671_10286874	Ga0207671_102868743	70
215	3300025915	Ga0207693_10105926	Ga0207693_101059263	70
216	3300025917	Ga0207660_10581786	Ga0207660_105817862	70
217	3300025917	Ga0207660_11354414	Ga0207660_113544142	70
218	3300025920	Ga0207649_10508088	Ga0207649_105080881	70
219	3300025920	Ga0207649_10901204	Ga0207649_109012042	70
220	3300025920	Ga0207649_11446063	Ga0207649_114460631	70
221	3300025921	Ga0207652_10024545	Ga0207652_100245456	70
222	3300025921	Ga0207652_11755785	Ga0207652_117557851	70
223	3300025923	Ga0207681_11021220	Ga0207681_110212201	70
224	3300025924	Ga0207694_10377578	Ga0207694_103775783	70
225	3300025925	Ga0207650_10900724	Ga0207650_109007243	70
226	3300025926	Ga0207659_10030537	Ga0207659_100305373	70
227	3300025926	Ga0207659_10110022	Ga0207659_101100223	70
228	3300025928	Ga0207700_10193914	Ga0207700_101939143	70
229	3300025929	Ga0207664_10423748	Ga0207664_104237482	70
230	3300025931	Ga0207644_11143838	Ga0207644_111438382	70
231	3300025937	Ga0207669_10170111	Ga0207669_101701113	70
232	3300025937	Ga0207669_10289076	Ga0207669_102890763	70
233	3300025937	Ga0207669_10889808	Ga0207669_108898082	70
234	3300025938	Ga0207704_10158019	Ga0207704_101580194	70
235	3300025940	Ga0207691_10274949	Ga0207691_102749492	70
236	3300025940	Ga0207691_11576170	Ga0207691_115761702	70
237	3300025941	Ga0207711_10064591	Ga0207711_100645912	70
238	3300025941	Ga0207711_11212279	Ga0207711_112122792	70
239	3300025944	Ga0207661_10225131	Ga0207661_102251313	70
240	3300025944	Ga0207661_11553181	Ga0207661_115531812	70
241	3300025945	Ga0207679_11609937	Ga0207679_116099372	70
242	3300025945	Ga0207679_12124443	Ga0207679_121244431	70
243	3300025949	Ga0207667_10389225	Ga0207667_103892254	70
244	3300025949	Ga0207667_10430070	Ga0207667_104300703	70
245	3300025960	Ga0207651_10261053	Ga0207651_102610532	70
246	3300025961	Ga0207712_10424885	Ga0207712_104248852	70
247	3300025981	Ga0207640_10408666	Ga0207640_104086661	70
248	3300025986	Ga0207658_10618019	Ga0207658_106180193	70
249	3300026023	Ga0207677_11273910	Ga0207677_112739102	70
250	3300026088	Ga0207641_12279691	Ga0207641_122796912	70
251	3300026089	Ga0207648_10037127	Ga0207648_100371275	70
252	3300026116	Ga0207674_10009032	Ga0207674_1000903213	70
253	3300026116	Ga0207674_10341006	Ga0207674_103410062	70
254	3300026121	Ga0207683_10085153	Ga0207683_100851535	70
255	3300026121	Ga0207683_10493939	Ga0207683_104939392	70
256	3300026121	Ga0207683_10702457	Ga0207683_107024572	70
257	3300026121	Ga0207683_11599658	Ga0207683_115996582	70
258	3300027907	Ga0207428_10166993	Ga0207428_101669933	70
259	3300027907	Ga0207428_10283052	Ga0207428_102830522	70
260	3300028379	Ga0268266_10107512	Ga0268266_101075125	70
261	3300028379	Ga0268266_11112184	Ga0268266_111121841	70
262	3300028381	Ga0268264_10746895	Ga0268264_107468952	70
263	3300028666	Ga0265336_10075959	Ga0265336_100759593	70
264	3300028800	Ga0265338_10278120	Ga0265338_102781203	70
265	3300030731	Ga0316177_1079954	Ga0316177_10799543	70
266	3300031090	Ga0265760_10038520	Ga0265760_100385203	70
267	3300031239	Ga0265328_10128089	Ga0265328_101280892	70
268	3300031240	Ga0265320_10333456	Ga0265320_103334562	70
269	3300031241	Ga0265325_10251561	Ga0265325_102515612	70
270	3300031247	Ga0265340_10005195	Ga0265340_100051952	70
