F440010

General Info

Members Datasets Scaffolds Average Seq Length
421 254 417 287

Family's Representative Sequence

Representative Sequence 3300025263|Ga0209565_1000134|Ga0209565_100013453
Length 304
Sequence MRLSLALRRGKGHLGSMDIPADAPTGLAMALDPLVTRILAPNPSPFTYTGTQTYLVGTTELAVIDPGPDDPEHLEALVAAIAGRKLLAILCTHTHRDHSPAAAPLKALTGAPVIGCAPLSLTDAGPRADAAFDTGYAPDRVLEDGEQLSGPGWTLTAVATPGHTSNHLCFALEETGGLFSGDHVMGWSTTVVAPPDGDMAAYMRSLDKLMGREQDRIYFPAHGEPIERPHRFVRGLIGHRRQREGQILRLLRAGTGTVPAMVERMYAGLDPRLNGAAGRSVLAHLIDLRDRGLVGEEGGAWKMA

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
3 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
4 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
157 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
158 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
159 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
160 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
167 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
168 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
171 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
184 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
201 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
227 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
230 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
231 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
241 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
242 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
243 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
244 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
247 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
248 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
251 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
254 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0
Isolates 1.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.05
Nodule 0.48
Rhizoplane 3.8
Rhizosphere 71.02
Stem 0
Stem Tuber 0
Unclassified 6.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003247 3300001979 Bacteria 7180
2 JGI24739J22299_10010647 3300001989 Bacteria 3411
3 JGI24737J22298_10002289 3300001990 Bacteria 6809
4 JGI24737J22298_10012312 3300001990 Bacteria 2789
5 JGI24737J22298_10033410 3300001990 Bacteria 1598
6 JGI24735J21928_10000590 3300002067 Bacteria 12771
7 JGI24735J21928_10001504 3300002067 Bacteria 8243
8 JGI24735J21928_10001790 3300002067 Bacteria 7539
9 JGI24735J21928_10004614 3300002067 Bacteria 4616
10 JGI24735J21928_10018807 3300002067 Bacteria 2128
11 JGI24735J21928_10018837 3300002067 Bacteria 2126
12 JGI24738J21930_10000184 3300002075 Bacteria 16152
13 JGI24744J21845_10008674 3300002077 Bacteria 2089
14 JGI24751J29686_10000660 3300002459 Bacteria 8652
15 JGI25150J39212_1002047 3300002774 Bacteria 5243
16 JGI25153J46596_10000395 3300003215 Bacteria 29365
17 JGI25153J46596_10002504 3300003215 Bacteria 10546
18 rootH1_10055751 3300003316 Bacteria 1033
19 rootH1_10055751 3300003323 Unclassified 3937
20 rootH1_10100018 3300003316 Bacteria 4198
21 rootH1_10122197 3300003316 Bacteria 1782
22 rootH2_10001791 3300003320 Bacteria 1918
23 rootL2_10247348 3300003322 Bacteria 1248
24 rootH1_10035136 3300003323 Bacteria 3354
25 Ga0055526_1004784 3300003771 Bacteria 8017
26 Ga0055537_1001358 3300003773 Bacteria 9868
27 Ga0055537_1002042 3300003773 Bacteria 7124
28 Ga0055524_1000056 3300003775 Bacteria 141764
29 Ga0055530_10000931 3300003791 Bacteria 23980
30 Ga0055530_10020923 3300003791 Bacteria 1940
31 Ga0055540_1002064 3300003792 Bacteria 11085
32 Ga0055531_10000013 3300003794 Bacteria 187583
33 Ga0065165_1002739 3300005262 Bacteria 14075
34 Ga0065165_1003272 3300005262 Bacteria 11685
35 Ga0065165_1009273 3300005262 Bacteria 4438
36 Ga0065165_1011299 3300005262 Bacteria 3746
37 Ga0065165_1035594 3300005262 Bacteria 1527
38 Ga0070658_10000479 3300005327 Bacteria 34657
39 Ga0070658_10102032 3300005327 Bacteria 2372
40 Ga0070676_10000230 3300005328 Bacteria 23872
41 Ga0070676_10044427 3300005328 Bacteria 2585
42 Ga0070683_100387006 3300005329 Bacteria 1333
43 Ga0070670_100130729 3300005331 Bacteria 2168
44 Ga0068869_100000200 3300005334 Bacteria 31213
45 Ga0070666_10000234 3300005335 Bacteria 37494
46 Ga0068868_100001398 3300005338 Bacteria 16647
47 Ga0070660_100004174 3300005339 Bacteria 9975
48 Ga0070660_100004583 3300005339 Bacteria 9552
49 Ga0070660_100075067 3300005339 Bacteria 2646
50 Ga0070660_100192891 3300005339 Bacteria 1651
51 Ga0070668_100000047 3300005347 Bacteria 76386
52 Ga0070668_100005498 3300005347 Bacteria 9394
