F440090

General Info

Members Datasets Scaffolds Average Seq Length
421 314 374 229

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0002207|Ga0495656_0002207_2583_3356
Length 257
Sequence MSANSLFEASSKLVQRLAGGGNCMNEPTIALEGSWRSALAAEFESPYMQKLNAFLTAQKESGKRIFPTGAEYFRALDLTPLAEVKVVILGQDPYHGLGQAHGLCFSVRPGVRIPPSLVNIYKEMQTDLGIAPARHGFLEHWAKQGVLLLNSVLTVEEAQAASHQGKGWETFTDAVIGKVNDECEAVVFMLWGAYAQRKAAFVDSSRHLVLKAAHPSPLSAHNGFFGSAHFSKANAFLESHGRTPIDWELPAAPRQHG

Samples

Sample ID Description Type Environment
1 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
2 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
3 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
4 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
5 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
6 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
7 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
8 2643221558 Rhizobium sp. Root149 Isolate Unclassified
9 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
10 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
11 2643221599 Rhizobium sp. Root708 Isolate Unclassified
12 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
13 2643221688 Rhizobium sp. Root482 Isolate Unclassified
14 2718217882 Rhizobium sp. N741 Isolate Nodule
15 2718218009 Rhizobium sp. N561 Isolate Nodule
16 2718218363 Rhizobium sp. N113 Isolate Nodule
17 2718218365 Rhizobium sp. N731 Isolate Nodule
18 2718218366 Rhizobium sp. N621 Isolate Nodule
19 2721755514 Rhizobium sp. N6212 Isolate Nodule
20 2721755810 Rhizobium sp. N871 Isolate Nodule
21 2728369365 Rhizobium sp. N1341 Isolate Nodule
22 2728369397 Rhizobium sp. N1314 Isolate Nodule
23 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
24 2791355260 Rhizobium sp. L9 Isolate Nodule
25 2791355264 Rhizobium sp. S9 Isolate Nodule
26 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
27 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
28 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
29 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
30 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
31 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
32 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
33 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
34 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
35 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
36 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
37 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
38 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
39 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
40 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
41 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
42 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
43 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
44 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
45 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
46 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
47 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
49 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
50 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
51 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
52 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
53 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
57 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
60 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
61 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
65 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
71 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
170 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
171 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
172 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
183 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
184 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
187 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
188 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
191 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
192 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
193 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
194 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
197 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
220 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
221 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
234 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
254 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
288 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
289 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
290 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
291 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
292 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
293 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
294 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
295 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
296 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
297 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
298 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
299 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
300 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
301 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
302 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
303 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
304 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
305 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
306 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
307 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
308 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
309 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
310 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
311 8024501048 Rhizobium sp. H4 Isolate Nodule
312 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
313 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
314 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.12
Metatranscriptomes 0.71
Isolates 11.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.28
Nodule 5.7
Rhizoplane 3.33
Rhizosphere 57.01
Stem 0
Stem Tuber 0
Unclassified 10.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000008 3300002739 Bacteria 54279