271	3300031344	Ga0265316_10074447	Ga0265316_100744473	70
272	3300031344	Ga0265316_10230510	Ga0265316_102305101	70
273	3300031344	Ga0265316_10457409	Ga0265316_104574091	70
274	3300031548	Ga0307408_101501365	Ga0307408_1015013652	70
275	3300031711	Ga0265314_10152971	Ga0265314_101529713	70
276	3300031711	Ga0265314_10312144	Ga0265314_103121442	70
277	3300031727	Ga0316576_10088029	Ga0316576_100880294	70
278	3300031728	Ga0316578_10076555	Ga0316578_100765552	70
279	3300031824	Ga0307413_10249581	Ga0307413_102495812	70
280	3300031852	Ga0307410_10648967	Ga0307410_106489672	70
281	3300031852	Ga0307410_10869197	Ga0307410_108691971	70
282	3300031901	Ga0307406_10161774	Ga0307406_101617744	70
283	3300031901	Ga0307406_10275082	Ga0307406_102750822	70
284	3300031903	Ga0307407_10720182	Ga0307407_107201822	70
285	3300031903	Ga0307407_11628808	Ga0307407_116288081	70
286	3300031911	Ga0307412_11012365	Ga0307412_110123651	70
287	3300032002	Ga0307416_101069760	Ga0307416_1010697602	70
288	3300032002	Ga0307416_101120918	Ga0307416_1011209182	70
289	3300032002	Ga0307416_101873409	Ga0307416_1018734092	70
290	3300032002	Ga0307416_102819858	Ga0307416_1028198582	70
291	3300032004	Ga0307414_10204234	Ga0307414_102042341	70
292	3300032005	Ga0307411_11935647	Ga0307411_119356471	70
293	3300032126	Ga0307415_100541190	Ga0307415_1005411903	70
294	3300032139	Ga0316580_10066022	Ga0316580_100660223	70
295	3300033524	Ga0316592_1112340	Ga0316592_11123401	70
296	3300033528	Ga0316588_1092303	Ga0316588_10923032	70
297	3300035089	Ga0373944_0215023	Ga0373944_0215023_471_683	70
298	3300035091	Ga0373951_0234536	Ga0373951_0234536_299_511	70
299	3300035410	Ga0373924_0113410	Ga0373924_0113410_199_411	70
300	3300035691	Ga0373931_0971187	Ga0373931_0971187_346_558	70
301	3300035692	Ga0373935_1141700	Ga0373935_1141700_79_291	70
302	3300035725	Ga0373947_0886446	Ga0373947_0886446_69_281	70
303	3300036401	Ga0373937_0022223	Ga0373937_0022223_977_1189	70
304	3300036401	Ga0373937_1667501	Ga0373937_1667501_97_309	70
305	3300036712	Ga0316584_0040941	Ga0316584_0040941_993_1205	70
306	3300037068	Ga0373925_0593287	Ga0373925_0593287_588_800	70
307	3300037471	Ga0395905_0050201	Ga0395905_0050201_421_633	70
308	3300037471	Ga0395905_0373630	Ga0395905_0373630_662_874	70
309	3300041486	Ga0451807_2515797	Ga0451807_2515797_262_474	70
310	3300042001	Ga0439441_138766	Ga0439441_138766_246_458	70
311	3300042439	Ga0439464_0329790	Ga0439464_0329790_23_235	70
312	3300044673	Ga0453683_0587163	Ga0453683_0587163_197_409	70
313	3300045051	Ga0451576_0038748	Ga0451576_0038748_495_707	70
314	3300046454	Ga0495592_0042470	Ga0495592_0042470_636_848	70
315	3300046462	Ga0495651_0430365	Ga0495651_0430365_229_441	70
316	3300046499	Ga0495594_0028853	Ga0495594_0028853_1565_1777	70
317	3300046511	Ga0495608_0005371	Ga0495608_0005371_8926_9138	70
318	3300046525	Ga0495663_0156468	Ga0495663_0156468_24_236	70
319	3300046529	Ga0495652_0208867	Ga0495652_0208867_831_1043	70
320	3300046531	Ga0495665_0176899	Ga0495665_0176899_766_978	70
321	3300046535	Ga0495586_0436964	Ga0495586_0436964_349_561	70
322	3300046536	Ga0495587_0141995	Ga0495587_0141995_229_441	70
323	3300046538	Ga0495609_0233121	Ga0495609_0233121_49_261	70