53 Ga0070668_100038200 3300005347 Bacteria 3669
54 Ga0070668_100199554 3300005347 Bacteria 1642
55 Ga0070669_100000008 3300005353 Bacteria 226764
56 Ga0070669_100000437 3300005353 Bacteria 31806
57 Ga0070669_100119035 3300005353 Bacteria 2012
58 Ga0070675_100006627 3300005354 Bacteria 8902
59 Ga0070671_100000010 3300005355 Bacteria 202799
60 Ga0070671_100000169 3300005355 Bacteria 43010
61 Ga0070671_100017053 3300005355 Bacteria 5875
62 Ga0070674_100051002 3300005356 Bacteria 2849
63 Ga0070673_100000006 3300005364 Bacteria 184299
64 Ga0070667_100000030 3300005367 Bacteria 178327
65 Ga0070663_100004887 3300005455 Bacteria 7911
66 Ga0070662_100007108 3300005457 Bacteria 7246
67 Ga0068867_100000001 3300005459 Bacteria 427563
68 Ga0068853_100161610 3300005539 Bacteria 2022
69 Ga0070686_100000352 3300005544 Bacteria 29658
70 Ga0070686_100085533 3300005544 Bacteria 2098
71 Ga0068855_100010482 3300005563 Bacteria 11182
72 Ga0068855_100105901 3300005563 Bacteria 3233
73 Ga0068855_100244870 3300005563 Bacteria 2002
74 Ga0068855_100244978 3300005563 Bacteria 2001
75 Ga0068857_100233163 3300005577 Bacteria 1684
76 Ga0068856_100240799 3300005614 Bacteria 1824
77 Ga0068852_100003329 3300005616 Bacteria 11220
78 Ga0068852_100185302 3300005616 Bacteria 1960
79 Ga0068852_100419042 3300005616 Bacteria 1320
80 Ga0068859_100002317 3300005617 Bacteria 19344
81 Ga0068859_100005156 3300005617 Bacteria 13269
82 Ga0068859_100103882 3300005617 Bacteria 2900
83 Ga0068859_100260377 3300005617 Bacteria 1826
84 Ga0068864_100023017 3300005618 Bacteria 5229
85 Ga0068861_100000001 3300005719 Bacteria 116118
86 Ga0068851_10007559 3300005834 Bacteria 4994
87 Ga0068851_10142290 3300005834 Bacteria 1305
88 Ga0068863_100000001 3300005841 Bacteria 581116
89 Ga0068863_100000093 3300005841 Bacteria 96862
90 Ga0068863_100000582 3300005841 Bacteria 37202
91 Ga0068863_100065620 3300005841 Bacteria 3434
92 Ga0068858_100006839 3300005842 Bacteria 11087
93 Ga0068858_100010200 3300005842 Bacteria 8915
94 Ga0068858_100036302 3300005842 Bacteria 4570
95 Ga0068860_100002229 3300005843 Bacteria 20406
96 Ga0068860_100003988 3300005843 Bacteria 15146
97 Ga0068860_100017800 3300005843 Bacteria 6923
98 Ga0068860_100629906 3300005843 Bacteria 1079
99 Ga0068862_100001451 3300005844 Bacteria 21840
100 Ga0068862_100011082 3300005844 Bacteria 7448
101 Ga0068862_100091483 3300005844 Bacteria 2650
102 Ga0075363_100182305 3300006048 Bacteria 1195
103 Ga0075367_10000607 3300006178 Bacteria 13767
104 Ga0075370_10036426 3300006353 Bacteria 2764
105 Ga0075370_10040892 3300006353 Bacteria 2616
106 Ga0075430_100229937 3300006846 Bacteria 1538
107 Ga0075434_100198543 3300006871 Bacteria 2026
108 Ga0068865_100000003 3300006881 Bacteria 231761
109 Ga0097620_100002317 3300006931 Bacteria 19344
110 Ga0097620_100005156 3300006931 Bacteria 13269
111 Ga0097620_100103880 3300006931 Bacteria 2900
112 Ga0097620_100260385 3300006931 Bacteria 1826
113 Ga0079104_1007109 3300006946 Bacteria 4114
114 Ga0105240_10091793 3300009093 Bacteria 3709
115 Ga0105245_10000113 3300009098 Bacteria 78545
116 Ga0105247_10000673 3300009101 Bacteria 26928
117 Ga0105247_10012233 3300009101 Bacteria 5157
118 Ga0105243_10000373 3300009148 Bacteria 48115
119 Ga0105243_10060689 3300009148 Bacteria 3021
120 Ga0105242_10010122 3300009176 Bacteria 7223
121 Ga0105248_10001758 3300009177 Bacteria 24108
122 Ga0105248_10004862 3300009177 Bacteria 14873
123 Ga0105248_10014065 3300009177 Bacteria 8807
124 Ga0105237_10005899 3300009545 Bacteria 13731
125 Ga0105238_10574796 3300009551 Bacteria 1133
126 Ga0105249_10000045 3300009553 Bacteria 182927
127 Ga0105249_10037210 3300009553 Bacteria 4416
128 Ga0105249_10084345 3300009553 Bacteria 2959
129 Ga0105239_10012172 3300010375 Bacteria 9592
130 Ga0105239_10129322 3300010375 Bacteria 2808
131 Ga0105246_10001620 3300011119 Bacteria 13399
132 Ga0157373_10004770 3300013100 Bacteria 10203
133 Ga0157373_10074190 3300013100 Bacteria 2400
134 Ga0157371_10208590 3300013102 Bacteria 1402
135 Ga0157371_10361403 3300013102 Bacteria 1058
136 Ga0157370_10000069 3300013104 Bacteria 112889
137 Ga0157370_10018262 3300013104 Bacteria 7054
138 Ga0157369_10173906 3300013105 Bacteria 2268
139 Ga0157369_10345800 3300013105 Bacteria 1545
140 Ga0157374_10057699 3300013296 Bacteria 3626
141 Ga0157378_10002300 3300013297 Bacteria 16976
142 Ga0163162_10012502 3300013306 Bacteria 8294
143 Ga0163162_10054234 3300013306 Bacteria 4032
144 Ga0157372_10059842 3300013307 Bacteria 4262
145 Ga0157372_10113522 3300013307 Bacteria 3105