2 JGI25152J39213_1004038 3300002773 Bacteria 4778
3 JGI25159J45721_1000062 3300002987 Bacteria 52082
4 JGI25151J46595_10002949 3300003187 Bacteria 9718
5 JGI25406J46586_10000620 3300003203 Bacteria 16621
6 JGI25161J50226_1000045 3300003374 Bacteria 116781
7 Ga0055526_1020965 3300003771 Bacteria 2296
8 Ga0055524_1003877 3300003775 Bacteria 7097
9 Ga0055536_1001379 3300003781 Bacteria 14759
10 Ga0055536_1005629 3300003781 Bacteria 6068
11 Ga0055534_1028253 3300003784 Bacteria 880
12 Ga0055528_1000727 3300003790 Bacteria 23231
13 Ga0055528_1022845 3300003790 Bacteria 1932
14 Ga0055530_10000048 3300003791 Bacteria 107993
15 Ga0055531_10002207 3300003794 Bacteria 13240
16 Ga0055531_10004679 3300003794 Bacteria 8201
17 Ga0055531_10031631 3300003794 Bacteria 1747
18 Ga0055543_1000076 3300004625 Bacteria 86664
19 Ga0065165_1000574 3300005262 Bacteria 54472
20 Ga0070658_10003987 3300005327 Bacteria 12105
21 Ga0070683_100177960 3300005329 Bacteria 2019
22 Ga0070670_100286428 3300005331 Bacteria 1439
23 Ga0070677_10018869 3300005333 Bacteria 2491
24 Ga0068868_100082756 3300005338 Bacteria 2575
25 Ga0070660_100079196 3300005339 Bacteria 2578
26 Ga0070689_100014594 3300005340 Bacteria 5710
27 Ga0070692_10388446 3300005345 Bacteria 878
28 Ga0070668_100001505 3300005347 Bacteria 16840
29 Ga0070669_100414881 3300005353 Bacteria 1104
30 Ga0070671_100013958 3300005355 Bacteria 6484
31 Ga0070674_100020025 3300005356 Bacteria 4264
32 Ga0070688_100223327 3300005365 Bacteria 1329
33 Ga0070701_10434677 3300005438 Bacteria 839
34 Ga0070700_100599372 3300005441 Bacteria 863
35 Ga0070708_100134608 3300005445 Bacteria 2288
36 Ga0070663_100136356 3300005455 Bacteria 1869
37 Ga0070681_10026676 3300005458 Bacteria 5807
38 Ga0068867_100008263 3300005459 Bacteria 7348
39 Ga0070698_100305351 3300005471 Bacteria 1522
40 Ga0070672_100156344 3300005543 Bacteria 1889
41 Ga0070665_100281071 3300005548 Bacteria 1666
42 Ga0068855_100017441 3300005563 Bacteria 8635
43 Ga0070664_100097610 3300005564 Bacteria 2551
44 Ga0068866_10009793 3300005718 Bacteria 4083
45 Ga0068870_10248308 3300005840 Bacteria 1102
46 Ga0068858_100193544 3300005842 Bacteria 1921
47 Ga0068860_100225494 3300005843 Bacteria 1820
48 Ga0068860_100746240 3300005843 Bacteria 990
49 Ga0081455_10128997 3300005937 Bacteria 1980
50 Ga0081538_10000101 3300005981 Bacteria 83888
51 Ga0081538_10004504 3300005981 Bacteria 12823
52 Ga0081539_10001153 3300005985 Bacteria 47882
53 Ga0075365_10067254 3300006038 Bacteria 2405
54 Ga0075365_10105402 3300006038 Bacteria 1934
55 Ga0075363_100151007 3300006048 Bacteria 1311
56 Ga0075363_100354096 3300006048 Bacteria 858
57 Ga0075364_10016245 3300006051 Bacteria 4629
58 Ga0075364_10100757 3300006051 Bacteria 1923
59 Ga0075364_10169007 3300006051 Bacteria 1478
60 Ga0075364_10169106 3300006051 Bacteria 1477
61 Ga0075362_10010065 3300006177 Bacteria 3679
62 Ga0075367_10036996 3300006178 Bacteria 2833
63 Ga0097621_100154856 3300006237 Bacteria 1967
64 Ga0097621_100310898 3300006237 Bacteria 1394
65 Ga0075370_10055409 3300006353 Bacteria 2253
66 Ga0075430_100004378 3300006846 Bacteria 11919
67 Ga0075431_100010375 3300006847 Bacteria 9359
68 Ga0075429_100017153 3300006880 Bacteria 6262
69 Ga0068865_100016884 3300006881 Bacteria 4682
70 Ga0114129_10196830 3300009147 Bacteria 2732
71 Ga0105243_10822284 3300009148 Bacteria 917
72 Ga0105242_10091539 3300009176 Unclassified 2560
73 Ga0105237_10000013 3300009545 Bacteria 297699
74 Ga0105238_10016478 3300009551 Bacteria 7481
75 Ga0105249_10149794 3300009553 Bacteria 2245
76 Ga0105239_10037409 3300010375 Bacteria 5321
77 Ga0105239_10219845 3300010375 Bacteria 2130
78 Ga0105239_10348938 3300010375 Bacteria 1671
79 Ga0157370_10111033 3300013104 Bacteria 2563
80 Ga0157369_10425353 3300013105 Bacteria 1377
81 Ga0157374_10162379 3300013296 Bacteria 2176
82 Ga0157380_10460572 3300014326 Bacteria 1224
83 Ga0157379_10028319 3300014968 Bacteria 4985
84 Ga0157376_10607378 3300014969 Bacteria 1089
85 Ga0163161_10039985 3300017792 Bacteria 3368
86 Ga0206356_11558345 3300020070 Bacteria 1550
87 Ga0206354_10859650 3300020081 Unclassified 1005
88 Ga0213875_10006456 3300021388 Bacteria 6153
89 Ga0224712_10042482 3300022467 Bacteria 1723
90 Ga0209436_100001 3300025208 Bacteria 304543
91 Ga0209436_100003 3300025208 Bacteria 220530
92 Ga0209563_106992 3300025230 Bacteria 1889
93 Ga0209129_1000226 3300025258 Bacteria 63537
94 Ga0209673_1000125 3300025273 Bacteria 168465
95 Ga0209673_1016795 3300025273 Bacteria 2723
96 Ga0209130_1000049 3300025284 Bacteria 226841
97 Ga0209130_1018204 3300025284 Bacteria 1654
98 Ga0209675_1000181 3300025291 Bacteria 71490
99 Ga0209676_1000113 3300025292 Bacteria 207931
100 Ga0209676_1000759 3300025292 Bacteria 43492
101 Ga0209676_1001045 3300025292 Bacteria 31908
102 Ga0209676_1039418 3300025292 Bacteria 1342
103 Ga0209025_1001755 3300025294 Bacteria 25992
104 Ga0209025_1009955 3300025294 Bacteria 6526
105 Ga0209025_1020830 3300025294 Bacteria 3562
106 Ga0209025_1025962 3300025294 Bacteria 2960
107 Ga0209564_1021296 3300025295 Bacteria 2337
108 Ga0209758_1026023 3300025297 Bacteria 2548
109 Ga0209758_1051649 3300025297 Bacteria 1429
110 Ga0209050_1001942 3300025298 Bacteria 19632
111 Ga0209256_1002742 3300025299 Bacteria 13610
112 Ga0207426_1000043 3300025302 Bacteria 432827
113 Ga0209257_1000083 3300025304 Bacteria 296207
114 Ga0209257_1000126 3300025304 Bacteria 215705
115 Ga0209257_1000340 3300025304 Bacteria 97492
116 Ga0209257_1002405 3300025304 Bacteria 18707
117 Ga0207642_10014827 3300025899 Bacteria 2887
118 Ga0207688_10193896 3300025901 Bacteria 1216
119 Ga0207643_10222161 3300025908 Bacteria 1156
120 Ga0207705_10040788 3300025909 Bacteria 3331
121 Ga0207684_10594778 3300025910 Bacteria 945
122 Ga0207707_10043810 3300025912 Bacteria 3902
123 Ga0207671_10000024 3300025914 Bacteria 274628
124 Ga0207657_10420923 3300025919 Bacteria 1050
125 Ga0207694_10023571 3300025924 Bacteria 4673
126 Ga0207644_10043497 3300025931 Bacteria 3187
127 Ga0207686_10071462 3300025934 Unclassified 2233
128 Ga0207709_10139006 3300025935 Bacteria 1667
129 Ga0207670_10033512 3300025936 Unclassified 3311
130 Ga0207669_10458508 3300025937 Bacteria 1012
131 Ga0207691_10301094 3300025940 Bacteria 1378
132 Ga0207667_10320094 3300025949 Bacteria 1584
133 Ga0207712_10184598 3300025961 Bacteria 1641
134 Ga0207712_10317987 3300025961 Bacteria 1283
135 Ga0207668_10222127 3300025972 Bacteria 1518