324	3300046539	Ga0495621_0125418	Ga0495621_0125418_395_607	70
325	3300046557	Ga0495622_0038576	Ga0495622_0038576_1018_1230	70
326	3300046559	Ga0495667_0303937	Ga0495667_0303937_537_749	70
327	3300046615	Ga0495656_0019394	Ga0495656_0019394_513_725	70
328	3300046615	Ga0495656_0207950	Ga0495656_0207950_79_291	70
329	3300046674	Ga0495588_0027645	Ga0495588_0027645_1830_2042	70
330	3300046678	Ga0495599_0029357	Ga0495599_0029357_2479_2691	70
331	3300046684	Ga0495669_0622641	Ga0495669_0622641_94_306	70
332	3300047315	Ga0495581_0211364	Ga0495581_0211364_132_344	70
333	3300047321	Ga0495676_0333036	Ga0495676_0333036_678_890	70
334	3300047322	Ga0495680_0784637	Ga0495680_0784637_137_349	70
335	3300047471	Ga0495684_0265156	Ga0495684_0265156_790_1002	70
336	3300048088	Ga0495602_0528469	Ga0495602_0528469_440_652	70
337	3300048090	Ga0495615_0256225	Ga0495615_0256225_60_272	70
338	3300048903	Ga0496100_0420198	Ga0496100_0420198_676_888	70
339	3300048905	Ga0496102_1298620	Ga0496102_1298620_300_524	70
340	3300048905	Ga0496102_1973735	Ga0496102_1973735_248_460	70
341	3300048906	Ga0496103_0514427	Ga0496103_0514427_429_653	70
342	3300048907	Ga0496104_0142591	Ga0496104_0142591_722_946	70
343	3300048907	Ga0496104_1241610	Ga0496104_1241610_171_383	70
344	3300048908	Ga0496105_0818639	Ga0496105_0818639_333_545	70
345	3300048910	Ga0496107_0995517	Ga0496107_0995517_221_433	70
346	3300048912	Ga0496109_1602944	Ga0496109_1602944_137_349	70
347	3300048915	Ga0496112_0167230	Ga0496112_0167230_332_544	70
348	3300048929	Ga0496126_0007559	Ga0496126_0007559_1112_1324	70
349	3300049521	Ga0501298_202647	Ga0501298_202647_62_274	70
350	3300049569	Ga0501032_0448678	Ga0501032_0448678_561_773	70
351	3300049569	Ga0501032_0597661	Ga0501032_0597661_180_392	70
352	3300049570	Ga0501033_0023632	Ga0501033_0023632_3190_3402	70
353	3300049570	Ga0501033_0725875	Ga0501033_0725875_254_466	70
354	3300049572	Ga0501036_0121780	Ga0501036_0121780_924_1136	70
355	3300049573	Ga0501037_0100007	Ga0501037_0100007_1620_1832	70
356	3300049574	Ga0501038_0140715	Ga0501038_0140715_1191_1403	70
357	3300049574	Ga0501038_0663354	Ga0501038_0663354_508_720	70
358	3300049575	Ga0501039_0024342	Ga0501039_0024342_3629_3841	70
359	3300049578	Ga0501042_0537617	Ga0501042_0537617_76_288	70
360	3300049579	Ga0501043_0215890	Ga0501043_0215890_664_876	70
361	3300049580	Ga0501046_0156306	Ga0501046_0156306_192_404	70
362	3300049580	Ga0501046_0354311	Ga0501046_0354311_717_929	70
363	3300049581	Ga0501047_0001948	Ga0501047_0001948_2735_2947	70
364	3300049581	Ga0501047_0893645	Ga0501047_0893645_36_248	70
365	3300049582	Ga0501048_0213788	Ga0501048_0213788_964_1176	70
366	3300049583	Ga0501067_0041506	Ga0501067_0041506_1835_2047	70
367	3300049584	Ga0501068_0102977	Ga0501068_0102977_909_1121	70
368	3300049584	Ga0501068_0113272	Ga0501068_0113272_284_496	70
369	3300049585	Ga0501069_0226125	Ga0501069_0226125_441_653	70
370	3300049586	Ga0501070_0234216	Ga0501070_0234216_128_340	70
371	3300049587	Ga0501071_1068251	Ga0501071_1068251_90_302	70
372	3300049588	Ga0501072_0812499	Ga0501072_0812499_184_396	70
373	3300049588	Ga0501072_1245828	Ga0501072_1245828_30_242	70
374	3300049589	Ga0501073_0079838	Ga0501073_0079838_1657_1869	70
375	3300049589	Ga0501073_0092701	Ga0501073_0092701_1113_1325	70