146 Ga0157372_10118609 3300013307 Bacteria 3036
147 Ga0157372_10141635 3300013307 Bacteria 2771
148 Ga0157380_10008488 3300014326 Bacteria 7338
149 Ga0157376_10000089 3300014969 Bacteria 69351
150 Ga0163161_10019426 3300017792 Bacteria 4767
151 Ga0207425_1000041 3300025245 Bacteria 210441
152 Ga0209148_1000238 3300025254 Bacteria 87836
153 Ga0209129_1002094 3300025258 Bacteria 10228
154 Ga0209565_1000008 3300025263 Bacteria 774179
155 Ga0209565_1000134 3300025263 Bacteria 104013
156 Ga0209455_1000952 3300025272 Bacteria 14767
157 Ga0209673_1002352 3300025273 Bacteria 13340
158 Ga0209675_1015089 3300025291 Bacteria 2314
159 Ga0209676_1016916 3300025292 Bacteria 2606
160 Ga0209025_1000068 3300025294 Bacteria 294129
161 Ga0209564_1012455 3300025295 Bacteria 3708
162 Ga0209758_1000004 3300025297 Bacteria 1375322
163 Ga0209758_1005937 3300025297 Bacteria 9061
164 Ga0209050_1000001 3300025298 Bacteria 3563507
165 Ga0209050_1000581 3300025298 Bacteria 59224
166 Ga0209050_1005993 3300025298 Bacteria 7374
167 Ga0209050_1014296 3300025298 Bacteria 3432
168 Ga0209256_1000009 3300025299 Bacteria 922071
169 Ga0209256_1000010 3300025299 Bacteria 912110
170 Ga0209051_1000191 3300025303 Bacteria 108763
171 Ga0209257_1000876 3300025304 Bacteria 42634
172 Ga0209257_1002898 3300025304 Bacteria 15899
173 Ga0209257_1003401 3300025304 Bacteria 13704
174 Ga0209257_1003674 3300025304 Bacteria 12823
175 Ga0209257_1014986 3300025304 Bacteria 3271
176 Ga0207697_10000036 3300025315 Bacteria 49927
177 Ga0207656_10076003 3300025321 Bacteria 1501
178 Ga0207710_10024250 3300025900 Bacteria 2610
179 Ga0207680_10000097 3300025903 Bacteria 40203
180 Ga0207680_10037307 3300025903 Bacteria 2805
181 Ga0207647_10001988 3300025904 Bacteria 15633
182 Ga0207647_10002647 3300025904 Bacteria 13526
183 Ga0207647_10007503 3300025904 Bacteria 7877
184 Ga0207647_10032481 3300025904 Bacteria 3352
185 Ga0207645_10003616 3300025907 Bacteria 11690
186 Ga0207645_10082030 3300025907 Bacteria 2067
187 Ga0207705_10000121 3300025909 Bacteria 86649
188 Ga0207705_10000365 3300025909 Bacteria 41098
189 Ga0207705_10053618 3300025909 Bacteria 2905
190 Ga0207695_10077775 3300025913 Bacteria 3368
191 Ga0207657_10015487 3300025919 Bacteria 7387
192 Ga0207657_10026870 3300025919 Bacteria 5279
193 Ga0207657_10027486 3300025919 Bacteria 5210
194 Ga0207657_10180243 3300025919 Bacteria 1708
195 Ga0207681_10000002 3300025923 Bacteria 985597
196 Ga0207681_10000463 3300025923 Bacteria 28492
197 Ga0207681_10027175 3300025923 Bacteria 3698
198 Ga0207650_10104123 3300025925 Bacteria 2189
199 Ga0207687_10000225 3300025927 Bacteria 38523
200 Ga0207644_10000002 3300025931 Bacteria 942221
201 Ga0207644_10000012 3300025931 Bacteria 186652
202 Ga0207644_10069262 3300025931 Bacteria 2576
203 Ga0207644_10136303 3300025931 Bacteria 1885
204 Ga0207644_10380165 3300025931 Bacteria 1151
205 Ga0207690_10368792 3300025932 Bacteria 1139
206 Ga0207706_10008805 3300025933 Bacteria 9291
207 Ga0207706_10026490 3300025933 Bacteria 5189
208 Ga0207706_10033279 3300025933 Bacteria 4590
209 Ga0207706_10211000 3300025933 Bacteria 1702
210 Ga0207686_10005107 3300025934 Bacteria 7060
211 Ga0207709_10000173 3300025935 Bacteria 86350
212 Ga0207704_10000001 3300025938 Bacteria 716296
213 Ga0207691_10009162 3300025940 Bacteria 9499
214 Ga0207711_10000852 3300025941 Bacteria 29486
215 Ga0207711_10113796 3300025941 Bacteria 2409
216 Ga0207689_10000744 3300025942 Bacteria 31242
217 Ga0207667_10000016 3300025949 Bacteria 391466
218 Ga0207667_10167891 3300025949 Bacteria 2256
219 Ga0207667_10276112 3300025949 Bacteria 1718
220 Ga0207651_10000002 3300025960 Bacteria 427663
221 Ga0207712_10000174 3300025961 Bacteria 66500
222 Ga0207668_10000066 3300025972 Bacteria 84452
223 Ga0207668_10000304 3300025972 Bacteria 32235
224 Ga0207668_10001421 3300025972 Bacteria 14084
225 Ga0207668_10003796 3300025972 Bacteria 8901
226 Ga0207640_10021246 3300025981 Bacteria 3866
227 Ga0207658_10000019 3300025986 Bacteria 206335
228 Ga0207658_10003580 3300025986 Bacteria 10968
229 Ga0207677_10000030 3300026023 Bacteria 120692
230 Ga0207703_10001492 3300026035 Bacteria 21341
231 Ga0207703_10006199 3300026035 Bacteria 9569
232 Ga0207703_10042647 3300026035 Bacteria 3640
233 Ga0207639_10008795 3300026041 Bacteria 6939
234 Ga0207639_10023944 3300026041 Bacteria 4413
235 Ga0207639_10122498 3300026041 Bacteria 2139
236 Ga0207678_10000857 3300026067 Bacteria 27922
237 Ga0207702_10002945 3300026078 Bacteria 15895
238 Ga0207641_10000001 3300026088 Bacteria 1180841
239 Ga0207641_10000029 3300026088 Bacteria 229383