136 Ga0207658_10202347 3300025986 Bacteria 1659
137 Ga0207658_10307123 3300025986 Bacteria 1369
138 Ga0207703_10015142 3300026035 Bacteria 6020
139 Ga0207703_10325847 3300026035 Bacteria 1408
140 Ga0207678_10508493 3300026067 Bacteria 1051
141 Ga0207708_10175295 3300026075 Bacteria 1700
142 Ga0207648_10010867 3300026089 Bacteria 8604
143 Ga0207648_10380968 3300026089 Bacteria 1275
144 Ga0207648_10751069 3300026089 Bacteria 906
145 Ga0207676_10640366 3300026095 Bacteria 1025
146 Ga0207674_10012927 3300026116 Bacteria 9309
147 Ga0207675_100058977 3300026118 Bacteria 3582
148 Ga0268266_10056016 3300028379 Bacteria 3391
149 Ga0268265_10707782 3300028380 Bacteria 974
150 Ga0268264_10370540 3300028381 Bacteria 1369
151 Ga0307515_10002150 3300028794 Bacteria 43260
152 Ga0307515_10051405 3300028794 Bacteria 6145
153 Ga0307513_10176099 3300031456 Bacteria 2009
154 Ga0307405_10205676 3300031731 Bacteria 1433
155 Ga0307413_10352839 3300031824 Bacteria 1136
156 Ga0307406_10012570 3300031901 Bacteria 4826
157 Ga0307406_10045598 3300031901 Bacteria 2753
158 Ga0307406_10407036 3300031901 Bacteria 1080
159 Ga0307412_10033305 3300031911 Bacteria 3274
160 Ga0307412_10061327 3300031911 Bacteria 2528
161 Ga0307412_10084193 3300031911 Bacteria 2207
162 Ga0307412_10135042 3300031911 Bacteria 1798
163 Ga0307412_10136916 3300031911 Bacteria 1788
164 Ga0307414_10000073 3300032004 Bacteria 94656
165 Ga0307414_10006992 3300032004 Bacteria 6325
166 Ga0307414_10017307 3300032004 Bacteria 4406
167 Ga0307414_10064569 3300032004 Bacteria 2607
168 Ga0307414_10074033 3300032004 Bacteria 2466
169 Ga0307415_100069014 3300032126 Bacteria 2477
170 Ga0307507_10125420 3300033179 Bacteria 2033
171 Ga0373930_0024752 3300034816 Bacteria 1201
172 Ga0373928_0001506 3300035084 Bacteria 4533
173 Ga0373951_0043552 3300035091 Bacteria 1088
174 Ga0373932_0034330 3300035112 Bacteria 1428
175 Ga0373931_0000003 3300035691 Bacteria 560286
176 Ga0316582_0017440 3300036647 Bacteria 4155
177 Ga0316584_0057373 3300036712 Bacteria 2915
178 Ga0316584_0188278 3300036712 Bacteria 1526
179 Ga0395899_0365324 3300037312 Bacteria 962
180 Ga0395900_0001296 3300037418 Bacteria 30462
181 Ga0395898_0023716 3300037466 Bacteria 6194
182 Ga0395905_0000845 3300037471 Bacteria 40004
183 Ga0395905_0001960 3300037471 Bacteria 23549
184 Ga0395905_0010818 3300037471 Bacteria 8838
185 Ga0436364_0157149 3300037853 Bacteria 29341
186 Ga0439439_0012779 3300041406 Bacteria 2031
187 Ga0439453_0022923 3300041408 Bacteria 1136
188 Ga0439466_0007509 3300041411 Bacteria 4124
189 Ga0439465_0003243 3300041413 Bacteria 5312
190 Ga0451802_0784639 3300041460 Bacteria 989
191 Ga0451806_128380 3300041462 Bacteria 1127
192 Ga0451807_1397041 3300041486 Bacteria 2921
193 Ga0451853_3569642 3300041512 Bacteria 1177
194 Ga0439432_068700 3300042006 Bacteria 1083
195 Ga0439452_056532 3300042010 Bacteria 887
196 Ga0450906_001180 3300042145 Bacteria 5782
197 Ga0450907_004599 3300042146 Bacteria 2370
198 Ga0450910_011077 3300042147 Bacteria 1291
199 Ga0439446_0012144 3300042156 Bacteria 2350
200 Ga0439435_0007870 3300042436 Bacteria 2458
201 Ga0450918_007306 3300042531 Bacteria 1958
202 Ga0451577_0787939 3300042876 Bacteria 859
203 Ga0466969_0000797 3300044656 Bacteria 17155
204 Ga0466966_0000085 3300044684 Bacteria 58533
205 Ga0466961_0039893 3300044693 Bacteria 3009
206 Ga0466961_0234760 3300044693 Bacteria 1128
207 Ga0453684_0005568 3300044712 Bacteria 24852
208 Ga0453684_0153847 3300044712 Bacteria 2729
209 Ga0466971_0000560 3300044719 Bacteria 14740
210 Ga0466968_0026211 3300044735 Bacteria 2391
211 Ga0466970_0002721 3300044765 Bacteria 8539
212 Ga0466957_0002701 3300044842 Bacteria 9592
213 Ga0466957_0319945 3300044842 Unclassified 1046
214 Ga0466959_0000028 3300045049 Bacteria 114144
215 Ga0466958_0000408 3300045836 Bacteria 17657
216 Ga0495603_0061906 3300046455 Bacteria 2210
217 Ga0495638_0003892 3300046460 Bacteria 11558
218 Ga0495638_0055285 3300046460 Bacteria 2465
219 Ga0495641_0117089 3300046461 Bacteria 1188
220 Ga0495605_0002966 3300046474 Bacteria 10273
221 Ga0495585_0024826 3300046492 Bacteria 3436
222 Ga0495607_0041219 3300046501 Bacteria 2744
223 Ga0495583_0003285 3300046506 Bacteria 12546
224 Ga0495583_0036897 3300046506 Bacteria 2321
225 Ga0495583_0051620 3300046506 Bacteria 1874
226 Ga0495606_0077836 3300046507 Bacteria 2070
227 Ga0495610_0100187 3300046512 Bacteria 1299
228 Ga0495616_0012156 3300046513 Bacteria 4899
229 Ga0495620_0096411 3300046515 Bacteria 1182
230 Ga0495631_0002952 3300046518 Bacteria 9418
231 Ga0495632_0009287 3300046519 Bacteria 5939
232 Ga0495643_0083941 3300046522 Bacteria 1653
233 Ga0495654_0044871 3300046530 Bacteria 2183
234 Ga0495656_0002207 3300046615 Bacteria 6429
235 Ga0495668_0000004 3300046616 Bacteria 574236
236 Ga0495668_0002457 3300046616 Bacteria 15250
237 Ga0495611_0007709 3300046648 Bacteria 4573
238 Ga0495625_0000914 3300046660 Bacteria 39744
239 Ga0495625_0005629 3300046660 Bacteria 11361
240 Ga0495588_0316096 3300046674 Bacteria 822
241 Ga0495624_0322073 3300046690 Bacteria 931
242 Ga0495670_0058177 3300046691 Bacteria 1941
243 Ga0495670_0386940 3300046691 Bacteria 755
244 Ga0495589_0042569 3300046794 Bacteria 2263
245 Ga0495660_0081804 3300046810 Bacteria 1692
246 Ga0495672_0019970 3300047320 Bacteria 4403
247 Ga0495681_0022104 3300047470 Bacteria 3412
248 Ga0495686_0330158 3300047472 Bacteria 834
249 Ga0495626_0070385 3300048091 Bacteria 1574
250 Ga0496101_0148332 3300048904 Bacteria 1792
251 Ga0496102_0038473 3300048905 Bacteria 4317
252 Ga0496104_0005278 3300048907 Bacteria 11294
253 Ga0496105_0228055 3300048908 Bacteria 1514
254 Ga0496106_0045752 3300048909 Unclassified 3288
255 Ga0496107_0121052 3300048910 Bacteria 1928
256 Ga0496108_0477961 3300048911 Bacteria 1089
257 Ga0496109_0110407 3300048912 Bacteria 2557
258 Ga0496110_0105267 3300048913 Bacteria 2531
259 Ga0496111_0006457 3300048914 Bacteria 7617
260 Ga0496114_0005604 3300048917 Bacteria 9844
261 Ga0496116_0093218 3300048919 Bacteria 1824
262 Ga0496118_0029425 3300048921 Bacteria 4606
263 Ga0496118_0055771 3300048921 Bacteria 2977
264 Ga0496118_0225675 3300048921 Bacteria 1086
265 Ga0496119_0022348 3300048922 Bacteria 4532
266 Ga0496120_0069999 3300048923 Bacteria 1930
267 Ga0496121_0000003 3300048924 Bacteria 1191431
268 Ga0496121_0020800 3300048924 Bacteria 6468
269 Ga0496121_0425684 3300048924 Bacteria 862
270 Ga0496122_0000042 3300048925 Bacteria 280482