376	3300049589	Ga0501073_0719862	Ga0501073_0719862_342_554	70
377	3300049589	Ga0501073_0898412	Ga0501073_0898412_303_515	70
378	3300049593	Ga0501077_0041031	Ga0501077_0041031_2680_2892	70
379	3300049593	Ga0501077_0561835	Ga0501077_0561835_336_548	70
380	3300049652	Ga0501202_027725	Ga0501202_027725_722_934	70
381	3300049742	Ga0501080_0252648	Ga0501080_0252648_1161_1373	70
382	3300049742	Ga0501080_0322025	Ga0501080_0322025_935_1147	70
383	3300049744	Ga0501083_0038420	Ga0501083_0038420_2810_3022	70
384	3300049744	Ga0501083_0078881	Ga0501083_0078881_1952_2164	70
385	3300049744	Ga0501083_0096639	Ga0501083_0096639_1549_1761	70
386	3300049822	Ga0501035_0500673	Ga0501035_0500673_260_472	70
387	3300049822	Ga0501035_0668115	Ga0501035_0668115_277_489	70
388	3300049823	Ga0501044_0333822	Ga0501044_0333822_753_965	70
389	3300049823	Ga0501044_0671996	Ga0501044_0671996_259_471	70
390	3300049823	Ga0501044_0691846	Ga0501044_0691846_263_475	70
391	3300049851	Ga0501212_040465	Ga0501212_040465_459_671	70
392	3300050507	nmdc:mga05p37_214501_c1	nmdc:mga05p37_214501_c1_1525_1737	70
393	3300050507	nmdc:mga05p37_23741_c1	nmdc:mga05p37_23741_c1_4274_4486	70
394	3300050507	nmdc:mga05p37_762375_c1	nmdc:mga05p37_762375_c1_282_494	70
395	3300050508	nmdc:mga09592_136831_c1	nmdc:mga09592_136831_c1_1270_1482	70
396	3300050508	nmdc:mga09592_1628968_c1	nmdc:mga09592_1628968_c1_67_279	70
397	3300050508	nmdc:mga09592_7337_c1	nmdc:mga09592_7337_c1_2001_2213	70
398	3300050508	nmdc:mga09592_88181_c1	nmdc:mga09592_88181_c1_1633_1845	70
399	3300050509	nmdc:mga0qj67_581662_c1	nmdc:mga0qj67_581662_c1_430_642	70
400	3300050509	nmdc:mga0qj67_619_c1	nmdc:mga0qj67_619_c1_23858_24070	70
401	3300050509	nmdc:mga0qj67_807984_c1	nmdc:mga0qj67_807984_c1_494_706	70
402	3300050510	nmdc:mga06r32_304576_c1	nmdc:mga06r32_304576_c1_187_399	70
403	3300050510	nmdc:mga06r32_30651_c1	nmdc:mga06r32_30651_c1_1895_2107	70
404	3300050510	nmdc:mga06r32_39678_c1	nmdc:mga06r32_39678_c1_3666_3878	70
405	3300050510	nmdc:mga06r32_66803_c1	nmdc:mga06r32_66803_c1_2681_2893	70
406	3300050511	nmdc:mga08y16_142237_c1	nmdc:mga08y16_142237_c1_151_363	70
407	3300050511	nmdc:mga08y16_287283_c1	nmdc:mga08y16_287283_c1_284_496	70
408	3300050512	nmdc:mga0n895_48307_c1	nmdc:mga0n895_48307_c1_73_285	70
409	3300050513	nmdc:mga0rr50_215057_c1	nmdc:mga0rr50_215057_c1_1189_1401	70
410	3300050514	nmdc:mga08x19_1187216_c1	nmdc:mga08x19_1187216_c1_26_238	70
411	3300050514	nmdc:mga08x19_1232285_c1	nmdc:mga08x19_1232285_c1_222_434	70
412	3300050514	nmdc:mga08x19_7295_c1	nmdc:mga08x19_7295_c1_2383_2595	70
413	3300050515	nmdc:mga0a205_408720_c1	nmdc:mga0a205_408720_c1_416_628	70
414	3300050515	nmdc:mga0a205_44148_c1	nmdc:mga0a205_44148_c1_3770_3982	70
415	3300053077	Ga0495601_0001666	Ga0495601_0001666_6559_6771	70
416	3300053085	Ga0495619_0001840	Ga0495619_0001840_3804_4016	70
417	3300054114	Ga0501084_0000849	Ga0501084_0000849_14726_14938	70
418	3300054114	Ga0501084_0485412	Ga0501084_0485412_612_824	70
419	3300060353	Ga0501082_0909793	Ga0501082_0909793_310_522	70
420	3300060353	Ga0501082_0916166	Ga0501082_0916166_12_224	70
421	3300061734	Ga0530510_0356357	Ga0530510_0356357_88_300	70
422	3300061734	Ga0530510_1315484	Ga0530510_1315484_148_360	70

