metagRoot

F440104

General Info

Members	Datasets	Scaffolds	Average Seq Length
421	265	387	323

Family's Representative Sequence

Representative Sequence	3300048925\|Ga0496122_0005047\|Ga0496122_0005047_6827_7951
Length	374
Sequence	MPQPEWQVRRRVHPDHAAARIVAHAADKSGEGGNFSPVAASNGHPIVLLENVMSLRDALKIPEWQVTDETVHAARRGFLQSLAATPVLALAGCADAEPPAAPQPTVTPEQARSGFRTSEELTRIEDVTSYNNFYEFGTAKNDPSQAPKTLKTSPWTISVSGECDKPGRIGLEDLLKAGTSEERIYRLRCVEGWSMVIPWLGIPLAPVLSRFAPNSKAKYVAFTTLADPKQMPQIRYRSINWPYREGLRMDEAMNPLTFLATGLYGKPLPQQNGAPLRLVVPWKYGFKSIKSIVEIKFVERMPETAWHDLQPSEYGFFSNVNPNVDHPRWSQKSERRIAGTASKLFAERIPTRPFNGYGEQVASMYAGMDLKKWY

Samples

	Sample ID	Description	Type	Environment
1	2524614729	Arenimonas oryziterrae YC6267, DSM 21050	Isolate	Rhizosphere
2	2571042365	Lysobacter oryzae DSM 21044	Isolate	Rhizosphere
3	2627854209	Arenimonas oryziterrae YC6267, DSM 21050	Isolate	Rhizosphere
4	2643221559	Lysobacter sp. Root559	Isolate	Unclassified
5	2643221573	Lysobacter sp. Root604	Isolate	Unclassified
6	2643221579	Pseudoxanthomonas sp. Root630	Isolate	Unclassified
7	2643221581	Pseudoxanthomonas sp. Root65	Isolate	Unclassified
8	2643221586	Lysobacter sp. Root667	Isolate	Unclassified
9	2643221593	Lysobacter sp. Root690	Isolate	Unclassified
10	2643221612	Lysobacter sp. Root76	Isolate	Unclassified
11	2643221695	Lysobacter sp. Root494	Isolate	Unclassified
12	2643221720	Lysobacter sp. Root916	Isolate	Unclassified
13	2643221727	Lysobacter sp. Root96	Isolate	Unclassified
14	2643221728	Lysobacter sp. Root983	Isolate	Unclassified
15	2747842501	Xanthomonas sp. WCS2014-23	Isolate	Unclassified
16	2818991457	Xanthomonas translucens 569	Isolate	Unclassified
17	2842780639	Pseudoxanthomonas sp. R-71986	Isolate	Unclassified
18	2852684882	Xanthomonas sp. JAI131	Isolate	Rhizosphere
19	2894414249	Luteimonas sp. LNNU 24178	Isolate	Rhizosphere
20	2895498888	Pseudoxanthomonas sp. SGD-10	Isolate	Rhizosphere
21	2895511927	Pseudoxanthomonas sp. SGD-5-1	Isolate	Rhizosphere
22	2895522137	Pseudoxanthomonas sp. SGNA-20	Isolate	Rhizosphere
23	2895525241	Pseudoxanthomonas sp. SGT-18	Isolate	Rhizosphere
24	2919130084	Xanthomonas sp. 1678	Isolate	Rhizosphere
25	2919513703	Luteimonas sp. 3794	Isolate	Unclassified
26	2919675420	Luteimonas terrae 4099	Isolate	Unclassified
27	2923516293	Pseudoxanthomonas mexicana SLBN-89	Isolate	Rhizosphere
28	2929195423	Xanthomonas sp. R-73098 Hybrid assembly	Isolate	Unclassified
29	2941489479	Lysobacter enzymogenes 2943	Isolate	Rhizosphere
30	2995948881	Lysobacter enzymogenes B25	Isolate	Unclassified
31	3300000546	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled	Metagenome	Rhizosphere
32	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
33	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
34	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
35	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
36	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
37	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
38	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
39	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
40	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
41	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
42	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
43	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
44	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
45	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
46	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
47	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
48	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
49	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
50	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
51	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
52	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
53	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
54	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
55	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
56	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
57	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
58	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
59	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
60	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
61	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
62	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
63	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
64	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
65	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
66	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
67	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
68	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
69	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
70	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
71	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
72	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
73	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
74	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
75	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
76	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
77	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
78	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
79	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
80	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
82	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
83	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
84	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
85	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
86	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
87	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
88	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
89	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
90	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
91	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
92	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
93	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
94	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
95	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
96	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
97	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
98	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
99	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
100	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
101	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
102	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
103	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
104	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
105	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
106	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
107	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
108	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
109	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
110	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
111	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
112	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
113	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
115	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
116	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
118	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
119	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
120	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
121	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
158	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
159	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
160	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
161	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
162	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
163	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
164	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
165	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
166	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
167	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
168	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
169	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
170	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
171	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
172	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
173	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
174	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
175	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
176	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
177	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
178	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
179	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
180	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
181	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
182	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
183	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
184	3300041462	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG	Metagenome	Rhizoplane
185	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
186	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
187	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
188	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
189	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
190	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
191	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
192	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
193	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
194	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
195	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
196	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
197	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
198	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
199	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
200	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
201	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
202	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
203	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
204	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
205	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
206	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
207	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
208	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
209	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
210	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
211	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
212	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
213	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
214	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
215	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
216	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
217	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
218	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
219	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
220	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
221	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
222	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
223	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
224	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
225	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
226	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
227	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
228	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
229	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
230	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
231	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
232	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
233	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
234	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
235	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
236	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
237	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
239	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
240	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
241	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
242	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
243	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
244	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
245	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
246	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
247	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
248	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
249	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
250	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
251	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
252	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
253	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
254	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
255	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
256	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
257	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
258	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
259	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
260	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
261	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
262	8003014200	Lysobacter changpingensis Cm-3-T8	Isolate	Rhizosphere
263	8021622325	Xanthomonas sp. LMG12462	Isolate	Rhizosphere
264	8021626552	Xanthomonas sp. LMG12460	Isolate	Rhizosphere
265	8021648035	Xanthomonas sp. LMG 12461	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	91.92
Metatranscriptomes	0
Isolates	8.08

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	10.93
Nodule	0
Rhizoplane	4.28
Rhizosphere	74.58
Stem	0
Stem Tuber	0
Unclassified	10.21