271 Ga0496122_0034959 3300048925 Bacteria 4102
272 Ga0496122_0321524 3300048925 Bacteria 822
273 Ga0496123_0000030 3300048926 Bacteria 291764
274 Ga0496123_0022135 3300048926 Bacteria 4910
275 Ga0496123_0054632 3300048926 Bacteria 2627
276 Ga0496123_0066887 3300048926 Bacteria 2273
277 Ga0496124_0000072 3300048927 Bacteria 219914
278 Ga0496124_0025200 3300048927 Bacteria 5389
279 Ga0496124_0117688 3300048927 Bacteria 2128
280 Ga0496124_0139540 3300048927 Bacteria 1914
281 Ga0496124_0237307 3300048927 Bacteria 1358
282 Ga0496125_0000170 3300048928 Bacteria 145369
283 Ga0496125_0096270 3300048928 Bacteria 2198
284 Ga0496126_0121491 3300048929 Bacteria 2264
285 Ga0496126_0216947 3300048929 Bacteria 1609
286 Ga0496126_0384277 3300048929 Bacteria 1142
287 Ga0496126_0403994 3300048929 Bacteria 1107
288 Ga0501031_0031144 3300049568 Bacteria 3480
289 Ga0501033_0002091 3300049570 Bacteria 17309
290 Ga0501034_0008684 3300049571 Bacteria 10703
291 Ga0501034_0048912 3300049571 Bacteria 4267
292 Ga0501034_0119619 3300049571 Bacteria 2620
293 Ga0501034_0202975 3300049571 Bacteria 1940
294 Ga0501034_0210357 3300049571 Bacteria 1900
295 Ga0501034_0247703 3300049571 Bacteria 1726
296 Ga0501036_0012347 3300049572 Bacteria 7073
297 Ga0501036_0036867 3300049572 Bacteria 4137
298 Ga0501036_0251167 3300049572 Bacteria 1482
299 Ga0501037_0002144 3300049573 Bacteria 14288
300 Ga0501038_0013713 3300049574 Bacteria 7388
301 Ga0501039_0118615 3300049575 Bacteria 2073
302 Ga0501042_0645357 3300049578 Bacteria 769
303 Ga0501043_0112988 3300049579 Bacteria 2133
304 Ga0501043_0150146 3300049579 Bacteria 1823
305 Ga0501046_0101130 3300049580 Bacteria 2212
306 Ga0501046_0135727 3300049580 Bacteria 1864
307 Ga0501047_0054299 3300049581 Bacteria 3875
308 Ga0501047_0056193 3300049581 Bacteria 3805
309 Ga0501047_0344163 3300049581 Bacteria 1328
310 Ga0501048_0377245 3300049582 Bacteria 1012
311 Ga0501069_0119635 3300049585 Bacteria 1504
312 Ga0501069_0158621 3300049585 Bacteria 1302
313 Ga0501070_0284469 3300049586 Bacteria 1349
314 Ga0501070_0766179 3300049586 Bacteria 760
315 Ga0501071_0013919 3300049587 Bacteria 5495
316 Ga0501076_0195090 3300049592 Bacteria 1653
317 Ga0501080_0056101 3300049742 Bacteria 3669
318 Ga0501083_0047365 3300049744 Bacteria 2904
319 Ga0501035_0003184 3300049822 Bacteria 15735
320 Ga0501035_0021771 3300049822 Bacteria 5893
321 Ga0501035_0535906 3300049822 Bacteria 960
322 Ga0501044_0006536 3300049823 Bacteria 12872
323 Ga0501044_0010417 3300049823 Bacteria 10089
324 Ga0501044_0084372 3300049823 Bacteria 3211
325 Ga0501045_0063220 3300049824 Bacteria 2716
326 nmdc:mga03683_206926_c1 3300050489 Bacteria 902
327 nmdc:mga03683_4058_c2 3300050489 Bacteria 3806
328 nmdc:mga03n38_112531_c1 3300050490 Bacteria 1328
329 nmdc:mga03n38_19407_c1 3300050490 Bacteria 2701
330 nmdc:mga03n38_303787_c1 3300050490 Bacteria 858
331 nmdc:mga00v17_102044_c1 3300050491 Bacteria 1812
332 nmdc:mga00v17_114513_c2 3300050491 Bacteria 1196
333 nmdc:mga00v17_175564_c1 3300050491 Bacteria 1382
334 nmdc:mga00v17_499013_c1 3300050491 Bacteria 789
335 nmdc:mga00v17_7766_c1 3300050491 Bacteria 5748
336 nmdc:mga0yw44_105464_c1 3300050492 Bacteria 1800
337 nmdc:mga0yw44_13620_c1 3300050492 Bacteria 4288
338 nmdc:mga0k408_341906_c1 3300050493 Bacteria 892
339 nmdc:mga09592_442_c1 3300050508 Bacteria 30628
340 nmdc:mga0qj67_2157_c1 3300050509 Bacteria 13981
341 nmdc:mga0qj67_727292_c1 3300050509 Bacteria 788
342 nmdc:mga06r32_1115_c1 3300050510 Bacteria 24067
343 nmdc:mga0sz30_91361_c1 3300050516 Bacteria 1325
344 Ga0500635_0000803 3300053080 Bacteria 7747
345 Ga0500578_0202979 3300053086 Bacteria 1212
346 Ga0500644_0002158 3300053088 Bacteria 4977
347 Ga0500650_0032902 3300053098 Bacteria 2364
348 Ga0500557_018664 3300053105 Bacteria 1939
349 Ga0500562_018223 3300053108 Bacteria 1813
350 Ga0500569_011381 3300053109 Bacteria 2123
351 Ga0500592_007007 3300053116 Bacteria 1793
352 Ga0500594_0000002 3300053118 Bacteria 916890
353 Ga0500594_0000601 3300053118 Bacteria 7716
354 Ga0500608_000148 3300053122 Bacteria 29285
355 Ga0500608_097448 3300053122 Bacteria 1366
356 Ga0500658_0004694 3300053134 Bacteria 5099
357 Ga0500658_0247924 3300053134 Bacteria 818
358 Ga0500559_0003033 3300053136 Bacteria 8396
359 Ga0500568_0000097 3300053139 Bacteria 82019
360 Ga0500568_0001143 3300053139 Bacteria 17806
361 Ga0500568_0001944 3300053139 Bacteria 12660
362 Ga0500568_0092190 3300053139 Bacteria 1142
363 Ga0500588_0116749 3300053146 Bacteria 937
364 Ga0500604_0038216 3300053151 Bacteria 1439
365 Ga0500616_0003751 3300053153 Bacteria 11324
366 Ga0500622_0000083 3300053156 Bacteria 101289
367 Ga0500622_0004457 3300053156 Bacteria 8785
368 Ga0500627_0000071 3300053158 Bacteria 41860
369 Ga0500627_0199895 3300053158 Bacteria 896
370 Ga0500633_0001155 3300053160 Bacteria 4799
371 Ga0500634_0006260 3300053161 Bacteria 5741
372 Ga0466962_0000574 3300061719 Bacteria 16166
373 Ga0530510_0118210 3300061734 Bacteria 1945
374 Ga0530510_0200757 3300061734 Bacteria 1481

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025972 Ga0207668_10222127 Ga0207668_102221273 195
2 3300020081 Ga0206354_10859650 Ga0206354_108596501 198
3 3300044842 Ga0466957_0319945 Ga0466957_0319945_425_1030 201
4 iso_pu_bacteria 2529292951 2530646418 202
5 3300047320 Ga0495672_0019970 Ga0495672_0019970_3764_4393 206
6 3300048925 Ga0496122_0321524 Ga0496122_0321524_43_675 206
7 3300048929 Ga0496126_0121491 Ga0496126_0121491_11_640 206
8 3300049579 Ga0501043_0112988 Ga0501043_0112988_1470_2090 206
9 3300049580 Ga0501046_0101130 Ga0501046_0101130_1362_1982 206
10 3300049581 Ga0501047_0344163 Ga0501047_0344163_211_831 206
11 3300049744 Ga0501083_0047365 Ga0501083_0047365_2241_2861 206
12 3300053160 Ga0500633_0001155 Ga0500633_0001155_199_819 206
13 3300031901 Ga0307406_10045598 Ga0307406_100455982 207
14 3300049575 Ga0501039_0118615 Ga0501039_0118615_397_1074 208
15 3300049585 Ga0501069_0119635 Ga0501069_0119635_40_717 208
16 3300061734 Ga0530510_0200757 Ga0530510_0200757_24_701 208
17 3300049572 Ga0501036_0036867 Ga0501036_0036867_2627_3304 209
18 3300049822 Ga0501035_0535906 Ga0501035_0535906_196_873 209
19 3300028380 Ga0268265_10707782 Ga0268265_107077822 210
20 3300013105 Ga0157369_10425353 Ga0157369_104253532 214
21 3300005564 Ga0070664_100097610 Ga0070664_1000976102 215
22 3300003203 JGI25406J46586_10000620 JGI25406J46586_1000062014 216