240 Ga0207641_10002512 3300026088 Bacteria 16895
241 Ga0207641_10091771 3300026088 Bacteria 2658
242 Ga0207641_10151692 3300026088 Bacteria 2099
243 Ga0207648_10000001 3300026089 Bacteria 427499
244 Ga0207648_10375614 3300026089 Bacteria 1285
245 Ga0207676_10015768 3300026095 Bacteria 5462
246 Ga0207674_10009584 3300026116 Bacteria 11048
247 Ga0207674_10024053 3300026116 Bacteria 6515
248 Ga0207674_10088087 3300026116 Bacteria 3098
249 Ga0207675_100000196 3300026118 Bacteria 55631
250 Ga0207675_100000358 3300026118 Bacteria 43765
251 Ga0207675_100121773 3300026118 Bacteria 2469
252 Ga0207698_10000130 3300026142 Bacteria 47043
253 Ga0209281_1015295 3300027111 Bacteria 1603
254 Ga0209813_10000075 3300027866 Bacteria 36981
255 Ga0268265_10000045 3300028380 Bacteria 180378
256 Ga0268265_10000339 3300028380 Bacteria 50894
257 Ga0268265_10316515 3300028380 Bacteria 1411
258 Ga0268264_10000010 3300028381 Bacteria 596543
259 Ga0268264_10004259 3300028381 Bacteria 12215
260 Ga0268264_10012577 3300028381 Bacteria 6971
261 Ga0268264_10025057 3300028381 Bacteria 4875
262 Ga0307513_10028045 3300031456 Bacteria 6449
263 Ga0307408_100090798 3300031548 Bacteria 2305
264 Ga0307408_100165945 3300031548 Bacteria 1758
265 Ga0307408_100306305 3300031548 Bacteria 1333
266 Ga0307405_10012300 3300031731 Bacteria 4522
267 Ga0307413_10174840 3300031824 Bacteria 1524
268 Ga0307410_10118754 3300031852 Bacteria 1925
269 Ga0307410_10206636 3300031852 Bacteria 1502
270 Ga0307406_10227908 3300031901 Bacteria 1389
271 Ga0307414_10091196 3300032004 Bacteria 2264
272 Ga0307414_10210331 3300032004 Bacteria 1589
273 Ga0307411_10132294 3300032005 Bacteria 1825
274 Ga0307411_10159569 3300032005 Bacteria 1687
275 Ga0395899_0001521 3300037312 Bacteria 19608
276 Ga0395900_0009291 3300037418 Bacteria 10081
277 Ga0395905_0018211 3300037471 Bacteria 6667
278 Ga0395905_0068601 3300037471 Bacteria 3321
279 Ga0395901_0073008 3300038443 Bacteria 3578
280 Ga0395901_0102947 3300038443 Bacteria 2996
281 Ga0439436_0020394 3300041404 Bacteria 1974
282 Ga0439461_0000498 3300041410 Bacteria 5666
283 Ga0439466_0018888 3300041411 Bacteria 2469
284 Ga0439465_0005658 3300041413 Bacteria 3978
285 Ga0451806_402659 3300041462 Bacteria 6155
286 Ga0451807_0382179 3300041486 Bacteria 6263
287 Ga0451853_2806299 3300041512 Bacteria 3032
288 Ga0439431_0000140 3300041997 Bacteria 13006
289 Ga0439431_0006887 3300041997 Bacteria 2525
290 Ga0439445_0004325 3300042004 Bacteria 3214
291 Ga0439448_0001939 3300042005 Bacteria 5514
292 Ga0439448_0009693 3300042005 Bacteria 2843
293 Ga0439448_0012547 3300042005 Bacteria 2537
294 Ga0439432_000640 3300042006 Bacteria 13098
295 Ga0439450_022012 3300042008 Bacteria 1373
296 Ga0439455_0014742 3300042012 Bacteria 1788
297 Ga0439455_0030935 3300042012 Bacteria 1330
298 Ga0439462_0014100 3300042015 Bacteria 2051
299 Ga0439462_0015361 3300042015 Bacteria 1973
300 Ga0439446_0018750 3300042156 Bacteria 1942
301 Ga0439458_0000137 3300042157 Bacteria 15585
302 Ga0439458_0002735 3300042157 Bacteria 4248
303 Ga0439458_0003196 3300042157 Bacteria 3881
304 Ga0439434_0001016 3300042435 Bacteria 8109
305 Ga0439434_0041366 3300042435 Bacteria 1416
306 Ga0466972_0000826 3300044658 Bacteria 14820
307 Ga0466966_0115314 3300044684 Bacteria 1654
308 Ga0466961_0036040 3300044693 Bacteria 3176
309 Ga0466961_0101880 3300044693 Bacteria 1808
310 Ga0466963_0005815 3300044694 Bacteria 7256
311 Ga0466964_0000258 3300044706 Bacteria 15333
312 Ga0466971_0005805 3300044719 Bacteria 5372
313 Ga0466970_0010990 3300044765 Bacteria 4606
314 Ga0466960_0004100 3300044901 Bacteria 5665
315 Ga0451576_0000393 3300045051 Bacteria 101814
316 Ga0451576_0259850 3300045051 Bacteria 1815
317 Ga0466958_0017628 3300045836 Bacteria 4132
318 Ga0466958_0042889 3300045836 Bacteria 2724
319 Ga0495627_000024 3300046453 Bacteria 250480
320 Ga0495627_003970 3300046453 Bacteria 6315
321 Ga0495650_0001027 3300046471 Bacteria 31380
322 Ga0495583_0000218 3300046506 Bacteria 96349
323 Ga0495606_0000710 3300046507 Bacteria 51532
324 Ga0495610_0000053 3300046512 Bacteria 142545
325 Ga0495616_0001456 3300046513 Bacteria 16481
326 Ga0495637_0003303 3300046520 Bacteria 8576
327 Ga0495637_0008486 3300046520 Bacteria 5045
328 Ga0495643_0000030 3300046522 Bacteria 260229
329 Ga0495648_0001960 3300046524 Bacteria 19584
330 Ga0495648_0006668 3300046524 Bacteria 9351
331 Ga0495654_0032421 3300046530 Bacteria 2649
332 Ga0495633_0002794 3300046558 Bacteria 12067
333 Ga0495668_0002221 3300046616 Bacteria 16492
334 Ga0495668_0048576 3300046616 Bacteria 2354