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07927

HicA_toxin

HicA toxin of bacterial toxin-antitoxin,

12

72

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6g26-assembly1.cif.gz_F	the crystal structure of the burkholderia pseudomallei hicab complex	0.9201	8	65
6g26-assembly1.cif.gz_F	the crystal structure of the burkholderia pseudomallei hicab complex	0.8776	8	65
5yrz-assembly1.cif.gz_D	toxin-antitoxin complex from streptococcus pneumoniae	0.8479	10	65
1whz-assembly1.cif.gz_A	crystal structure of a hypothetical protein from thermus thermophilus hb8	0.8429	4	69
4c26-assembly1.cif.gz_A	solution nmr structure of the hica toxin from burkholderia pseudomallei	0.8331	12	65

ID	Description	Score	Start	End	Superfamily
6g26F00	Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein.	0.9201	8	65	3.30.920.30
af_Q54V25_1_59_3.30.920.30	Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein.	0.9016	7	65	3.30.920.30
af_Q54V25_1_59_3.30.920.30	Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein.	0.888	7	65	3.30.920.30
6g26F00	Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein.	0.8776	8	65	3.30.920.30
5yrzD00	Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein.	0.8479	10	65	3.30.920.30

ID	Description	Score	Start	End	GO Terms
AF-A0A1G2UIJ2-F1-model_v4	Addiction module toxin, HicA family	0.9661	4	70	GO:0003729 GO:0004519
AF-A0A1R4HC55-F1-model_v4	Putative periplasmic or secreted lipoprotein (Modular protein)	0.9594	5	70	GO:0003729 GO:0004519
AF-A0A2T1EK84-F1-model_v4	Type II toxin-antitoxin system HicA family toxin	0.9573	9	70	GO:0003729 GO:0004519
AF-A0A2V5NHJ4-F1-model_v4	Type II toxin-antitoxin system HicA family toxin	0.9566	6	70	GO:0003729 GO:0004519
AF-A0A833D5E3-F1-model_v4	Type II toxin-antitoxin system HicA family toxin	0.9533	1	69	GO:0003729 GO:0004519

Feature Viewer

pLDDT	pTM	Quality
92.36	0.79	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F440255

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF07927

HicA_toxin

HicA toxin of bacterial toxin-antitoxin,

12

72

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map