23 3300005985 Ga0081539_10001153 Ga0081539_1000115319 216
24 3300028794 Ga0307515_10051405 Ga0307515_100514057 216
25 3300031456 Ga0307513_10176099 Ga0307513_101760994 216
26 3300031824 Ga0307413_10352839 Ga0307413_103528392 216
27 3300032126 Ga0307415_100069014 Ga0307415_1000690143 216
28 3300033179 Ga0307507_10125420 Ga0307507_101254203 216
29 3300049571 Ga0501034_0202975 Ga0501034_0202975_1002_1679 216
30 iso_pu_bacteria 2795385470 2795783554 216
31 iso_pu_bacteria 8047710418 8047715568 216
32 3300006038 Ga0075365_10105402 Ga0075365_101054022 217
33 3300037471 Ga0395905_0000845 Ga0395905_0000845_33557_34210 217
34 3300049571 Ga0501034_0008684 Ga0501034_0008684_8909_9592 217
35 3300049585 Ga0501069_0158621 Ga0501069_0158621_400_1056 218
36 3300025931 Ga0207644_10043497 Ga0207644_100434972 219
37 3300026035 Ga0207703_10015142 Ga0207703_100151427 219
38 3300035084 Ga0373928_0001506 Ga0373928_0001506_3484_4143 219
39 3300035091 Ga0373951_0043552 Ga0373951_0043552_404_1063 219
40 3300035112 Ga0373932_0034330 Ga0373932_0034330_738_1397 219
41 3300035691 Ga0373931_0000003 Ga0373931_0000003_363167_363826 219
42 3300041408 Ga0439453_0022923 Ga0439453_0022923_24_683 219
43 3300042147 Ga0450910_011077 Ga0450910_011077_188_847 219
44 3300042156 Ga0439446_0012144 Ga0439446_0012144_1624_2283 219
45 3300042436 Ga0439435_0007870 Ga0439435_0007870_244_903 219
46 3300046461 Ga0495641_0117089 Ga0495641_0117089_105_764 219
47 3300046690 Ga0495624_0322073 Ga0495624_0322073_178_849 219
48 3300049578 Ga0501042_0645357 Ga0501042_0645357_43_702 219
49 3300049582 Ga0501048_0377245 Ga0501048_0377245_137_796 219
50 3300049586 Ga0501070_0766179 Ga0501070_0766179_81_740 219
51 3300049587 Ga0501071_0013919 Ga0501071_0013919_3652_4311 219
52 3300049823 Ga0501044_0010417 Ga0501044_0010417_6509_7168 219
53 3300049824 Ga0501045_0063220 Ga0501045_0063220_952_1611 219
54 3300050490 nmdc:mga03n38_19407_c1 nmdc:mga03n38_19407_c1_521_1180 219
55 3300050509 nmdc:mga0qj67_727292_c1 nmdc:mga0qj67_727292_c1_25_684 219
56 3300061734 Ga0530510_0118210 Ga0530510_0118210_263_922 219
57 3300005843 Ga0068860_100225494 Ga0068860_1002254942 220
58 3300006038 Ga0075365_10067254 Ga0075365_100672542 220
59 3300006048 Ga0075363_100151007 Ga0075363_1001510072 220
60 3300006048 Ga0075363_100354096 Ga0075363_1003540962 220
61 3300006051 Ga0075364_10016245 Ga0075364_100162453 220
62 3300006051 Ga0075364_10100757 Ga0075364_101007573 220
63 3300006051 Ga0075364_10169106 Ga0075364_101691061 220
64 3300025901 Ga0207688_10193896 Ga0207688_101938962 220
65 3300025986 Ga0207658_10307123 Ga0207658_103071232 220
66 3300028381 Ga0268264_10370540 Ga0268264_103705402 220
67 3300049568 Ga0501031_0031144 Ga0501031_0031144_321_983 220
68 3300049571 Ga0501034_0247703 Ga0501034_0247703_81_743 220
69 3300049572 Ga0501036_0251167 Ga0501036_0251167_271_933 220
70 3300049573 Ga0501037_0002144 Ga0501037_0002144_5320_5982 220
71 3300049581 Ga0501047_0054299 Ga0501047_0054299_230_940 220
72 3300049586 Ga0501070_0284469 Ga0501070_0284469_470_1132 220
73 3300049742 Ga0501080_0056101 Ga0501080_0056101_567_1277 220
74 3300050489 nmdc:mga03683_206926_c1 nmdc:mga03683_206926_c1_28_690 220
75 3300050490 nmdc:mga03n38_112531_c1 nmdc:mga03n38_112531_c1_189_851 220
76 3300050490 nmdc:mga03n38_303787_c1 nmdc:mga03n38_303787_c1_95_757 220
77 3300050491 nmdc:mga00v17_102044_c1 nmdc:mga00v17_102044_c1_281_943 220
78 3300050491 nmdc:mga00v17_114513_c2 nmdc:mga00v17_114513_c2_492_1154 220
79 3300050491 nmdc:mga00v17_175564_c1 nmdc:mga00v17_175564_c1_84_746 220
80 3300050491 nmdc:mga00v17_7766_c1 nmdc:mga00v17_7766_c1_4219_4881 220
81 3300050492 nmdc:mga0yw44_13620_c1 nmdc:mga0yw44_13620_c1_103_765 220
82 3300053118 Ga0500594_0000002 Ga0500594_0000002_187755_188417 220
83 3300053139 Ga0500568_0092190 Ga0500568_0092190_384_1049 220
84 3300005445 Ga0070708_100134608 Ga0070708_1001346084 221
85 3300005937 Ga0081455_10128997 Ga0081455_101289973 221
86 3300005981 Ga0081538_10000101 Ga0081538_1000010138 221
87 3300005981 Ga0081538_10004504 Ga0081538_100045042 221
88 3300025910 Ga0207684_10594778 Ga0207684_105947781 221
89 3300041460 Ga0451802_0784639 Ga0451802_0784639_223_888 221
90 3300049592 Ga0501076_0195090 Ga0501076_0195090_686_1354 221
91 3300050492 nmdc:mga0yw44_105464_c1 nmdc:mga0yw44_105464_c1_189_854 221
92 3300053151 Ga0500604_0038216 Ga0500604_0038216_380_1045 221
93 3300005331 Ga0070670_100286428 Ga0070670_1002864282 222
94 3300005338 Ga0068868_100082756 Ga0068868_1000827563 222
95 3300005340 Ga0070689_100014594 Ga0070689_1000145946 222
96 3300005345 Ga0070692_10388446 Ga0070692_103884461 222
97 3300005356 Ga0070674_100020025 Ga0070674_1000200255 222
98 3300005365 Ga0070688_100223327 Ga0070688_1002233271 222
99 3300005438 Ga0070701_10434677 Ga0070701_104346772 222
100 3300005441 Ga0070700_100599372 Ga0070700_1005993721 222
101 3300005459 Ga0068867_100008263 Ga0068867_1000082636 222
102 3300005543 Ga0070672_100156344 Ga0070672_1001563441 222
103 3300005718 Ga0068866_10009793 Ga0068866_100097932 222
104 3300005840 Ga0068870_10248308 Ga0068870_102483082 222
105 3300005842 Ga0068858_100193544 Ga0068858_1001935442 222
106 3300005843 Ga0068860_100746240 Ga0068860_1007462402 222
107 3300006237 Ga0097621_100154856 Ga0097621_1001548562 222
108 3300006237 Ga0097621_100310898 Ga0097621_1003108981 222
109 3300006881 Ga0068865_100016884 Ga0068865_1000168842 222
110 3300009176 Ga0105242_10091539 Ga0105242_100915392 222
111 3300009553 Ga0105249_10149794 Ga0105249_101497943 222
112 3300014326 Ga0157380_10460572 Ga0157380_104605722 222
113 3300014968 Ga0157379_10028319 Ga0157379_100283196 222
114 3300014969 Ga0157376_10607378 Ga0157376_106073782 222
115 3300025899 Ga0207642_10014827 Ga0207642_100148272 222
116 3300025908 Ga0207643_10222161 Ga0207643_102221612 222
117 3300025934 Ga0207686_10071462 Ga0207686_100714623 222
118 3300025935 Ga0207709_10139006 Ga0207709_101390062 222
119 3300025936 Ga0207670_10033512 Ga0207670_100335122 222
120 3300025937 Ga0207669_10458508 Ga0207669_104585082 222
121 3300025940 Ga0207691_10301094 Ga0207691_103010941 222
122 3300025961 Ga0207712_10184598 Ga0207712_101845982 222
123 3300025961 Ga0207712_10317987 Ga0207712_103179871 222
124 3300025986 Ga0207658_10202347 Ga0207658_102023471 222
125 3300026035 Ga0207703_10325847 Ga0207703_103258472 222
126 3300026075 Ga0207708_10175295 Ga0207708_101752952 222
127 3300026089 Ga0207648_10010867 Ga0207648_100108673 222