335 Ga0495611_0082245 3300046648 Bacteria 1482
336 Ga0495625_0035851 3300046660 Bacteria 3652
337 Ga0495670_0000002 3300046691 Bacteria 601814
338 Ga0495670_0010027 3300046691 Bacteria 4659
339 Ga0495671_0000072 3300046692 Bacteria 97315
340 Ga0495671_0045784 3300046692 Bacteria 2189
341 Ga0495649_0112123 3300046694 Bacteria 1446
342 Ga0495649_0237353 3300046694 Bacteria 939
343 Ga0495683_0131132 3300047323 Bacteria 1182
344 Ga0495681_0000099 3300047470 Bacteria 75808
345 Ga0495681_0000858 3300047470 Bacteria 23365
346 Ga0495686_0008783 3300047472 Bacteria 7363
347 Ga0496100_0400741 3300048903 Bacteria 1045
348 Ga0496103_0131073 3300048906 Bacteria 1601
349 Ga0496104_0018392 3300048907 Bacteria 6376
350 Ga0496105_0276148 3300048908 Bacteria 1356
351 Ga0496106_0001994 3300048909 Bacteria 15358
352 Ga0496107_0006186 3300048910 Bacteria 8223
353 Ga0496108_0060537 3300048911 Bacteria 3186
354 Ga0496109_0315756 3300048912 Bacteria 1474
355 Ga0496110_0028842 3300048913 Bacteria 4770
356 Ga0496111_0344978 3300048914 Bacteria 1102
357 Ga0496112_0356615 3300048915 Bacteria 1405
358 Ga0496113_0000998 3300048916 Bacteria 15153
359 Ga0496115_0001129 3300048918 Bacteria 19266
360 Ga0496116_0037014 3300048919 Bacteria 3408
361 Ga0496117_0033071 3300048920 Bacteria 3916
362 Ga0496117_0040966 3300048920 Bacteria 3400
363 Ga0496118_0075722 3300048921 Bacteria 2398
364 Ga0496119_0112234 3300048922 Bacteria 1511
365 Ga0496121_0000087 3300048924 Bacteria 222451
366 Ga0496121_0015601 3300048924 Bacteria 7936
367 Ga0496122_0000603 3300048925 Bacteria 73878
368 Ga0496122_0009099 3300048925 Bacteria 10531
369 Ga0496123_0000155 3300048926 Bacteria 139646
370 Ga0496123_0011287 3300048926 Bacteria 7763
371 Ga0496123_0062259 3300048926 Bacteria 2392
372 Ga0496124_0043851 3300048927 Bacteria 3841
373 Ga0496125_0015219 3300048928 Bacteria 7449
374 Ga0496125_0033431 3300048928 Bacteria 4551
375 Ga0496125_0126610 3300048928 Bacteria 1809
376 Ga0496126_0028348 3300048929 Bacteria 5338
377 Ga0496126_0126594 3300048929 Bacteria 2211
378 Ga0501298_033098 3300049521 Bacteria 1023
379 Ga0501300_004776 3300049523 Bacteria 2003
380 Ga0501034_0198046 3300049571 Bacteria 1968
381 Ga0501223_000039 3300049663 Bacteria 45537
382 Ga0501257_000039 3300049686 Bacteria 37011
383 Ga0501225_0000010 3300049705 Bacteria 82395
384 Ga0501225_0004272 3300049705 Bacteria 4269
385 nmdc:mga06z11_17_c1 3300050494 Bacteria 79602
386 nmdc:mga04h51_23_c1 3300050495 Bacteria 63511
387 nmdc:mga07m45_60295_c1 3300050496 Bacteria 2147
388 nmdc:mga0qj67_23949_c2 3300050509 Bacteria 4112
389 nmdc:mga0n895_148538_c1 3300050512 Bacteria 2373
390 Ga0500643_000268 3300053087 Bacteria 45965
391 Ga0500643_002015 3300053087 Bacteria 10931
392 Ga0500643_002195 3300053087 Bacteria 10317
393 Ga0500643_002236 3300053087 Bacteria 10213
394 Ga0500643_016815 3300053087 Bacteria 2467
395 Ga0500566_0004538 3300053094 Bacteria 8291
396 Ga0500641_0007461 3300053096 Bacteria 3901
397 Ga0500555_000575 3300053103 Bacteria 14512
398 Ga0500556_0000197 3300053104 Bacteria 49633
399 Ga0500592_000182 3300053116 Bacteria 12130
400 Ga0500595_000572 3300053119 Bacteria 21961
401 Ga0500642_0000011 3300053130 Bacteria 215963
402 Ga0500658_0009412 3300053134 Bacteria 3604
403 Ga0500658_0024665 3300053134 Bacteria 2305
404 Ga0500573_0000114 3300053140 Bacteria 32888
405 Ga0500573_0076881 3300053140 Bacteria 1900
406 Ga0500577_0068226 3300053142 Bacteria 1388
407 Ga0500604_0000025 3300053151 Bacteria 68203
408 Ga0500604_0001841 3300053151 Bacteria 5890
409 Ga0500604_0046596 3300053151 Bacteria 1327
410 Ga0500616_0000254 3300053153 Bacteria 82664
411 Ga0500616_0008241 3300053153 Bacteria 6496
412 Ga0500624_000002 3300053157 Bacteria 257900
413 Ga0500627_0000208 3300053158 Bacteria 16936
414 Ga0500627_0000332 3300053158 Bacteria 12851
415 Ga0500627_0124036 3300053158 Bacteria 1166
416 Ga0500645_001488 3300053730 Bacteria 11755
417 Ga0466962_0005694 3300061719 Bacteria 5986

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006353 Ga0075370_10040892 Ga0075370_100408925 268
2 3300005617 Ga0068859_100103882 Ga0068859_1001038822 273
3 3300006931 Ga0097620_100103880 Ga0097620_1001038802 273
4 3300042157 Ga0439458_0000137 Ga0439458_0000137_2989_3813 273
5 3300031824 Ga0307413_10174840 Ga0307413_101748402 274
6 3300053730 Ga0500645_001488 Ga0500645_001488_6486_7343 274
7 3300032005 Ga0307411_10132294 Ga0307411_101322941 275
8 3300053096 Ga0500641_0007461 Ga0500641_0007461_2263_3120 275
9 3300053153 Ga0500616_0008241 Ga0500616_0008241_1019_1876 276