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	LJNas_1000254	3300000546	Bacteria	9214
2	JGI25152J39213_1000032	3300002773	Bacteria	96369
3	JGI25150J39212_1000351	3300002774	Bacteria	22655
4	JGI25151J46595_10000080	3300003187	Bacteria	131551
5	JGI25151J46595_10000138	3300003187	Bacteria	96369
6	JGI25153J46596_10000102	3300003215	Bacteria	96369
7	Ga0055526_1017017	3300003771	Bacteria	2805
8	Ga0055537_1000380	3300003773	Bacteria	29892
9	Ga0055524_1000305	3300003775	Bacteria	46621
10	Ga0055524_1001978	3300003775	Bacteria	10981
11	Ga0055536_1000470	3300003781	Bacteria	28175
12	Ga0055534_1000179	3300003784	Bacteria	46621
13	Ga0055528_1000230	3300003790	Bacteria	46621
14	Ga0055530_10002611	3300003791	Bacteria	11349
15	Ga0055531_10008653	3300003794	Bacteria	5326
16	Ga0055531_10008730	3300003794	Bacteria	5290
17	Ga0058692_1000023	3300003856	Bacteria	237263
18	Ga0065704_10076331	3300005289	Bacteria	5162
19	Ga0065712_10077224	3300005290	Bacteria	3529
20	Ga0065715_10106787	3300005293	Bacteria	2808
21	Ga0070683_100013851	3300005329	Bacteria	7043
22	Ga0068869_100088931	3300005334	Bacteria	2319
23	Ga0070666_10002514	3300005335	Bacteria	11093
24	Ga0070666_10002726	3300005335	Bacteria	10672
25	Ga0068868_100091585	3300005338	Bacteria	2450
26	Ga0068868_100158377	3300005338	Bacteria	1869
27	Ga0070660_100014761	3300005339	Bacteria	5635
28	Ga0070689_100168081	3300005340	Bacteria	1776
29	Ga0070661_100030045	3300005344	Bacteria	3924
30	Ga0070675_100286915	3300005354	Bacteria	1448
31	Ga0070671_100056088	3300005355	Bacteria	3278
32	Ga0070674_100057565	3300005356	Bacteria	2699
33	Ga0070659_100024400	3300005366	Bacteria	4635
34	Ga0070667_100017470	3300005367	Bacteria	5945
35	Ga0070667_100026996	3300005367	Bacteria	4776
36	Ga0070667_100244596	3300005367	Bacteria	1603
37	Ga0070667_100410816	3300005367	Bacteria	1233
38	Ga0070678_100014640	3300005456	Bacteria	4956
39	Ga0070678_100184082	3300005456	Bacteria	1712
40	Ga0070685_10001101	3300005466	Bacteria	14441
41	Ga0070679_100048186	3300005530	Bacteria	4246
42	Ga0070684_100010032	3300005535	Bacteria	7487
43	Ga0068853_100012735	3300005539	Bacteria	6848
44	Ga0068853_100032184	3300005539	Bacteria	4441
45	Ga0068853_100080310	3300005539	Bacteria	2853
46	Ga0068853_100106259	3300005539	Bacteria	2488
47	Ga0070672_100013034	3300005543	Bacteria	5859
48	Ga0070672_100112037	3300005543	Bacteria	2225
49	Ga0070693_100002319	3300005547	Bacteria	8736
50	Ga0070665_100024273	3300005548	Bacteria	6105
51	Ga0070665_100074183	3300005548	Bacteria	3408
52	Ga0068855_100023127	3300005563	Bacteria	7447
53	Ga0070664_100054196	3300005564	Bacteria	3402
54	Ga0068854_100004323	3300005578	Bacteria	8956
55	Ga0068854_100077516	3300005578	Bacteria	2446
56	Ga0068854_100084894	3300005578	Bacteria	2344
57	Ga0068856_100012801	3300005614	Bacteria	8119
58	Ga0068856_100024744	3300005614	Bacteria	5848
59	Ga0068856_100190534	3300005614	Bacteria	2064
60	Ga0068852_100031797	3300005616	Bacteria	4362
61	Ga0068852_100052650	3300005616	Bacteria	3499
62	Ga0068852_100101489	3300005616	Bacteria	2598
63	Ga0068864_100100929	3300005618	Bacteria	2559
64	Ga0068851_10028040	3300005834	Bacteria	2779
65	Ga0068863_100083507	3300005841	Bacteria	3027
66	Ga0068863_100223708	3300005841	Bacteria	1814
67	Ga0068858_100005259	3300005842	Bacteria	12680
68	Ga0068858_100006448	3300005842	Bacteria	11423
69	Ga0068860_100178017	3300005843	Bacteria	2055
70	Ga0068860_100181206	3300005843	Bacteria	2036
71	Ga0068862_100063682	3300005844	Bacteria	3173
72	Ga0081539_10041105	3300005985	Bacteria	2706
73	Ga0097621_100135881	3300006237	Bacteria	2097
74	Ga0097621_100274567	3300006237	Bacteria	1482
75	Ga0068871_100126170	3300006358	Bacteria	2166
76	Ga0068871_100306184	3300006358	Bacteria	1396
77	Ga0075431_100310176	3300006847	Bacteria	1593
78	Ga0075433_10066690	3300006852	Bacteria	3158
79	Ga0075434_100044271	3300006871	Bacteria	4416
80	Ga0068865_100006141	3300006881	Bacteria	7323
81	Ga0068865_100114275	3300006881	Bacteria	1996
82	Ga0105251_10000108	3300009011	Bacteria	81679
83	Ga0105240_10010393	3300009093	Bacteria	13081
84	Ga0105240_10058129	3300009093	Bacteria	4829
85	Ga0105240_10065901	3300009093	Bacteria	4495
86	Ga0105245_10293438	3300009098	Bacteria	1593
87	Ga0114129_10008885	3300009147	Bacteria	14327
88	Ga0114129_10022549	3300009147	Bacteria	8933
89	Ga0105241_10004161	3300009174	Bacteria	10685
90	Ga0105241_10010882	3300009174	Bacteria	6674
91	Ga0105241_10011095	3300009174	Bacteria	6611
92	Ga0105241_10031382	3300009174	Bacteria	3979
93	Ga0105242_10002454	3300009176	Bacteria	14545
94	Ga0105242_10083575	3300009176	Bacteria	2674
95	Ga0105248_10026152	3300009177	Bacteria	6493
96	Ga0105237_10008040	3300009545	Bacteria	11471
97	Ga0105238_10004788	3300009551	Bacteria	13390
98	Ga0105238_10137254	3300009551	Bacteria	2423
99	Ga0105249_10003051	3300009553	Bacteria	14449
100	Ga0105249_10141078	3300009553	Bacteria	2311
101	Ga0105239_10007776	3300010375	Bacteria	12268
102	Ga0105239_10008526	3300010375	Bacteria	11649
103	Ga0105239_10103888	3300010375	Bacteria	3145
104	Ga0105239_10116435	3300010375	Bacteria	2966
105	Ga0105239_10157225	3300010375	Bacteria	2539
106	Ga0105239_10257543	3300010375	Bacteria	1961
107	Ga0105246_10031548	3300011119	Bacteria	3508
108	Ga0157370_10041961	3300013104	Bacteria	4410
109	Ga0157370_10100987	3300013104	Bacteria	2702
110	Ga0157370_10135872	3300013104	Bacteria	2292
111	Ga0157369_10043973	3300013105	Bacteria	4864
112	Ga0157369_10141382	3300013105	Bacteria	2547
113	Ga0157374_10061337	3300013296	Bacteria	3522
114	Ga0163162_10008079	3300013306	Bacteria	10269
115	Ga0163162_10021282	3300013306	Bacteria	6384
116	Ga0163162_10240185	3300013306	Bacteria	1942
117	Ga0163162_10386890	3300013306	Bacteria	1532
118	Ga0157372_10001879	3300013307	Bacteria	22756
119	Ga0157372_10029232	3300013307	Bacteria	6016
120	Ga0157372_10049927	3300013307	Bacteria	4654
121	Ga0157375_10001190	3300013308	Bacteria	22445
122	Ga0157375_10696466	3300013308	Bacteria	1170
123	Ga0163163_10001216	3300014325	Bacteria	21766
124	Ga0163163_10094402	3300014325	Bacteria	3009
125	Ga0157379_10004969	3300014968	Bacteria	11411
126	Ga0157376_10000471	3300014969	Bacteria	25943
127	Ga0157376_10003196	3300014969	Bacteria	11270
128	Ga0157376_10005965	3300014969	Bacteria	8559