128 3300026095 Ga0207676_10640366 Ga0207676_106403661 222
129 3300026118 Ga0207675_100058977 Ga0207675_1000589773 222
130 3300036647 Ga0316582_0017440 Ga0316582_0017440_508_1245 222
131 3300036712 Ga0316584_0057373 Ga0316584_0057373_1400_2113 222
132 3300036712 Ga0316584_0188278 Ga0316584_0188278_490_1227 222
133 3300037312 Ga0395899_0365324 Ga0395899_0365324_154_822 222
134 3300048904 Ga0496101_0148332 Ga0496101_0148332_853_1536 222
135 3300048905 Ga0496102_0038473 Ga0496102_0038473_307_990 222
136 3300048907 Ga0496104_0005278 Ga0496104_0005278_7425_8108 222
137 3300048908 Ga0496105_0228055 Ga0496105_0228055_265_948 222
138 3300048909 Ga0496106_0045752 Ga0496106_0045752_1598_2281 222
139 3300048910 Ga0496107_0121052 Ga0496107_0121052_217_900 222
140 3300048911 Ga0496108_0477961 Ga0496108_0477961_44_727 222
141 3300048912 Ga0496109_0110407 Ga0496109_0110407_1657_2340 222
142 3300048913 Ga0496110_0105267 Ga0496110_0105267_943_1626 222
143 3300048914 Ga0496111_0006457 Ga0496111_0006457_3732_4415 222
144 3300048917 Ga0496114_0005604 Ga0496114_0005604_2246_2929 222
145 3300003794 Ga0055531_10031631 Ga0055531_100316313 223
146 3300005329 Ga0070683_100177960 Ga0070683_1001779602 223
147 3300005347 Ga0070668_100001505 Ga0070668_1000015056 223
148 3300005455 Ga0070663_100136356 Ga0070663_1001363563 223
149 3300005458 Ga0070681_10026676 Ga0070681_100266762 223
150 3300005563 Ga0068855_100017441 Ga0068855_1000174419 223
151 3300006051 Ga0075364_10169007 Ga0075364_101690073 223
152 3300006177 Ga0075362_10010065 Ga0075362_100100654 223
153 3300006178 Ga0075367_10036996 Ga0075367_100369963 223
154 3300025912 Ga0207707_10043810 Ga0207707_100438104 223
155 3300025949 Ga0207667_10320094 Ga0207667_103200942 223
156 3300026067 Ga0207678_10508493 Ga0207678_105084932 223
157 3300044693 Ga0466961_0234760 Ga0466961_0234760_332_1030 223
158 3300049571 Ga0501034_0210357 Ga0501034_0210357_10_681 223
159 3300050489 nmdc:mga03683_4058_c2 nmdc:mga03683_4058_c2_711_1382 223
160 3300050491 nmdc:mga00v17_499013_c1 nmdc:mga00v17_499013_c1_46_717 223
161 3300050493 nmdc:mga0k408_341906_c1 nmdc:mga0k408_341906_c1_197_868 223
162 3300005471 Ga0070698_100305351 Ga0070698_1003053511 224
163 3300006846 Ga0075430_100004378 Ga0075430_10000437810 224
164 3300006847 Ga0075431_100010375 Ga0075431_1000103755 224
165 3300006880 Ga0075429_100017153 Ga0075429_1000171535 224
166 3300009147 Ga0114129_10196830 Ga0114129_101968303 224
167 3300009148 Ga0105243_10822284 Ga0105243_108222842 224
168 3300047472 Ga0495686_0330158 Ga0495686_0330158_38_712 224
169 3300050508 nmdc:mga09592_442_c1 nmdc:mga09592_442_c1_10008_10682 224
170 3300050509 nmdc:mga0qj67_2157_c1 nmdc:mga0qj67_2157_c1_7528_8202 224
171 3300050510 nmdc:mga06r32_1115_c1 nmdc:mga06r32_1115_c1_10332_11006 224
172 iso_pu_bacteria 2643221560 2643819408 224
173 iso_pu_bacteria 2643221563 2643836119 224
174 iso_pu_bacteria 2643221608 2644052596 224
175 iso_pu_bacteria 2852653556 2852656077 224
176 iso_pu_bacteria 2852680915 2852683261 224
177 iso_pu_bacteria 8055431914 8055432175 224
178 3300017792 Ga0163161_10039985 Ga0163161_100399854 225
179 3300020070 Ga0206356_11558345 Ga0206356_115583452 225
180 3300021388 Ga0213875_10006456 Ga0213875_100064564 225
181 3300022467 Ga0224712_10042482 Ga0224712_100424822 225
182 3300026089 Ga0207648_10751069 Ga0207648_107510692 225
183 3300026116 Ga0207674_10012927 Ga0207674_100129274 225
184 3300037853 Ga0436364_0157149 Ga0436364_0157149_5831_6508 225
185 3300044712 Ga0453684_0153847 Ga0453684_0153847_1766_2452 225
186 iso_pu_bacteria 2643221688 2644496458 225
187 iso_pu_bacteria 2791355253 2793283014 225
188 iso_pu_bacteria 8056875544 8056876009 225
189 3300005327 Ga0070658_10003987 Ga0070658_100039874 226
190 3300005333 Ga0070677_10018869 Ga0070677_100188692 226
191 3300005339 Ga0070660_100079196 Ga0070660_1000791962 226
192 3300005355 Ga0070671_100013958 Ga0070671_1000139582 226
193 3300009545 Ga0105237_10000013 Ga0105237_1000001374 226
194 3300009551 Ga0105238_10016478 Ga0105238_100164783 226
195 3300010375 Ga0105239_10219845 Ga0105239_102198453 226
196 3300010375 Ga0105239_10348938 Ga0105239_103489383 226
197 3300013296 Ga0157374_10162379 Ga0157374_101623792 226
198 3300025909 Ga0207705_10040788 Ga0207705_100407883 226
199 3300025914 Ga0207671_10000024 Ga0207671_10000024107 226
200 3300025919 Ga0207657_10420923 Ga0207657_104209231 226
201 3300025924 Ga0207694_10023571 Ga0207694_100235712 226
202 3300026089 Ga0207648_10380968 Ga0207648_103809682 226
203 3300034816 Ga0373930_0024752 Ga0373930_0024752_375_1091 226
204 3300037418 Ga0395900_0001296 Ga0395900_0001296_29115_29795 226
205 3300037466 Ga0395898_0023716 Ga0395898_0023716_109_789 226
206 3300042876 Ga0451577_0787939 Ga0451577_0787939_59_742 226
207 3300044712 Ga0453684_0005568 Ga0453684_0005568_7400_8086 226
208 iso_pu_bacteria 2510917030 2511198644 226
209 iso_pu_bacteria 2582581298 2585221412 226
210 iso_pu_bacteria 2582581299 2585230752 226
211 iso_pu_bacteria 2582581304 2585259197 226
212 iso_pu_bacteria 2585427529 2585544418 226
213 iso_pu_bacteria 2643221558 2643813003 226
214 iso_pu_bacteria 2643221599 2644002994 226
215 iso_pu_bacteria 2791355260 2793319590 226
216 iso_pu_bacteria 2791355264 2793346873 226
217 iso_pu_bacteria 2802429606 2805932599 226
218 iso_pu_bacteria 2838022645 2838023467 226
219 iso_pu_bacteria 2838668709 2838671735 226
220 iso_pu_bacteria 2838701080 2838704414 226
221 iso_pu_bacteria 2842146304 2842149632 226
222 iso_pu_bacteria 2842192696 2842195664 226
223 iso_pu_bacteria 2842198810 2842198981 226
224 iso_pu_bacteria 2842250916 2842254201 226
225 iso_pu_bacteria 2842317721 2842319930 226
226 iso_pu_bacteria 2842489311 2842493528 226
227 iso_pu_bacteria 2842495871 2842497680 226
228 iso_pu_bacteria 2929138655 2929141223 226
229 iso_pu_bacteria 3005445848 3005450976 226
230 iso_pu_bacteria 3005452660 3005455133 226
231 iso_pu_bacteria 8018150411 8018154768 226
232 3300031911 Ga0307412_10084193 Ga0307412_100841933 227
233 3300003781 Ga0055536_1001379 Ga0055536_10013793 228
234 3300003781 Ga0055536_1005629 Ga0055536_10056293 228
235 3300003784 Ga0055534_1028253 Ga0055534_10282531 228
236 3300003791 Ga0055530_10000048 Ga0055530_1000004894 228
237 3300003794 Ga0055531_10002207 Ga0055531_1000220722 228
238 3300003794 Ga0055531_10004679 Ga0055531_100046798 228
239 3300010375 Ga0105239_10037409 Ga0105239_100374095 228