10 3300005616 Ga0068852_100419042 Ga0068852_1004190421 277
11 3300048921 Ga0496118_0075722 Ga0496118_0075722_11_844 277
12 3300045051 Ga0451576_0259850 Ga0451576_0259850_467_1348 278
13 3300046507 Ga0495606_0000710 Ga0495606_0000710_48165_49004 278
14 3300005327 Ga0070658_10000479 Ga0070658_1000047915 279
15 3300005339 Ga0070660_100004174 Ga0070660_1000041744 279
16 3300025909 Ga0207705_10000365 Ga0207705_1000036533 279
17 3300025919 Ga0207657_10015487 Ga0207657_100154875 279
18 3300037418 Ga0395900_0009291 Ga0395900_0009291_7332_8174 279
19 3300048920 Ga0496117_0033071 Ga0496117_0033071_827_1687 279
20 3300048924 Ga0496121_0015601 Ga0496121_0015601_2498_3358 279
21 3300048926 Ga0496123_0062259 Ga0496123_0062259_1154_2014 279
22 iso_pu_bacteria 2599185354 2600202841 279
23 3300001990 JGI24737J22298_10012312 JGI24737J22298_100123125 280
24 3300001990 JGI24737J22298_10033410 JGI24737J22298_100334102 280
25 3300002067 JGI24735J21928_10000590 JGI24735J21928_1000059012 280
26 3300002067 JGI24735J21928_10001504 JGI24735J21928_100015045 280
27 3300002067 JGI24735J21928_10004614 JGI24735J21928_100046143 280
28 3300002067 JGI24735J21928_10018807 JGI24735J21928_100188072 280
29 3300002067 JGI24735J21928_10018837 JGI24735J21928_100188372 280
30 3300002075 JGI24738J21930_10000184 JGI24738J21930_100001842 280
31 3300002077 JGI24744J21845_10008674 JGI24744J21845_100086741 280
32 3300003316 rootH1_10055751 rootH1_100557511 280
33 3300003316 rootH1_10100018 rootH1_101000181 280
34 3300003320 rootH2_10001791 rootH2_100017913 280
35 3300003322 rootL2_10247348 rootL2_102473482 280
36 3300003323 rootH1_10035136 rootH1_100351362 280
37 3300005327 Ga0070658_10102032 Ga0070658_101020321 280
38 3300005328 Ga0070676_10000230 Ga0070676_100002309 280
39 3300005334 Ga0068869_100000200 Ga0068869_10000020031 280
40 3300005338 Ga0068868_100001398 Ga0068868_10000139813 280
41 3300005339 Ga0070660_100004583 Ga0070660_10000458310 280
42 3300005339 Ga0070660_100075067 Ga0070660_1000750674 280
43 3300005339 Ga0070660_100192891 Ga0070660_1001928912 280
44 3300005354 Ga0070675_100006627 Ga0070675_1000066273 280
45 3300005355 Ga0070671_100017053 Ga0070671_1000170535 280
46 3300005356 Ga0070674_100051002 Ga0070674_1000510021 280
47 3300005364 Ga0070673_100000006 Ga0070673_100000006119 280
48 3300005457 Ga0070662_100007108 Ga0070662_1000071082 280
49 3300005459 Ga0068867_100000001 Ga0068867_100000001364 280
50 3300005539 Ga0068853_100161610 Ga0068853_1001616104 280
51 3300005563 Ga0068855_100244870 Ga0068855_1002448703 280
52 3300005577 Ga0068857_100233163 Ga0068857_1002331632 280
53 3300005614 Ga0068856_100240799 Ga0068856_1002407993 280
54 3300005616 Ga0068852_100003329 Ga0068852_10000332910 280
55 3300006881 Ga0068865_100000003 Ga0068865_100000003195 280
56 3300009093 Ga0105240_10091793 Ga0105240_100917933 280
57 3300009098 Ga0105245_10000113 Ga0105245_1000011347 280
58 3300009148 Ga0105243_10000373 Ga0105243_1000037340 280
59 3300009176 Ga0105242_10010122 Ga0105242_100101222 280
60 3300009553 Ga0105249_10084345 Ga0105249_100843453 280
61 3300010375 Ga0105239_10012172 Ga0105239_100121727 280
62 3300011119 Ga0105246_10001620 Ga0105246_1000162010 280
63 3300013100 Ga0157373_10074190 Ga0157373_100741903 280
64 3300013102 Ga0157371_10208590 Ga0157371_102085902 280
65 3300013102 Ga0157371_10361403 Ga0157371_103614031 280
66 3300013104 Ga0157370_10000069 Ga0157370_1000006955 280
67 3300013105 Ga0157369_10173906 Ga0157369_101739062 280
68 3300013296 Ga0157374_10057699 Ga0157374_100576992 280
69 3300013297 Ga0157378_10002300 Ga0157378_1000230010 280
70 3300013307 Ga0157372_10059842 Ga0157372_100598424 280
71 3300013307 Ga0157372_10113522 Ga0157372_101135226 280
72 3300013307 Ga0157372_10118609 Ga0157372_101186092 280
73 3300013307 Ga0157372_10141635 Ga0157372_101416352 280
74 3300014969 Ga0157376_10000089 Ga0157376_1000008948 280
75 3300017792 Ga0163161_10019426 Ga0163161_100194262 280
76 3300025254 Ga0209148_1000238 Ga0209148_100023849 280
77 3300025272 Ga0209455_1000952 Ga0209455_10009524 280
78 3300025904 Ga0207647_10002647 Ga0207647_1000264716 280
79 3300025904 Ga0207647_10007503 Ga0207647_100075037 280
80 3300025904 Ga0207647_10032481 Ga0207647_100324811 280
81 3300025907 Ga0207645_10003616 Ga0207645_1000361610 280
82 3300025913 Ga0207695_10077775 Ga0207695_100777755 280
83 3300025919 Ga0207657_10026870 Ga0207657_100268705 280
84 3300025919 Ga0207657_10027486 Ga0207657_100274864 280
85 3300025919 Ga0207657_10180243 Ga0207657_101802432 280
86 3300025927 Ga0207687_10000225 Ga0207687_1000022518 280