129	Ga0157376_10275868	3300014969	Bacteria	1581
130	Ga0163161_10051636	3300017792	Bacteria	2979
131	Ga0207425_1000078	3300025245	Bacteria	104429
132	Ga0209129_1000157	3300025258	Bacteria	105043
133	Ga0209233_1005323	3300025261	Bacteria	4282
134	Ga0209565_1000001	3300025263	Bacteria	2950419
135	Ga0209673_1000001	3300025273	Bacteria	3176258
136	Ga0209673_1003877	3300025273	Bacteria	8432
137	Ga0209130_1008178	3300025284	Bacteria	3119
138	Ga0209675_1000001	3300025291	Bacteria	2950293
139	Ga0209676_1000628	3300025292	Bacteria	50981
140	Ga0209676_1000764	3300025292	Bacteria	43254
141	Ga0209676_1000994	3300025292	Bacteria	33423
142	Ga0209025_1000015	3300025294	Bacteria	808120
143	Ga0209025_1000054	3300025294	Bacteria	317002
144	Ga0209025_1002203	3300025294	Bacteria	21561
145	Ga0209564_1000001	3300025295	Bacteria	3176258
146	Ga0209564_1006532	3300025295	Bacteria	6270
147	Ga0209758_1000062	3300025297	Bacteria	317002
148	Ga0209758_1013522	3300025297	Bacteria	4440
149	Ga0209050_1000809	3300025298	Bacteria	44027
150	Ga0209050_1016523	3300025298	Bacteria	3011
151	Ga0209256_1000002	3300025299	Bacteria	1906740
152	Ga0209256_1003149	3300025299	Bacteria	12002
153	Ga0209051_1005648	3300025303	Bacteria	7241
154	Ga0209257_1000080	3300025304	Bacteria	312038
155	Ga0209257_1000170	3300025304	Bacteria	169384
156	Ga0209257_1000273	3300025304	Bacteria	117663
157	Ga0209257_1000593	3300025304	Bacteria	60449
158	Ga0209257_1000975	3300025304	Bacteria	38974
159	Ga0209257_1001712	3300025304	Bacteria	24579
160	Ga0207656_10000937	3300025321	Bacteria	9508
161	Ga0207713_1000595	3300025735	Bacteria	35708
162	Ga0207680_10000616	3300025903	Bacteria	16825
163	Ga0207680_10011146	3300025903	Bacteria	4530
164	Ga0207680_10032726	3300025903	Bacteria	2959
165	Ga0207647_10000186	3300025904	Bacteria	50154
166	Ga0207647_10001220	3300025904	Bacteria	19782
167	Ga0207647_10016424	3300025904	Bacteria	5054
168	Ga0207705_10028032	3300025909	Bacteria	4015
169	Ga0207705_10066599	3300025909	Bacteria	2605
170	Ga0207654_10000128	3300025911	Bacteria	49057
171	Ga0207654_10034938	3300025911	Bacteria	2797
172	Ga0207654_10105629	3300025911	Bacteria	1743
173	Ga0207695_10000007	3300025913	Bacteria	1092551
174	Ga0207695_10001506	3300025913	Bacteria	38709
175	Ga0207695_10006744	3300025913	Bacteria	14809
176	Ga0207695_10065877	3300025913	Bacteria	3722
177	Ga0207671_10006371	3300025914	Bacteria	10527
178	Ga0207671_10062050	3300025914	Bacteria	2775
179	Ga0207657_10006941	3300025919	Bacteria	11669
180	Ga0207649_10005858	3300025920	Bacteria	6660
181	Ga0207649_10010668	3300025920	Bacteria	5052
182	Ga0207694_10000944	3300025924	Bacteria	25614
183	Ga0207694_10006032	3300025924	Bacteria	9272
184	Ga0207694_10049980	3300025924	Bacteria	3237
185	Ga0207659_10287398	3300025926	Bacteria	1346
186	Ga0207706_10002671	3300025933	Bacteria	17373
187	Ga0207706_10011704	3300025933	Bacteria	7999
188	Ga0207704_10003048	3300025938	Bacteria	7575
189	Ga0207704_10094338	3300025938	Bacteria	1976
190	Ga0207704_10101905	3300025938	Bacteria	1916
191	Ga0207691_10019585	3300025940	Bacteria	6401
192	Ga0207691_10081198	3300025940	Bacteria	2915
193	Ga0207689_10111123	3300025942	Bacteria	2252
194	Ga0207667_10022110	3300025949	Bacteria	7035
195	Ga0207667_10119314	3300025949	Bacteria	2718
196	Ga0207667_10541851	3300025949	Bacteria	1177
197	Ga0207712_10000254	3300025961	Bacteria	51558
198	Ga0207668_10203572	3300025972	Bacteria	1578
199	Ga0207640_10033212	3300025981	Bacteria	3208
200	Ga0207658_10007247	3300025986	Bacteria	7561
201	Ga0207658_10038795	3300025986	Bacteria	3434
202	Ga0207677_10051499	3300026023	Bacteria	2792
203	Ga0207703_10005350	3300026035	Bacteria	10337
204	Ga0207703_10011699	3300026035	Bacteria	6826
205	Ga0207703_10300816	3300026035	Bacteria	1463
206	Ga0207639_10000129	3300026041	Bacteria	55422
207	Ga0207639_10001755	3300026041	Bacteria	14589
208	Ga0207702_10005496	3300026078	Bacteria	11083
209	Ga0207702_10151122	3300026078	Bacteria	2112
210	Ga0207702_10270981	3300026078	Bacteria	1601
211	Ga0207641_10093246	3300026088	Bacteria	2639
212	Ga0207641_10192041	3300026088	Bacteria	1877
213	Ga0207648_10096740	3300026089	Bacteria	2583
214	Ga0207676_10092171	3300026095	Bacteria	2491
215	Ga0207674_10012210	3300026116	Bacteria	9608
216	Ga0207683_10005565	3300026121	Bacteria	10793
217	Ga0207683_10019545	3300026121	Bacteria	5785
218	Ga0207683_10303175	3300026121	Bacteria	1462
219	Ga0207698_10007143	3300026142	Bacteria	6994
220	Ga0207698_10056114	3300026142	Bacteria	3040
221	Ga0209371_1000059	3300027312	Bacteria	237154
222	Ga0268266_10000006	3300028379	Bacteria	1410021
223	Ga0268264_10062055	3300028381	Bacteria	3137
224	Ga0268264_10161200	3300028381	Bacteria	2020
225	Ga0268264_10174377	3300028381	Bacteria	1948
226	Ga0265337_1015640	3300028556	Bacteria	2476
227	Ga0265334_10002437	3300028573	Bacteria	8753
228	Ga0268256_1000055	3300030500	Bacteria	237299
229	Ga0265320_10000322	3300031240	Bacteria	39135
230	Ga0265325_10097749	3300031241	Bacteria	1441
231	Ga0265339_10058062	3300031249	Bacteria	2091
232	Ga0307513_10009441	3300031456	Bacteria	12338
233	Ga0307513_10194166	3300031456	Bacteria	1878
234	Ga0307408_100019861	3300031548	Bacteria	4526
235	Ga0307408_100072281	3300031548	Bacteria	2553
236	Ga0307408_100139229	3300031548	Bacteria	1903
237	Ga0265314_10015264	3300031711	Bacteria	6099
238	Ga0307413_10025510	3300031824	Bacteria	3241
239	Ga0307413_10063451	3300031824	Bacteria	2290
240	Ga0307413_10243649	3300031824	Bacteria	1329
241	Ga0307406_10043248	3300031901	Bacteria	2816
242	Ga0307406_10043386	3300031901	Bacteria	2812
243	Ga0307406_10093501	3300031901	Bacteria	2030
244	Ga0307412_10033885	3300031911	Bacteria	3250
245	Ga0307412_10067149	3300031911	Bacteria	2434
246	Ga0307409_100037031	3300031995	Bacteria	3593
247	Ga0307409_100310223	3300031995	Bacteria	1472
248	Ga0307416_100097129	3300032002	Bacteria	2550
249	Ga0307416_100155516	3300032002	Bacteria	2104
250	Ga0307414_10000569	3300032004	Bacteria	19267
251	Ga0307414_10007030	3300032004	Bacteria	6308
252	Ga0307414_10013379	3300032004	Bacteria	4883
253	Ga0307414_10025660	3300032004	Bacteria	3779
254	Ga0307414_10038280	3300032004	Bacteria	3219
255	Ga0307414_10076595	3300032004	Bacteria	2431
256	Ga0307414_10113304	3300032004	Bacteria	2070
257	Ga0307414_10153590	3300032004	Bacteria	1819