240 3300025291 Ga0209675_1000181 Ga0209675_100018148 228
241 3300025292 Ga0209676_1000113 Ga0209676_1000113219 228
242 3300025292 Ga0209676_1000759 Ga0209676_100075910 228
243 3300025292 Ga0209676_1001045 Ga0209676_100104527 228
244 3300025294 Ga0209025_1020830 Ga0209025_10208304 228
245 3300025294 Ga0209025_1025962 Ga0209025_10259622 228
246 3300025298 Ga0209050_1001942 Ga0209050_10019423 228
247 3300025304 Ga0209257_1000083 Ga0209257_1000083208 228
248 3300025304 Ga0209257_1000126 Ga0209257_1000126182 228
249 3300025304 Ga0209257_1000340 Ga0209257_100034097 228
250 3300025304 Ga0209257_1002405 Ga0209257_10024054 228
251 3300031731 Ga0307405_10205676 Ga0307405_102056762 228
252 3300031901 Ga0307406_10012570 Ga0307406_100125707 228
253 3300031901 Ga0307406_10407036 Ga0307406_104070361 228
254 3300031911 Ga0307412_10033305 Ga0307412_100333056 228
255 3300031911 Ga0307412_10061327 Ga0307412_100613272 228
256 3300031911 Ga0307412_10135042 Ga0307412_101350422 228
257 3300032004 Ga0307414_10000073 Ga0307414_1000007371 228
258 3300032004 Ga0307414_10006992 Ga0307414_100069925 228
259 3300032004 Ga0307414_10017307 Ga0307414_100173077 228
260 3300032004 Ga0307414_10064569 Ga0307414_100645692 228
261 3300032004 Ga0307414_10074033 Ga0307414_100740335 228
262 3300037471 Ga0395905_0001960 Ga0395905_0001960_19388_20089 228
263 3300037471 Ga0395905_0010818 Ga0395905_0010818_5076_5780 228
264 3300046616 Ga0495668_0000004 Ga0495668_0000004_204967_205680 228
265 3300046660 Ga0495625_0000914 Ga0495625_0000914_15972_16685 228
266 3300048921 Ga0496118_0225675 Ga0496118_0225675_182_877 228
267 3300049571 Ga0501034_0048912 Ga0501034_0048912_1174_1869 228
268 3300049571 Ga0501034_0119619 Ga0501034_0119619_1527_2240 228
269 3300049572 Ga0501036_0012347 Ga0501036_0012347_5960_6673 228
270 3300049574 Ga0501038_0013713 Ga0501038_0013713_161_874 228
271 3300049579 Ga0501043_0150146 Ga0501043_0150146_856_1569 228
272 3300049580 Ga0501046_0135727 Ga0501046_0135727_155_868 228
273 3300049581 Ga0501047_0056193 Ga0501047_0056193_2724_3437 228
274 3300049823 Ga0501044_0006536 Ga0501044_0006536_3243_3956 228
275 3300049823 Ga0501044_0084372 Ga0501044_0084372_2062_2763 228
276 3300053080 Ga0500635_0000803 Ga0500635_0000803_5416_6108 228
277 3300053116 Ga0500592_007007 Ga0500592_007007_22_738 228
278 3300053122 Ga0500608_000148 Ga0500608_000148_14271_14966 228
279 3300053136 Ga0500559_0003033 Ga0500559_0003033_145_843 228
280 3300053139 Ga0500568_0001143 Ga0500568_0001143_9532_10245 228
281 3300053158 Ga0500627_0000071 Ga0500627_0000071_18800_19513 228
282 3300025230 Ga0209563_106992 Ga0209563_1069922 229
283 3300041406 Ga0439439_0012779 Ga0439439_0012779_1078_1791 229
284 3300041411 Ga0439466_0007509 Ga0439466_0007509_489_1202 229
285 3300041413 Ga0439465_0003243 Ga0439465_0003243_1417_2130 229
286 3300041462 Ga0451806_128380 Ga0451806_128380_78_848 229
287 3300041486 Ga0451807_1397041 Ga0451807_1397041_1481_2251 229
288 3300041512 Ga0451853_3569642 Ga0451853_3569642_88_858 229
289 3300042006 Ga0439432_068700 Ga0439432_068700_351_1064 229
290 3300042010 Ga0439452_056532 Ga0439452_056532_141_854 229
291 3300042145 Ga0450906_001180 Ga0450906_001180_4438_5151 229
292 3300042146 Ga0450907_004599 Ga0450907_004599_1589_2302 229
293 3300042531 Ga0450918_007306 Ga0450918_007306_297_1010 229
294 3300049570 Ga0501033_0002091 Ga0501033_0002091_4520_5221 229
295 3300049822 Ga0501035_0003184 Ga0501035_0003184_12014_12715 229
296 iso_pu_bacteria 2582581866 2585392529 229
297 3300002739 JGI25158J39367_1000008 JGI25158J39367_100000857 230
298 3300002773 JGI25152J39213_1004038 JGI25152J39213_10040384 230
299 3300002987 JGI25159J45721_1000062 JGI25159J45721_100006220 230
300 3300003187 JGI25151J46595_10002949 JGI25151J46595_100029494 230
301 3300003374 JGI25161J50226_1000045 JGI25161J50226_1000045108 230
302 3300003771 Ga0055526_1020965 Ga0055526_10209651 230
303 3300003775 Ga0055524_1003877 Ga0055524_10038771 230
304 3300003790 Ga0055528_1000727 Ga0055528_10007272 230
305 3300003790 Ga0055528_1022845 Ga0055528_10228451 230
306 3300004625 Ga0055543_1000076 Ga0055543_100007656 230
307 3300005262 Ga0065165_1000574 Ga0065165_100057437 230
308 3300005353 Ga0070669_100414881 Ga0070669_1004148812 230
309 3300005548 Ga0070665_100281071 Ga0070665_1002810713 230
310 3300006353 Ga0075370_10055409 Ga0075370_100554092 230
311 3300013104 Ga0157370_10111033 Ga0157370_101110332 230
312 3300025208 Ga0209436_100001 Ga0209436_100001144 230
313 3300025208 Ga0209436_100003 Ga0209436_100003100 230
314 3300025258 Ga0209129_1000226 Ga0209129_100022610 230
315 3300025273 Ga0209673_1000125 Ga0209673_1000125162 230
316 3300025273 Ga0209673_1016795 Ga0209673_10167952 230
317 3300025284 Ga0209130_1000049 Ga0209130_100004933 230
318 3300025284 Ga0209130_1018204 Ga0209130_10182042 230
319 3300025292 Ga0209676_1039418 Ga0209676_10394181 230
320 3300025294 Ga0209025_1001755 Ga0209025_100175510 230
321 3300025294 Ga0209025_1009955 Ga0209025_10099552 230
322 3300025295 Ga0209564_1021296 Ga0209564_10212961 230
323 3300025297 Ga0209758_1026023 Ga0209758_10260233 230
324 3300025297 Ga0209758_1051649 Ga0209758_10516492 230
325 3300025299 Ga0209256_1002742 Ga0209256_10027423 230
326 3300025302 Ga0207426_1000043 Ga0207426_1000043186 230
327 3300028379 Ga0268266_10056016 Ga0268266_100560163 230
328 3300028794 Ga0307515_10002150 Ga0307515_100021505 230
329 3300031911 Ga0307412_10136916 Ga0307412_101369163 230
330 3300044656 Ga0466969_0000797 Ga0466969_0000797_2995_3708 230
331 3300044684 Ga0466966_0000085 Ga0466966_0000085_54692_55405 230
332 3300044693 Ga0466961_0039893 Ga0466961_0039893_2243_2956 230
333 3300044719 Ga0466971_0000560 Ga0466971_0000560_5933_6646 230
334 3300044735 Ga0466968_0026211 Ga0466968_0026211_71_769 230
335 3300044765 Ga0466970_0002721 Ga0466970_0002721_258_971 230
336 3300044842 Ga0466957_0002701 Ga0466957_0002701_8658_9371 230
337 3300045049 Ga0466959_0000028 Ga0466959_0000028_108698_109411 230
338 3300045836 Ga0466958_0000408 Ga0466958_0000408_11284_11997 230
339 3300046455 Ga0495603_0061906 Ga0495603_0061906_1162_1866 230
340 3300046460 Ga0495638_0003892 Ga0495638_0003892_5925_6617 230
341 3300046460 Ga0495638_0055285 Ga0495638_0055285_526_1218 230
342 3300046474 Ga0495605_0002966 Ga0495605_0002966_1892_2593 230
343 3300046492 Ga0495585_0024826 Ga0495585_0024826_234_935 230
344 3300046501 Ga0495607_0041219 Ga0495607_0041219_1414_2118 230