87 3300025931 Ga0207644_10380165 Ga0207644_103801652 280
88 3300025932 Ga0207690_10368792 Ga0207690_103687922 280
89 3300025933 Ga0207706_10008805 Ga0207706_100088052 280
90 3300025933 Ga0207706_10026490 Ga0207706_100264907 280
91 3300025933 Ga0207706_10033279 Ga0207706_100332796 280
92 3300025933 Ga0207706_10211000 Ga0207706_102110003 280
93 3300025934 Ga0207686_10005107 Ga0207686_100051079 280
94 3300025935 Ga0207709_10000173 Ga0207709_1000017344 280
95 3300025938 Ga0207704_10000001 Ga0207704_10000001324 280
96 3300025940 Ga0207691_10009162 Ga0207691_1000916213 280
97 3300025942 Ga0207689_10000744 Ga0207689_1000074431 280
98 3300025949 Ga0207667_10000016 Ga0207667_1000001621 280
99 3300025960 Ga0207651_10000002 Ga0207651_1000000285 280
100 3300026023 Ga0207677_10000030 Ga0207677_1000003052 280
101 3300026041 Ga0207639_10122498 Ga0207639_101224985 280
102 3300026078 Ga0207702_10002945 Ga0207702_1000294524 280
103 3300026089 Ga0207648_10000001 Ga0207648_1000000185 280
104 3300026116 Ga0207674_10088087 Ga0207674_100880876 280
105 3300026142 Ga0207698_10000130 Ga0207698_1000013029 280
106 3300037312 Ga0395899_0001521 Ga0395899_0001521_15627_16472 280
107 3300037471 Ga0395905_0068601 Ga0395905_0068601_2311_3156 280
108 3300038443 Ga0395901_0073008 Ga0395901_0073008_504_1349 280
109 3300041462 Ga0451806_402659 Ga0451806_402659_2435_3280 280
110 3300041486 Ga0451807_0382179 Ga0451807_0382179_2332_3177 280
111 3300041512 Ga0451853_2806299 Ga0451853_2806299_2102_2947 280
112 3300042005 Ga0439448_0001939 Ga0439448_0001939_869_1714 280
113 3300042005 Ga0439448_0009693 Ga0439448_0009693_806_1651 280
114 3300042005 Ga0439448_0012547 Ga0439448_0012547_499_1344 280
115 3300042008 Ga0439450_022012 Ga0439450_022012_66_911 280
116 3300042012 Ga0439455_0014742 Ga0439455_0014742_313_1158 280
117 3300042012 Ga0439455_0030935 Ga0439455_0030935_313_1158 280
118 3300042157 Ga0439458_0002735 Ga0439458_0002735_537_1382 280
119 3300042157 Ga0439458_0003196 Ga0439458_0003196_170_1015 280
120 3300044658 Ga0466972_0000826 Ga0466972_0000826_4019_4864 280
121 3300044684 Ga0466966_0115314 Ga0466966_0115314_142_987 280
122 3300044693 Ga0466961_0036040 Ga0466961_0036040_523_1368 280
123 3300044693 Ga0466961_0101880 Ga0466961_0101880_680_1525 280
124 3300044694 Ga0466963_0005815 Ga0466963_0005815_4055_4900 280
125 3300044706 Ga0466964_0000258 Ga0466964_0000258_2659_3504 280
126 3300044719 Ga0466971_0005805 Ga0466971_0005805_1126_1971 280
127 3300044765 Ga0466970_0010990 Ga0466970_0010990_535_1380 280
128 3300044901 Ga0466960_0004100 Ga0466960_0004100_1754_2599 280
129 3300045836 Ga0466958_0017628 Ga0466958_0017628_477_1322 280
130 3300045836 Ga0466958_0042889 Ga0466958_0042889_203_1048 280
131 3300046506 Ga0495583_0000218 Ga0495583_0000218_87891_88736 280
132 3300046648 Ga0495611_0082245 Ga0495611_0082245_179_1024 280
133 3300046691 Ga0495670_0010027 Ga0495670_0010027_2120_2965 280
134 3300046694 Ga0495649_0237353 Ga0495649_0237353_55_900 280
135 3300047323 Ga0495683_0131132 Ga0495683_0131132_77_922 280
136 3300048922 Ga0496119_0112234 Ga0496119_0112234_300_1145 280
137 3300048928 Ga0496125_0033431 Ga0496125_0033431_280_1125 280
138 3300050496 nmdc:mga07m45_60295_c1 nmdc:mga07m45_60295_c1_250_1095 280
139 3300053103 Ga0500555_000575 Ga0500555_000575_7610_8455 280
140 3300053142 Ga0500577_0068226 Ga0500577_0068226_302_1147 280
141 3300061719 Ga0466962_0005694 Ga0466962_0005694_2156_3001 280
142 iso_pu_bacteria 2643221622 2644126042 280
143 iso_pu_bacteria 8057101203 8057101260 280
144 3300025909 Ga0207705_10000121 Ga0207705_1000012120 281
145 3300046453 Ga0495627_003970 Ga0495627_003970_1011_1889 282
146 3300046512 Ga0495610_0000053 Ga0495610_0000053_140908_141786 282
147 3300047470 Ga0495681_0000099 Ga0495681_0000099_24598_25476 282
148 3300047472 Ga0495686_0008783 Ga0495686_0008783_902_1780 282
149 3300048925 Ga0496122_0009099 Ga0496122_0009099_6815_7678 282
150 3300048926 Ga0496123_0011287 Ga0496123_0011287_3433_4296 282
151 3300048927 Ga0496124_0043851 Ga0496124_0043851_764_1627 282
152 3300002774 JGI25150J39212_1002047 JGI25150J39212_10020472 283
153 3300003215 JGI25153J46596_10000395 JGI25153J46596_1000039512 283
154 3300003316 rootH1_10122197 rootH1_101221972 283
155 3300005328 Ga0070676_10044427 Ga0070676_100444272 283
156 3300005617 Ga0068859_100005156 Ga0068859_1000051563 283
157 3300005719 Ga0068861_100000001 Ga0068861_10000000157 283
158 3300005844 Ga0068862_100091483 Ga0068862_1000914832 283
159 3300006931 Ga0097620_100005156 Ga0097620_1000051563 283