258	Ga0307414_10155222	3300032004	Bacteria	1811
259	Ga0307414_10368585	3300032004	Bacteria	1238
260	Ga0307411_10087921	3300032005	Bacteria	2159
261	Ga0307415_100218183	3300032126	Bacteria	1527
262	Ga0373937_0372892	3300036401	Bacteria	1353
263	Ga0373925_0333464	3300037068	Bacteria	1229
264	Ga0237819_00077	3300038705	Bacteria	34998
265	Ga0439436_0005204	3300041404	Bacteria	3985
266	Ga0439447_000730	3300041407	Bacteria	12185
267	Ga0439465_0034746	3300041413	Bacteria	1614
268	Ga0451791_0939359	3300041451	Bacteria	1831
269	Ga0451793_1424622	3300041452	Bacteria	5932
270	Ga0451797_0990680	3300041453	Bacteria	1212
271	Ga0451800_1268897	3300041459	Bacteria	4302
272	Ga0451806_127377	3300041462	Bacteria	4257
273	Ga0451807_0098160	3300041486	Bacteria	1861
274	Ga0451837_1418555	3300041494	Bacteria	1797
275	Ga0451837_1603297	3300041494	Bacteria	1476
276	Ga0451839_0500772	3300041496	Bacteria	1467
277	Ga0451853_0850473	3300041512	Bacteria	1673
278	Ga0439445_0021499	3300042004	Bacteria	1621
279	Ga0439432_020504	3300042006	Bacteria	2196
280	Ga0439449_0000889	3300042007	Bacteria	11670
281	Ga0439449_0017532	3300042007	Bacteria	2689
282	Ga0451577_0007822	3300042876	Bacteria	10456
283	Ga0453684_0002948	3300044712	Bacteria	39915
284	Ga0453684_0021032	3300044712	Bacteria	9783
285	Ga0453684_0140739	3300044712	Bacteria	2881
286	Ga0466959_0005396	3300045049	Bacteria	8748
287	Ga0451576_0000156	3300045051	Bacteria	174140
288	Ga0495629_0014398	3300046459	Bacteria	5690
289	Ga0495580_0062955	3300046472	Bacteria	2602
290	Ga0495639_0077857	3300046475	Bacteria	1540
291	Ga0495607_0027902	3300046501	Bacteria	3485
292	Ga0495606_0005271	3300046507	Bacteria	12459
293	Ga0495663_0000289	3300046525	Bacteria	19166
294	Ga0495665_0005805	3300046531	Bacteria	6662
295	Ga0495645_0009898	3300046543	Bacteria	6670
296	Ga0495633_0027745	3300046558	Bacteria	2764
297	Ga0495656_0001355	3300046615	Bacteria	7995
298	Ga0495668_0000710	3300046616	Bacteria	40166
299	Ga0495659_0094593	3300046664	Bacteria	1151
300	Ga0495658_0000544	3300046683	Bacteria	20555
301	Ga0495636_0000021	3300047318	Bacteria	72964
302	Ga0495681_0029407	3300047470	Bacteria	2812
303	Ga0495686_0007155	3300047472	Bacteria	8401
304	Ga0496101_0097791	3300048904	Bacteria	2193
305	Ga0496102_0099665	3300048905	Bacteria	2697
306	Ga0496103_0062730	3300048906	Bacteria	2314
307	Ga0496103_0071676	3300048906	Bacteria	2169
308	Ga0496104_0000020	3300048907	Bacteria	247296
309	Ga0496105_0000039	3300048908	Bacteria	118127
310	Ga0496106_0016041	3300048909	Bacteria	5539
311	Ga0496109_0465478	3300048912	Bacteria	1194
312	Ga0496110_0106396	3300048913	Bacteria	2517
313	Ga0496110_0481883	3300048913	Bacteria	1130
314	Ga0496112_0214342	3300048915	Bacteria	1882
315	Ga0496113_0067906	3300048916	Bacteria	2705
316	Ga0496117_0008089	3300048920	Bacteria	10072
317	Ga0496117_0039304	3300048920	Bacteria	3494
318	Ga0496117_0039774	3300048920	Bacteria	3466
319	Ga0496118_0001999	3300048921	Bacteria	28907
320	Ga0496118_0028223	3300048921	Bacteria	4733
321	Ga0496118_0030534	3300048921	Bacteria	4495
322	Ga0496118_0117234	3300048921	Bacteria	1747
323	Ga0496119_0004117	3300048922	Bacteria	14645
324	Ga0496120_0000161	3300048923	Bacteria	112351
325	Ga0496121_0000631	3300048924	Bacteria	65738
326	Ga0496122_0000647	3300048925	Bacteria	70731
327	Ga0496122_0005047	3300048925	Bacteria	15951
328	Ga0496123_0000234	3300048926	Bacteria	112524
329	Ga0496123_0029115	3300048926	Bacteria	4076
330	Ga0496124_0000009	3300048927	Bacteria	734820
331	Ga0496124_0000415	3300048927	Bacteria	76192
332	Ga0496125_0027335	3300048928	Bacteria	5174
333	Ga0496126_0005198	3300048929	Bacteria	15029
334	Ga0501031_0014827	3300049568	Bacteria	5066
335	Ga0501032_0004764	3300049569	Bacteria	10170
336	Ga0501032_0049130	3300049569	Bacteria	2847
337	Ga0501034_0000563	3300049571	Bacteria	58800
338	Ga0501034_0013768	3300049571	Bacteria	8321
339	Ga0501034_0018984	3300049571	Bacteria	7042
340	Ga0501034_0033391	3300049571	Bacteria	5221
341	Ga0501034_0046133	3300049571	Bacteria	4403
342	Ga0501036_0055437	3300049572	Bacteria	3358
343	Ga0501038_0006969	3300049574	Bacteria	10438
344	Ga0501038_0036684	3300049574	Bacteria	4301
345	Ga0501039_0093750	3300049575	Bacteria	2340
346	Ga0501043_0000564	3300049579	Bacteria	33148
347	Ga0501043_0027882	3300049579	Bacteria	4433
348	Ga0501043_0033424	3300049579	Bacteria	4047
349	Ga0501043_0060170	3300049579	Bacteria	2981
350	Ga0501043_0176866	3300049579	Bacteria	1663
351	Ga0501046_0017607	3300049580	Bacteria	5960
352	Ga0501047_0000653	3300049581	Bacteria	36334
353	Ga0501047_0003824	3300049581	Bacteria	14152
354	Ga0501047_0005385	3300049581	Bacteria	12027
355	Ga0501047_0078892	3300049581	Bacteria	3166
356	Ga0501067_0000699	3300049583	Bacteria	18081
357	Ga0501068_0013256	3300049584	Bacteria	4687
358	Ga0501069_0021059	3300049585	Bacteria	3536
359	Ga0501070_0033785	3300049586	Bacteria	4280
360	Ga0501070_0055358	3300049586	Bacteria	3287
361	Ga0501070_0150911	3300049586	Bacteria	1917
362	Ga0501071_0026073	3300049587	Bacteria	4100
363	Ga0501073_0001670	3300049589	Bacteria	16436
364	Ga0501073_0023208	3300049589	Bacteria	4458
365	Ga0501074_0006006	3300049590	Bacteria	8761
366	Ga0501074_0031517	3300049590	Bacteria	3840
367	Ga0501074_0076590	3300049590	Bacteria	2400
368	Ga0501075_0058063	3300049591	Bacteria	2914
369	Ga0501079_0074607	3300049741	Bacteria	2622
370	Ga0501079_0280562	3300049741	Bacteria	1303
371	Ga0501080_0006203	3300049742	Bacteria	10732
372	Ga0501080_0047014	3300049742	Bacteria	4017
373	Ga0501080_0123401	3300049742	Bacteria	2399
374	Ga0501083_0017739	3300049744	Bacteria	4964
375	Ga0501035_0026795	3300049822	Bacteria	5272
376	Ga0501044_0037141	3300049823	Bacteria	5092
377	Ga0501044_0039169	3300049823	Bacteria	4945
378	nmdc:mga00v17_418_c1	3300050491	Bacteria	22160
379	nmdc:mga05p37_563634_c1	3300050507	Bacteria	1294
380	nmdc:mga06r32_182818_c1	3300050510	Bacteria	2082
381	nmdc:mga06r32_24524_c1	3300050510	Bacteria	5600
382	nmdc:mga0rr50_190989_c1	3300050513	Bacteria	1678
383	nmdc:mga0rr50_26003_c1	3300050513	Bacteria	4077
384	nmdc:mga08x19_166730_c1	3300050514	Bacteria	1498
385	nmdc:mga0a205_345004_c1	3300050515	Bacteria	1357
386	Ga0500634_0000148	3300053161	Bacteria	25167
387	Ga0501082_0215530	3300060353	Bacteria	1670