345 3300046506 Ga0495583_0003285 Ga0495583_0003285_8760_9461 230
346 3300046506 Ga0495583_0036897 Ga0495583_0036897_398_1099 230
347 3300046506 Ga0495583_0051620 Ga0495583_0051620_800_1492 230
348 3300046507 Ga0495606_0077836 Ga0495606_0077836_537_1238 230
349 3300046512 Ga0495610_0100187 Ga0495610_0100187_463_1155 230
350 3300046513 Ga0495616_0012156 Ga0495616_0012156_2785_3486 230
351 3300046515 Ga0495620_0096411 Ga0495620_0096411_402_1103 230
352 3300046518 Ga0495631_0002952 Ga0495631_0002952_8595_9296 230
353 3300046519 Ga0495632_0009287 Ga0495632_0009287_423_1124 230
354 3300046522 Ga0495643_0083941 Ga0495643_0083941_715_1407 230
355 3300046530 Ga0495654_0044871 Ga0495654_0044871_651_1352 230
356 3300046615 Ga0495656_0002207 Ga0495656_0002207_2583_3356 230
357 3300046616 Ga0495668_0002457 Ga0495668_0002457_4618_5319 230
358 3300046648 Ga0495611_0007709 Ga0495611_0007709_2017_2718 230
359 3300046660 Ga0495625_0005629 Ga0495625_0005629_10602_11303 230
360 3300046674 Ga0495588_0316096 Ga0495588_0316096_63_767 230
361 3300046691 Ga0495670_0058177 Ga0495670_0058177_18_719 230
362 3300046691 Ga0495670_0386940 Ga0495670_0386940_23_727 230
363 3300046794 Ga0495589_0042569 Ga0495589_0042569_123_827 230
364 3300046810 Ga0495660_0081804 Ga0495660_0081804_580_1281 230
365 3300047470 Ga0495681_0022104 Ga0495681_0022104_1609_2313 230
366 3300048091 Ga0495626_0070385 Ga0495626_0070385_579_1280 230
367 3300048919 Ga0496116_0093218 Ga0496116_0093218_299_991 230
368 3300048921 Ga0496118_0029425 Ga0496118_0029425_840_1532 230
369 3300048921 Ga0496118_0055771 Ga0496118_0055771_1853_2554 230
370 3300048922 Ga0496119_0022348 Ga0496119_0022348_1085_1789 230
371 3300048923 Ga0496120_0069999 Ga0496120_0069999_1002_1706 230
372 3300048924 Ga0496121_0000003 Ga0496121_0000003_837613_838317 230
373 3300048924 Ga0496121_0020800 Ga0496121_0020800_1888_2580 230
374 3300048924 Ga0496121_0425684 Ga0496121_0425684_142_834 230
375 3300048925 Ga0496122_0000042 Ga0496122_0000042_131555_132253 230
376 3300048925 Ga0496122_0034959 Ga0496122_0034959_2286_2978 230
377 3300048926 Ga0496123_0000030 Ga0496123_0000030_159507_160205 230
378 3300048926 Ga0496123_0022135 Ga0496123_0022135_803_1504 230
379 3300048926 Ga0496123_0054632 Ga0496123_0054632_651_1355 230
380 3300048926 Ga0496123_0066887 Ga0496123_0066887_724_1425 230
381 3300048927 Ga0496124_0000072 Ga0496124_0000072_205713_206414 230
382 3300048927 Ga0496124_0025200 Ga0496124_0025200_2950_3654 230
383 3300048927 Ga0496124_0117688 Ga0496124_0117688_375_1082 230
384 3300048927 Ga0496124_0139540 Ga0496124_0139540_949_1656 230
385 3300048927 Ga0496124_0237307 Ga0496124_0237307_10_711 230
386 3300048928 Ga0496125_0000170 Ga0496125_0000170_33787_34491 230
387 3300048928 Ga0496125_0096270 Ga0496125_0096270_579_1271 230
388 3300048929 Ga0496126_0216947 Ga0496126_0216947_608_1315 230
389 3300048929 Ga0496126_0384277 Ga0496126_0384277_253_972 230
390 3300048929 Ga0496126_0403994 Ga0496126_0403994_149_850 230
391 3300049822 Ga0501035_0021771 Ga0501035_0021771_3702_4430 230
392 3300050516 nmdc:mga0sz30_91361_c1 nmdc:mga0sz30_91361_c1_336_1028 230
393 3300053086 Ga0500578_0202979 Ga0500578_0202979_396_1097 230
394 3300053088 Ga0500644_0002158 Ga0500644_0002158_3057_3749 230
395 3300053098 Ga0500650_0032902 Ga0500650_0032902_77_778 230
396 3300053105 Ga0500557_018664 Ga0500557_018664_786_1487 230
397 3300053108 Ga0500562_018223 Ga0500562_018223_634_1335 230
398 3300053109 Ga0500569_011381 Ga0500569_011381_412_1113 230
399 3300053118 Ga0500594_0000601 Ga0500594_0000601_1046_1747 230
400 3300053122 Ga0500608_097448 Ga0500608_097448_645_1337 230
401 3300053134 Ga0500658_0004694 Ga0500658_0004694_306_1019 230
402 3300053134 Ga0500658_0247924 Ga0500658_0247924_71_772 230
403 3300053139 Ga0500568_0000097 Ga0500568_0000097_28533_29246 230
404 3300053139 Ga0500568_0001944 Ga0500568_0001944_11260_11961 230
405 3300053146 Ga0500588_0116749 Ga0500588_0116749_27_728 230
406 3300053153 Ga0500616_0003751 Ga0500616_0003751_994_1695 230
407 3300053156 Ga0500622_0000083 Ga0500622_0000083_72697_73389 230
408 3300053156 Ga0500622_0004457 Ga0500622_0004457_1824_2516 230
409 3300053158 Ga0500627_0199895 Ga0500627_0199895_94_798 230
410 3300053161 Ga0500634_0006260 Ga0500634_0006260_1329_2030 230
411 3300061719 Ga0466962_0000574 Ga0466962_0000574_3811_4524 230
412 iso_pu_bacteria 2718217882 2719182224 230
413 iso_pu_bacteria 2718218009 2719732940 230
414 iso_pu_bacteria 2718218363 2721148315 230
415 iso_pu_bacteria 2718218365 2721159723 230
416 iso_pu_bacteria 2718218366 2721165151 230
417 iso_pu_bacteria 2721755514 2722841321 230
418 iso_pu_bacteria 2721755810 2724045696 230
419 iso_pu_bacteria 2728369365 2730165459 230
420 iso_pu_bacteria 2728369397 2730299355 230
421 iso_pu_bacteria 8024501048 8024501226 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

76

238

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fcl-assembly1.cif.gz_A complex of ung2 and a fragment-based designed inhibitor 0.9813 8 225
3zor-assembly1.cif.gz_A structure of bsudg 0.9794 8 226
4lyl-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase from cod (gadus morhua) in complex with the proteinaceous inhibitor ugi 0.9776 8 225
3tkb-assembly1.cif.gz_A crystal structure of human uracil-dna glycosylase d183g/k302r mutant 0.9763 8 225
8ail-assembly1.cif.gz_M bacillus phage vmy22 p56 in complex with bacillus weidmannii ung 0.9762 7 227
ID Description Score Start End Superfamily
1okbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9808 8 225 3.40.470.10
af_Q8ILU6_89_322_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9752 8 227 3.40.470.10
af_O74834_61_307_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9718 7 224 3.40.470.10
af_Q1ZXM2_175_429_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.96 8 229 3.40.470.10
1okbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9548 8 225 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A1G3F2M2-F1-model_v4 deleted 0.9998 67 227
AF-A0A0K9QFS9-F1-model_v4 deleted 0.9982 21 228
AF-A0A136HHC5-F1-model_v4 Uracil-DNA glycosylase (EC 3.2.2.27) 0.9978 11 170 GO:0004844
GO:0005737
GO:0097510
AF-A0A661FLH0-F1-model_v4 Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) 0.9972 8 227 GO:0004844
GO:0005737
GO:0097510
AF-A0A4P0TFD6-F1-model_v4 deleted 0.997 26 227

Feature Viewer

pLDDT pTM Quality
95.19 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map