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300031711	Ga0265314_10015264	Ga0265314_100152641	260
2	3300031249	Ga0265339_10058062	Ga0265339_100580621	280
3	3300005539	Ga0068853_100106259	Ga0068853_1001062593	282
4	3300044712	Ga0453684_0140739	Ga0453684_0140739_1102_2079	287
5	3300049571	Ga0501034_0000563	Ga0501034_0000563_36907_37881	290
6	3300032004	Ga0307414_10007030	Ga0307414_100070303	291
7	3300025292	Ga0209676_1000994	Ga0209676_100099439	292
8	3300049579	Ga0501043_0027882	Ga0501043_0027882_1284_2273	292
9	3300049580	Ga0501046_0017607	Ga0501046_0017607_735_1724	292
10	3300049581	Ga0501047_0003824	Ga0501047_0003824_10948_11937	292
11	3300049586	Ga0501070_0150911	Ga0501070_0150911_300_1289	292
12	3300049742	Ga0501080_0006203	Ga0501080_0006203_3040_4029	292
13	3300003187	JGI25151J46595_10000080	JGI25151J46595_10000080108	293
14	3300003781	Ga0055536_1000470	Ga0055536_10004703	293
15	3300025292	Ga0209676_1000628	Ga0209676_100062842	293
16	3300025294	Ga0209025_1000015	Ga0209025_1000015504	293
17	3300025297	Ga0209758_1013522	Ga0209758_10135222	293
18	3300041453	Ga0451797_0990680	Ga0451797_0990680_64_981	293
19	3300049571	Ga0501034_0013768	Ga0501034_0013768_6527_7495	293
20	3300048913	Ga0496110_0481883	Ga0496110_0481883_233_1117	294
21	3300049568	Ga0501031_0014827	Ga0501031_0014827_2235_3203	294
22	3300049569	Ga0501032_0004764	Ga0501032_0004764_754_1722	294
23	3300049574	Ga0501038_0036684	Ga0501038_0036684_1922_2890	294
24	3300049579	Ga0501043_0033424	Ga0501043_0033424_297_1265	294
25	3300049581	Ga0501047_0078892	Ga0501047_0078892_1521_2489	294
26	3300049589	Ga0501073_0023208	Ga0501073_0023208_1591_2559	294
27	3300049822	Ga0501035_0026795	Ga0501035_0026795_2310_3278	294
28	3300049823	Ga0501044_0037141	Ga0501044_0037141_1927_2895	294
29	3300031911	Ga0307412_10067149	Ga0307412_100671492	295
30	3300032002	Ga0307416_100155516	Ga0307416_1001555163	295
31	3300003794	Ga0055531_10008730	Ga0055531_100087302	298
32	3300005614	Ga0068856_100012801	Ga0068856_1000128015	298
33	3300025298	Ga0209050_1016523	Ga0209050_10165232	298
34	3300025304	Ga0209257_1000080	Ga0209257_1000080204	298
35	3300026078	Ga0207702_10005496	Ga0207702_1000549610	298
36	3300044712	Ga0453684_0002948	Ga0453684_0002948_25364_26299	299
37	3300045051	Ga0451576_0000156	Ga0451576_0000156_13816_14751	299
38	3300046459	Ga0495629_0014398	Ga0495629_0014398_737_1726	299
39	3300047318	Ga0495636_0000021	Ga0495636_0000021_18760_19731	299
40	3300009177	Ga0105248_10026152	Ga0105248_100261523	301
41	3300013104	Ga0157370_10100987	Ga0157370_101009872	301
42	3300013296	Ga0157374_10061337	Ga0157374_100613373	301
43	3300013306	Ga0163162_10386890	Ga0163162_103868902	301
44	3300013307	Ga0157372_10029232	Ga0157372_100292324	301
45	3300014969	Ga0157376_10275868	Ga0157376_102758682	301
46	3300031995	Ga0307409_100310223	Ga0307409_1003102232	301
47	3300044712	Ga0453684_0021032	Ga0453684_0021032_7784_8743	301
48	3300010375	Ga0105239_10103888	Ga0105239_101038882	302
49	3300031824	Ga0307413_10025510	Ga0307413_100255102	302
50	3300031911	Ga0307412_10033885	Ga0307412_100338853	302
51	3300032004	Ga0307414_10013379	Ga0307414_100133794	302
52	3300032004	Ga0307414_10153590	Ga0307414_101535902	302
53	3300038705	Ga0237819_00077	Ga0237819_00077_4757_5725	302
54	3300041512	Ga0451853_0850473	Ga0451853_0850473_296_1288	302
55	3300047472	Ga0495686_0007155	Ga0495686_0007155_5563_6531	302
56	3300028556	Ga0265337_1015640	Ga0265337_10156403	303
57	3300028573	Ga0265334_10002437	Ga0265334_100024373	303
58	3300031240	Ga0265320_10000322	Ga0265320_100003222	303
59	3300031548	Ga0307408_100072281	Ga0307408_1000722811	303
60	3300031824	Ga0307413_10063451	Ga0307413_100634512	303
61	3300032004	Ga0307414_10038280	Ga0307414_100382804	303
62	3300032004	Ga0307414_10155222	Ga0307414_101552221	303
63	3300032005	Ga0307411_10087921	Ga0307411_100879212	303
64	3300032126	Ga0307415_100218183	Ga0307415_1002181832	303
65	3300042006	Ga0439432_020504	Ga0439432_020504_946_1917	303
66	3300042007	Ga0439449_0017532	Ga0439449_0017532_1531_2502	303
67	iso_pu_bacteria	2524614729	2525556618	303
68	iso_pu_bacteria	2627854209	2630648214	303
69	3300005614	Ga0068856_100024744	Ga0068856_1000247444	304
70	3300005842	Ga0068858_100005259	Ga0068858_10000525910	304
71	3300014325	Ga0163163_10094402	Ga0163163_100944022	304
72	3300025299	Ga0209256_1003149	Ga0209256_10031493	304
73	3300026035	Ga0207703_10005350	Ga0207703_1000535010	304
74	3300031824	Ga0307413_10243649	Ga0307413_102436492	304
75	3300048928	Ga0496125_0027335	Ga0496125_0027335_2568_3545	304
76	3300049587	Ga0501071_0026073	Ga0501071_0026073_640_1611	304
77	3300049591	Ga0501075_0058063	Ga0501075_0058063_799_1770	304
78	3300002773	JGI25152J39213_1000032	JGI25152J39213_100003221	305
79	3300002774	JGI25150J39212_1000351	JGI25150J39212_100035116	305
80	3300003187	JGI25151J46595_10000138	JGI25151J46595_1000013821	305
81	3300003215	JGI25153J46596_10000102	JGI25153J46596_1000010221	305
82	3300005844	Ga0068862_100063682	Ga0068862_1000636822	305
83	3300013306	Ga0163162_10008079	Ga0163162_100080793	305
84	3300025245	Ga0207425_1000078	Ga0207425_100007822	305
85	3300025258	Ga0209129_1000157	Ga0209129_100015771	305
86	3300025294	Ga0209025_1000054	Ga0209025_1000054189	305
87	3300025297	Ga0209758_1000062	Ga0209758_1000062189	305
88	3300026035	Ga0207703_10300816	Ga0207703_103008162	305
89	3300042876	Ga0451577_0007822	Ga0451577_0007822_6750_7730	305
90	3300046558	Ga0495633_0027745	Ga0495633_0027745_76_1047	305
91	3300053161	Ga0500634_0000148	Ga0500634_0000148_14853_15824	305
92	3300006852	Ga0075433_10066690	Ga0075433_100666903	306
93	3300006871	Ga0075434_100044271	Ga0075434_1000442713	306
94	3300009147	Ga0114129_10008885	Ga0114129_100088852	306
95	3300009147	Ga0114129_10022549	Ga0114129_100225494	306
96	3300009174	Ga0105241_10031382	Ga0105241_100313823	306
97	3300010375	Ga0105239_10116435	Ga0105239_101164353	306
98	3300025911	Ga0207654_10000128	Ga0207654_100001285	306
99	3300031548	Ga0307408_100139229	Ga0307408_1001392291	306
100	3300031995	Ga0307409_100037031	Ga0307409_1000370312	306
101	3300041407	Ga0439447_000730	Ga0439447_000730_1702_2673	306
102	3300046616	Ga0495668_0000710	Ga0495668_0000710_11255_12226	306
103	3300048904	Ga0496101_0097791	Ga0496101_0097791_218_1198	306
104	3300048905	Ga0496102_0099665	Ga0496102_0099665_1055_2080	306
105	3300048906	Ga0496103_0071676	Ga0496103_0071676_367_1392	306
106	3300048909	Ga0496106_0016041	Ga0496106_0016041_1527_2552	306
107	3300048913	Ga0496110_0106396	Ga0496110_0106396_1253_2278	306
108	3300048916	Ga0496113_0067906	Ga0496113_0067906_480_1505	306
109	3300050507	nmdc:mga05p37_563634_c1	nmdc:mga05p37_563634_c1_121_1077	306
110	3300050513	nmdc:mga0rr50_26003_c1	nmdc:mga0rr50_26003_c1_322_1278	306
111	3300050514	nmdc:mga08x19_166730_c1	nmdc:mga08x19_166730_c1_259_1215	306
112	3300050515	nmdc:mga0a205_345004_c1	nmdc:mga0a205_345004_c1_17_973	306
113	iso_pu_bacteria	2571042365	2572254047	306
114	iso_pu_bacteria	2643221559	2643817610	306
115	iso_pu_bacteria	2643221573	2643878827	306
116	iso_pu_bacteria	2643221579	2643906422	306
117	iso_pu_bacteria	2643221581	2643916516	306
118	iso_pu_bacteria	2643221586	2643940322	306
119	iso_pu_bacteria	2643221593	2643974077	306
120	iso_pu_bacteria	2643221612	2644079393	306
121	iso_pu_bacteria	2643221720	2644660143	306
122	iso_pu_bacteria	2643221727	2644694837	306
123	iso_pu_bacteria	2643221728	2644697444	306
124	iso_pu_bacteria	2747842501	2748015740	306
125	iso_pu_bacteria	2818991457	2819663093	306
126	iso_pu_bacteria	2842780639	2842780949	306
127	iso_pu_bacteria	2852684882	2852685921	306
128	iso_pu_bacteria	2894414249	2894415503	306
129	iso_pu_bacteria	2895498888	2895500689	306
130	iso_pu_bacteria	2895511927	2895516441	306
131	iso_pu_bacteria	2895522137	2895523639	306
132	iso_pu_bacteria	2895525241	2895526779	306
133	iso_pu_bacteria	2919130084	2919133765	306
134	iso_pu_bacteria	2919513703	2919514544	306
135	iso_pu_bacteria	2919675420	2919676584	306
136	iso_pu_bacteria	2923516293	2923518293	306
137	iso_pu_bacteria	2929195423	2929197499	306
138	iso_pu_bacteria	2941489479	2941490803	306
139	iso_pu_bacteria	2995948881	2995951249	306
140	iso_pu_bacteria	8003014200	8003015998	306
141	iso_pu_bacteria	8021622325	8021624585	306
142	iso_pu_bacteria	8021626552	8021627929	306
143	iso_pu_bacteria	8021648035	8021649496	306
144	3300005335	Ga0070666_10002726	Ga0070666_100027267	307
145	3300006237	Ga0097621_100274567	Ga0097621_1002745672	307
146	3300006358	Ga0068871_100306184	Ga0068871_1003061842	307
147	3300009098	Ga0105245_10293438	Ga0105245_102934381	307
148	3300010375	Ga0105239_10007776	Ga0105239_100077762	307
149	3300013104	Ga0157370_10041961	Ga0157370_100419612	307
150	3300014325	Ga0163163_10001216	Ga0163163_100012165	307
151	3300025903	Ga0207680_10000616	Ga0207680_100006162	307
152	3300031901	Ga0307406_10043386	Ga0307406_100433862	307
153	3300031901	Ga0307406_10093501	Ga0307406_100935012	307
154	3300049569	Ga0501032_0049130	Ga0501032_0049130_632_1621	307
155	3300049571	Ga0501034_0018984	Ga0501034_0018984_4565_5554	307
156	3300049571	Ga0501034_0033391	Ga0501034_0033391_2736_3725	307
157	3300049571	Ga0501034_0046133	Ga0501034_0046133_1323_2312	307
158	3300049572	Ga0501036_0055437	Ga0501036_0055437_815_1804	307
159	3300049574	Ga0501038_0006969	Ga0501038_0006969_9241_10230	307
160	3300049575	Ga0501039_0093750	Ga0501039_0093750_1031_2020	307
161	3300049579	Ga0501043_0060170	Ga0501043_0060170_635_1624	307
162	3300049579	Ga0501043_0176866	Ga0501043_0176866_33_1022	307
163	3300049581	Ga0501047_0000653	Ga0501047_0000653_28144_29133	307
164	3300049581	Ga0501047_0005385	Ga0501047_0005385_1590_2579	307
165	3300049583	Ga0501067_0000699	Ga0501067_0000699_4747_5736	307
166	3300049584	Ga0501068_0013256	Ga0501068_0013256_2316_3305	307
167	3300049585	Ga0501069_0021059	Ga0501069_0021059_91_1080	307
168	3300049586	Ga0501070_0033785	Ga0501070_0033785_1323_2312	307
169	3300049586	Ga0501070_0055358	Ga0501070_0055358_1219_2208	307
170	3300049589	Ga0501073_0001670	Ga0501073_0001670_3155_4144	307
171	3300049590	Ga0501074_0006006	Ga0501074_0006006_4669_5658	307
172	3300049590	Ga0501074_0031517	Ga0501074_0031517_2366_3355	307
173	3300049590	Ga0501074_0076590	Ga0501074_0076590_338_1327	307
174	3300049741	Ga0501079_0074607	Ga0501079_0074607_1142_2131	307
175	3300049741	Ga0501079_0280562	Ga0501079_0280562_258_1247	307
176	3300049742	Ga0501080_0047014	Ga0501080_0047014_620_1609	307
177	3300049742	Ga0501080_0123401	Ga0501080_0123401_745_1734	307
178	3300049744	Ga0501083_0017739	Ga0501083_0017739_1711_2700	307
179	3300049823	Ga0501044_0039169	Ga0501044_0039169_2112_3101	307
180	3300060353	Ga0501082_0215530	Ga0501082_0215530_98_1087	307
181	iso_pu_bacteria	2643221695	2644529213	307
182	3300005329	Ga0070683_100013851	Ga0070683_1000138513	308
183	3300005338	Ga0068868_100158377	Ga0068868_1001583771	308
184	3300005339	Ga0070660_100014761	Ga0070660_1000147613	308
185	3300005344	Ga0070661_100030045	Ga0070661_1000300452	308
186	3300005355	Ga0070671_100056088	Ga0070671_1000560882	308
187	3300005366	Ga0070659_100024400	Ga0070659_1000244002	308
188	3300005367	Ga0070667_100017470	Ga0070667_1000174703	308
189	3300005367	Ga0070667_100410816	Ga0070667_1004108162	308
190	3300005535	Ga0070684_100010032	Ga0070684_1000100324	308
191	3300005539	Ga0068853_100032184	Ga0068853_1000321844	308
192	3300005564	Ga0070664_100054196	Ga0070664_1000541962	308
193	3300005578	Ga0068854_100077516	Ga0068854_1000775162	308
194	3300005578	Ga0068854_100084894	Ga0068854_1000848943	308
195	3300005616	Ga0068852_100031797	Ga0068852_1000317972	308
196	3300005618	Ga0068864_100100929	Ga0068864_1001009292	308
197	3300005843	Ga0068860_100178017	Ga0068860_1001780172	308
198	3300005843	Ga0068860_100181206	Ga0068860_1001812062	308
199	3300009093	Ga0105240_10058129	Ga0105240_100581292	308
200	3300009174	Ga0105241_10010882	Ga0105241_100108822	308
201	3300009174	Ga0105241_10011095	Ga0105241_100110952	308
202	3300009545	Ga0105237_10008040	Ga0105237_100080402	308
203	3300009551	Ga0105238_10004788	Ga0105238_100047882	308
204	3300009551	Ga0105238_10137254	Ga0105238_101372542	308
205	3300009553	Ga0105249_10141078	Ga0105249_101410781	308
206	3300010375	Ga0105239_10008526	Ga0105239_100085262	308
207	3300011119	Ga0105246_10031548	Ga0105246_100315482	308
208	3300013104	Ga0157370_10135872	Ga0157370_101358722	308
209	3300013105	Ga0157369_10043973	Ga0157369_100439732	308
210	3300013105	Ga0157369_10141382	Ga0157369_101413822	308
211	3300013306	Ga0163162_10240185	Ga0163162_102401852	308
212	3300013307	Ga0157372_10001879	Ga0157372_100018798	308
213	3300013307	Ga0157372_10049927	Ga0157372_100499272	308
214	3300014968	Ga0157379_10004969	Ga0157379_100049698	308
215	3300025904	Ga0207647_10001220	Ga0207647_100012205	308
216	3300025909	Ga0207705_10028032	Ga0207705_100280323	308
217	3300025909	Ga0207705_10066599	Ga0207705_100665993	308
218	3300025911	Ga0207654_10034938	Ga0207654_100349381	308
219	3300025911	Ga0207654_10105629	Ga0207654_101056292	308
220	3300025913	Ga0207695_10001506	Ga0207695_1000150612	308
221	3300025914	Ga0207671_10006371	Ga0207671_100063712	308
222	3300025919	Ga0207657_10006941	Ga0207657_100069418	308
223	3300025920	Ga0207649_10005858	Ga0207649_100058583	308
224	3300025920	Ga0207649_10010668	Ga0207649_100106684	308
225	3300025924	Ga0207694_10049980	Ga0207694_100499804	308
226	3300025933	Ga0207706_10011704	Ga0207706_100117044	308
227	3300025938	Ga0207704_10101905	Ga0207704_101019052	308
228	3300025949	Ga0207667_10022110	Ga0207667_100221105	308
229	3300025949	Ga0207667_10119314	Ga0207667_101193142	308
230	3300025986	Ga0207658_10038795	Ga0207658_100387952	308
231	3300026023	Ga0207677_10051499	Ga0207677_100514992	308
232	3300026041	Ga0207639_10001755	Ga0207639_100017554	308
233	3300026078	Ga0207702_10151122	Ga0207702_101511222	308
234	3300026078	Ga0207702_10270981	Ga0207702_102709811	308
235	3300026088	Ga0207641_10093246	Ga0207641_100932462	308
236	3300026116	Ga0207674_10012210	Ga0207674_100122103	308
237	3300026142	Ga0207698_10007143	Ga0207698_100071434	308
238	3300028381	Ga0268264_10161200	Ga0268264_101612002	308
239	3300028381	Ga0268264_10174377	Ga0268264_101743772	308
240	3300046664	Ga0495659_0094593	Ga0495659_0094593_127_1089	308
241	3300005290	Ga0065712_10077224	Ga0065712_100772242	309
242	3300005293	Ga0065715_10106787	Ga0065715_101067873	309
243	3300005356	Ga0070674_100057565	Ga0070674_1000575652	309
244	3300006847	Ga0075431_100310176	Ga0075431_1003101762	309
245	3300032004	Ga0307414_10368585	Ga0307414_103685851	309
246	3300045049	Ga0466959_0005396	Ga0466959_0005396_5867_6850	309
247	3300048920	Ga0496117_0039774	Ga0496117_0039774_860_1843	309
248	3300048921	Ga0496118_0001999	Ga0496118_0001999_17999_18982	309
249	3300050510	nmdc:mga06r32_182818_c1	nmdc:mga06r32_182818_c1_194_1180	309
250	3300050510	nmdc:mga06r32_24524_c1	nmdc:mga06r32_24524_c1_4154_5140	309
251	3300003771	Ga0055526_1017017	Ga0055526_10170172	310
252	3300003773	Ga0055537_1000380	Ga0055537_10003805	310
253	3300003775	Ga0055524_1000305	Ga0055524_100030534	310
254	3300003775	Ga0055524_1001978	Ga0055524_10019788	310
255	3300003784	Ga0055534_1000179	Ga0055534_100017934	310
256	3300003790	Ga0055528_1000230	Ga0055528_100023022	310
257	3300003791	Ga0055530_10002611	Ga0055530_100026114	310
258	3300003794	Ga0055531_10008653	Ga0055531_100086533	310
259	3300003856	Ga0058692_1000023	Ga0058692_1000023109	310
260	3300005289	Ga0065704_10076331	Ga0065704_100763314	310
261	3300009011	Ga0105251_10000108	Ga0105251_100001087	310
262	3300025263	Ga0209565_1000001	Ga0209565_10000011865	310
263	3300025273	Ga0209673_1000001	Ga0209673_10000011865	310
264	3300025273	Ga0209673_1003877	Ga0209673_10038779	310
265	3300025284	Ga0209130_1008178	Ga0209130_10081782	310
266	3300025291	Ga0209675_1000001	Ga0209675_1000001667	310
267	3300025292	Ga0209676_1000764	Ga0209676_100076439	310
268	3300025294	Ga0209025_1002203	Ga0209025_10022039	310
269	3300025295	Ga0209564_1000001	Ga0209564_1000001829	310
270	3300025295	Ga0209564_1006532	Ga0209564_10065325	310
271	3300025298	Ga0209050_1000809	Ga0209050_100080925	310
272	3300025299	Ga0209256_1000002	Ga0209256_1000002723	310
273	3300025303	Ga0209051_1005648	Ga0209051_10056485	310
274	3300025304	Ga0209257_1000170	Ga0209257_100017054	310
275	3300025304	Ga0209257_1000273	Ga0209257_100027332	310
276	3300025304	Ga0209257_1000593	Ga0209257_100059310	310
277	3300025304	Ga0209257_1000975	Ga0209257_10009757	310
278	3300025304	Ga0209257_1001712	Ga0209257_10017127	310
279	3300025735	Ga0207713_1000595	Ga0207713_100059522	310
280	3300025949	Ga0207667_10541851	Ga0207667_105418511	310
281	3300025972	Ga0207668_10203572	Ga0207668_102035722	310
282	3300027312	Ga0209371_1000059	Ga0209371_1000059108	310
283	3300030500	Ga0268256_1000055	Ga0268256_100005590	310
284	3300031456	Ga0307513_10009441	Ga0307513_100094419	310
285	3300031456	Ga0307513_10194166	Ga0307513_101941662	310
286	3300031548	Ga0307408_100019861	Ga0307408_1000198612	310
287	3300031901	Ga0307406_10043248	Ga0307406_100432482	310
288	3300032004	Ga0307414_10000569	Ga0307414_100005697	310
289	3300032004	Ga0307414_10025660	Ga0307414_100256602	310
290	3300032004	Ga0307414_10076595	Ga0307414_100765952	310
291	3300032004	Ga0307414_10113304	Ga0307414_101133041	310
292	3300041404	Ga0439436_0005204	Ga0439436_0005204_291_1259	310
293	3300041413	Ga0439465_0034746	Ga0439465_0034746_16_984	310
294	3300041451	Ga0451791_0939359	Ga0451791_0939359_11_979	310
295	3300041452	Ga0451793_1424622	Ga0451793_1424622_4325_5293	310
296	3300041459	Ga0451800_1268897	Ga0451800_1268897_795_1763	310
297	3300041462	Ga0451806_127377	Ga0451806_127377_2540_3508	310
298	3300041486	Ga0451807_0098160	Ga0451807_0098160_101_1069	310
299	3300041494	Ga0451837_1418555	Ga0451837_1418555_751_1719	310
300	3300041494	Ga0451837_1603297	Ga0451837_1603297_53_1021	310
301	3300041496	Ga0451839_0500772	Ga0451839_0500772_14_982	310
302	3300042004	Ga0439445_0021499	Ga0439445_0021499_530_1501	310
303	3300042007	Ga0439449_0000889	Ga0439449_0000889_4113_5084	310
304	3300046501	Ga0495607_0027902	Ga0495607_0027902_1252_2220	310
305	3300046507	Ga0495606_0005271	Ga0495606_0005271_8365_9333	310
306	3300046525	Ga0495663_0000289	Ga0495663_0000289_5526_6494	310
307	3300046615	Ga0495656_0001355	Ga0495656_0001355_2355_3323	310
308	3300047470	Ga0495681_0029407	Ga0495681_0029407_1233_2201	310
309	3300048920	Ga0496117_0008089	Ga0496117_0008089_1931_2899	310
310	3300048921	Ga0496118_0030534	Ga0496118_0030534_1525_2493	310
311	3300048921	Ga0496118_0117234	Ga0496118_0117234_549_1517	310
312	3300048922	Ga0496119_0004117	Ga0496119_0004117_639_1607	310
313	3300048923	Ga0496120_0000161	Ga0496120_0000161_67790_68758	310
314	3300048924	Ga0496121_0000631	Ga0496121_0000631_50816_51787	310
315	3300048925	Ga0496122_0000647	Ga0496122_0000647_41956_42924	310
316	3300048925	Ga0496122_0005047	Ga0496122_0005047_6827_7951	310
317	3300048926	Ga0496123_0000234	Ga0496123_0000234_67771_68739	310
318	3300048926	Ga0496123_0029115	Ga0496123_0029115_1291_2415	310
319	3300048927	Ga0496124_0000009	Ga0496124_0000009_366370_367338	310
320	3300048927	Ga0496124_0000415	Ga0496124_0000415_39177_40145	310
321	3300049579	Ga0501043_0000564	Ga0501043_0000564_899_1867	310
322	3300005335	Ga0070666_10002514	Ga0070666_100025146	311
323	3300005338	Ga0068868_100091585	Ga0068868_1000915853	311
324	3300005340	Ga0070689_100168081	Ga0070689_1001680812	311
325	3300005367	Ga0070667_100026996	Ga0070667_1000269962	311
326	3300005367	Ga0070667_100244596	Ga0070667_1002445962	311
327	3300005456	Ga0070678_100014640	Ga0070678_1000146403	311
328	3300005456	Ga0070678_100184082	Ga0070678_1001840822	311
329	3300005530	Ga0070679_100048186	Ga0070679_1000481861	311
330	3300005539	Ga0068853_100012735	Ga0068853_1000127355	311
331	3300005539	Ga0068853_100080310	Ga0068853_1000803103	311
332	3300005543	Ga0070672_100112037	Ga0070672_1001120372	311
333	3300005547	Ga0070693_100002319	Ga0070693_1000023195	311
334	3300005548	Ga0070665_100024273	Ga0070665_1000242734	311
335	3300005563	Ga0068855_100023127	Ga0068855_1000231279	311
336	3300005578	Ga0068854_100004323	Ga0068854_10000432310	311
337	3300005614	Ga0068856_100190534	Ga0068856_1001905343	311
338	3300005616	Ga0068852_100101489	Ga0068852_1001014893	311
339	3300005834	Ga0068851_10028040	Ga0068851_100280404	311
340	3300005841	Ga0068863_100083507	Ga0068863_1000835072	311
341	3300005841	Ga0068863_100223708	Ga0068863_1002237081	311
342	3300005842	Ga0068858_100006448	Ga0068858_10000644812	311
343	3300006237	Ga0097621_100135881	Ga0097621_1001358812	311
344	3300006358	Ga0068871_100126170	Ga0068871_1001261702	311
345	3300006881	Ga0068865_100114275	Ga0068865_1001142752	311
346	3300009093	Ga0105240_10065901	Ga0105240_100659013	311
347	3300009174	Ga0105241_10004161	Ga0105241_1000416110	311
348	3300009176	Ga0105242_10083575	Ga0105242_100835753	311
349	3300009553	Ga0105249_10003051	Ga0105249_1000305114	311
350	3300010375	Ga0105239_10157225	Ga0105239_101572252	311
351	3300010375	Ga0105239_10257543	Ga0105239_102575432	311
352	3300013308	Ga0157375_10696466	Ga0157375_106964662	311
353	3300014969	Ga0157376_10000471	Ga0157376_100004718	311
354	3300017792	Ga0163161_10051636	Ga0163161_100516362	311
355	3300025321	Ga0207656_10000937	Ga0207656_100009374	311
356	3300025903	Ga0207680_10011146	Ga0207680_100111461	311
357	3300025903	Ga0207680_10032726	Ga0207680_100327263	311
358	3300025904	Ga0207647_10000186	Ga0207647_1000018616	311
359	3300025913	Ga0207695_10006744	Ga0207695_1000674411	311
360	3300025913	Ga0207695_10065877	Ga0207695_100658773	311
361	3300025924	Ga0207694_10006032	Ga0207694_100060324	311
362	3300025933	Ga0207706_10002671	Ga0207706_1000267112	311
363	3300025938	Ga0207704_10094338	Ga0207704_100943382	311
364	3300025940	Ga0207691_10081198	Ga0207691_100811982	311
365	3300025961	Ga0207712_10000254	Ga0207712_1000025415	311
366	3300025981	Ga0207640_10033212	Ga0207640_100332123	311
367	3300025986	Ga0207658_10007247	Ga0207658_100072477	311
368	3300026035	Ga0207703_10011699	Ga0207703_100116997	311
369	3300026041	Ga0207639_10000129	Ga0207639_1000012935	311
370	3300026088	Ga0207641_10192041	Ga0207641_101920411	311
371	3300026089	Ga0207648_10096740	Ga0207648_100967403	311
372	3300026095	Ga0207676_10092171	Ga0207676_100921713	311
373	3300026121	Ga0207683_10005565	Ga0207683_100055653	311
374	3300026121	Ga0207683_10303175	Ga0207683_103031752	311
375	3300028379	Ga0268266_10000006	Ga0268266_10000006390	311
376	3300028381	Ga0268264_10062055	Ga0268264_100620552	311
377	3300032002	Ga0307416_100097129	Ga0307416_1000971292	311
378	3300050491	nmdc:mga00v17_418_c1	nmdc:mga00v17_418_c1_16063_17043	311
379	3300005334	Ga0068869_100088931	Ga0068869_1000889312	312
380	3300005354	Ga0070675_100286915	Ga0070675_1002869151	312
381	3300005466	Ga0070685_10001101	Ga0070685_100011013	312
382	3300005543	Ga0070672_100013034	Ga0070672_1000130344	312
383	3300005616	Ga0068852_100052650	Ga0068852_1000526503	312
384	3300005985	Ga0081539_10041105	Ga0081539_100411052	312
385	3300006881	Ga0068865_100006141	Ga0068865_1000061416	312
386	3300009093	Ga0105240_10010393	Ga0105240_1001039313	312
387	3300009176	Ga0105242_10002454	Ga0105242_100024547	312
388	3300013306	Ga0163162_10021282	Ga0163162_100212825	312
389	3300013308	Ga0157375_10001190	Ga0157375_1000119012	312
390	3300014969	Ga0157376_10005965	Ga0157376_100059655	312
391	3300025261	Ga0209233_1005323	Ga0209233_10053232	312
392	3300025913	Ga0207695_10000007	Ga0207695_10000007506	312
393	3300025914	Ga0207671_10062050	Ga0207671_100620503	312
394	3300025924	Ga0207694_10000944	Ga0207694_1000094414	312
395	3300025926	Ga0207659_10287398	Ga0207659_102873981	312
396	3300025938	Ga0207704_10003048	Ga0207704_100030485	312
397	3300025940	Ga0207691_10019585	Ga0207691_100195852	312
398	3300025942	Ga0207689_10111123	Ga0207689_101111232	312
399	3300026121	Ga0207683_10019545	Ga0207683_100195455	312
400	3300026142	Ga0207698_10056114	Ga0207698_100561142	312
401	3300031241	Ga0265325_10097749	Ga0265325_100977492	312
402	3300036401	Ga0373937_0372892	Ga0373937_0372892_86_1102	312
403	3300037068	Ga0373925_0333464	Ga0373925_0333464_15_1007	312
404	3300046472	Ga0495580_0062955	Ga0495580_0062955_358_1350	312
405	3300046475	Ga0495639_0077857	Ga0495639_0077857_521_1513	312
406	3300046531	Ga0495665_0005805	Ga0495665_0005805_1804_2820	312
407	3300046683	Ga0495658_0000544	Ga0495658_0000544_232_1248	312
408	3300048906	Ga0496103_0062730	Ga0496103_0062730_715_1713	312
409	3300048907	Ga0496104_0000020	Ga0496104_0000020_71826_72818	312
410	3300048908	Ga0496105_0000039	Ga0496105_0000039_106013_107005	312
411	3300048920	Ga0496117_0039304	Ga0496117_0039304_2312_3310	312
412	3300048921	Ga0496118_0028223	Ga0496118_0028223_1640_2638	312
413	3300005548	Ga0070665_100074183	Ga0070665_1000741831	320
414	3300014969	Ga0157376_10003196	Ga0157376_100031963	320
415	3300025904	Ga0207647_10016424	Ga0207647_100164242	320
416	3300046543	Ga0495645_0009898	Ga0495645_0009898_1066_2028	320
417	3300048912	Ga0496109_0465478	Ga0496109_0465478_42_1037	320
418	3300048915	Ga0496112_0214342	Ga0496112_0214342_814_1809	320
419	3300050513	nmdc:mga0rr50_190989_c1	nmdc:mga0rr50_190989_c1_58_1035	320
420	3300000546	LJNas_1000254	LJNas_10002544	322
421	3300048929	Ga0496126_0005198	Ga0496126_0005198_2106_3107	322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

144

306

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1xdq-assembly3.cif.gz_C	structural and biochemical identification of a novel bacterial oxidoreductase	0.9059	65	315
1xdy-assembly7.cif.gz_G	structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor	0.9034	65	315
1xdy-assembly7.cif.gz_G	structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor	0.867	65	315
1xdq-assembly3.cif.gz_C	structural and biochemical identification of a novel bacterial oxidoreductase	0.86	65	315
2ca3-assembly1.cif.gz_A	sulfite dehydrogenase from starkeya novella r55m mutant	0.8263	99	255

ID	Description	Score	Start	End	Superfamily
1xdyH00	Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain	0.9156	65	315	3.90.420.10
1xdyH00	Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain	0.8691	65	315	3.90.420.10
2biiB01	Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain	0.8263	101	256	3.90.420.10
af_P11035_116_359_3.90.420.10	Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain	0.8252	100	255	3.90.420.10
af_Q54XJ8_10_262_3.90.420.10	Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain	0.8177	99	255	3.90.420.10

ID	Description	Score	Start	End
AF-A0A162C394-F1-model_v4	Oxidoreductase molybdopterin-binding domain-containing protein	0.9618	85	230
AF-A0A162C394-F1-model_v4	Oxidoreductase molybdopterin-binding domain-containing protein	0.9554	85	230
AF-A0A7V8JR83-F1-model_v4	Protein-methionine-sulfoxide reductase catalytic subunit MsrP	0.954	71	183
AF-A0A7S1GSH0-F1-model_v4	Oxidoreductase molybdopterin-binding domain-containing protein	0.9495	100	269
AF-A0A150QJ33-F1-model_v4	Sulfoxide reductase catalytic subunit YedY	0.949	73	303

Feature Viewer

pLDDT	pTM	Quality
74.68	0.77	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F440104

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

144

306

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map