160 3300009148 Ga0105243_10060689 Ga0105243_100606892 283
161 3300009177 Ga0105248_10001758 Ga0105248_100017589 283
162 3300013100 Ga0157373_10004770 Ga0157373_1000477010 283
163 3300014326 Ga0157380_10008488 Ga0157380_100084882 283
164 3300025245 Ga0207425_1000041 Ga0207425_100004167 283
165 3300025258 Ga0209129_1002094 Ga0209129_10020946 283
166 3300025292 Ga0209676_1016916 Ga0209676_10169162 283
167 3300025294 Ga0209025_1000068 Ga0209025_1000068236 283
168 3300025297 Ga0209758_1000004 Ga0209758_1000004135 283
169 3300025298 Ga0209050_1000001 Ga0209050_10000012065 283
170 3300025303 Ga0209051_1000191 Ga0209051_10001914 283
171 3300025304 Ga0209257_1000876 Ga0209257_100087615 283
172 3300025907 Ga0207645_10082030 Ga0207645_100820302 283
173 3300025931 Ga0207644_10069262 Ga0207644_100692623 283
174 3300025941 Ga0207711_10000852 Ga0207711_100008529 283
175 3300026089 Ga0207648_10375614 Ga0207648_103756142 283
176 3300026118 Ga0207675_100000196 Ga0207675_10000019657 283
177 3300026118 Ga0207675_100121773 Ga0207675_1001217733 283
178 3300028380 Ga0268265_10316515 Ga0268265_103165152 283
179 3300031548 Ga0307408_100306305 Ga0307408_1003063052 283
180 3300032005 Ga0307411_10159569 Ga0307411_101595692 283
181 3300042435 Ga0439434_0041366 Ga0439434_0041366_494_1348 283
182 3300048913 Ga0496110_0028842 Ga0496110_0028842_1977_2840 283
183 3300049705 Ga0501225_0004272 Ga0501225_0004272_3076_3927 283
184 iso_pu_bacteria 2919138771 2919139228 283
185 3300003215 JGI25153J46596_10002504 JGI25153J46596_100025047 284
186 3300003773 Ga0055537_1002042 Ga0055537_10020428 284
187 3300003775 Ga0055524_1000056 Ga0055524_10000567 284
188 3300003791 Ga0055530_10000931 Ga0055530_1000093123 284
189 3300003791 Ga0055530_10020923 Ga0055530_100209232 284
190 3300005262 Ga0065165_1002739 Ga0065165_100273911 284
191 3300005262 Ga0065165_1003272 Ga0065165_100327214 284
192 3300005262 Ga0065165_1009273 Ga0065165_10092736 284
193 3300005347 Ga0070668_100005498 Ga0070668_1000054985 284
194 3300005563 Ga0068855_100244978 Ga0068855_1002449782 284
195 3300005616 Ga0068852_100185302 Ga0068852_1001853022 284
196 3300005841 Ga0068863_100000582 Ga0068863_10000058217 284
197 3300005843 Ga0068860_100002229 Ga0068860_10000222919 284
198 3300005844 Ga0068862_100001451 Ga0068862_1000014516 284
199 3300006846 Ga0075430_100229937 Ga0075430_1002299372 284
200 3300009101 Ga0105247_10012233 Ga0105247_100122336 284
201 3300009553 Ga0105249_10000045 Ga0105249_1000004517 284
202 3300025263 Ga0209565_1000008 Ga0209565_1000008629 284
203 3300025273 Ga0209673_1002352 Ga0209673_10023528 284
204 3300025291 Ga0209675_1015089 Ga0209675_10150892 284
205 3300025297 Ga0209758_1005937 Ga0209758_10059373 284
206 3300025298 Ga0209050_1005993 Ga0209050_10059932 284
207 3300025299 Ga0209256_1000009 Ga0209256_1000009240 284
208 3300025299 Ga0209256_1000010 Ga0209256_1000010164 284
209 3300025304 Ga0209257_1003401 Ga0209257_10034018 284
210 3300025304 Ga0209257_1014986 Ga0209257_10149863 284
211 3300025900 Ga0207710_10024250 Ga0207710_100242503 284
212 3300025949 Ga0207667_10276112 Ga0207667_102761122 284
213 3300025961 Ga0207712_10000174 Ga0207712_1000017417 284
214 3300025972 Ga0207668_10003796 Ga0207668_100037965 284
215 3300026088 Ga0207641_10002512 Ga0207641_100025123 284
216 3300028380 Ga0268265_10000045 Ga0268265_1000004516 284
217 3300028381 Ga0268264_10025057 Ga0268264_100250573 284
218 3300031456 Ga0307513_10028045 Ga0307513_100280459 284
219 3300037471 Ga0395905_0018211 Ga0395905_0018211_2974_3831 284
220 3300038443 Ga0395901_0102947 Ga0395901_0102947_1861_2718 284
221 3300041404 Ga0439436_0020394 Ga0439436_0020394_938_1795 284
222 3300041410 Ga0439461_0000498 Ga0439461_0000498_954_1811 284
223 3300041411 Ga0439466_0018888 Ga0439466_0018888_41_898 284
224 3300041413 Ga0439465_0005658 Ga0439465_0005658_857_1714 284
225 3300041997 Ga0439431_0000140 Ga0439431_0000140_8611_9468 284
226 3300041997 Ga0439431_0006887 Ga0439431_0006887_1010_1867 284
227 3300042004 Ga0439445_0004325 Ga0439445_0004325_2314_3171 284
228 3300042006 Ga0439432_000640 Ga0439432_000640_7499_8356 284
229 3300042015 Ga0439462_0014100 Ga0439462_0014100_1056_1913 284
230 3300042015 Ga0439462_0015361 Ga0439462_0015361_108_965 284
231 3300042156 Ga0439446_0018750 Ga0439446_0018750_1008_1865 284
232 3300042435 Ga0439434_0001016 Ga0439434_0001016_122_979 284
233 3300046691 Ga0495670_0000002 Ga0495670_0000002_91859_92716 284
234 3300049521 Ga0501298_033098 Ga0501298_033098_38_895 284
235 3300049523 Ga0501300_004776 Ga0501300_004776_171_1028 284
236 3300049571 Ga0501034_0198046 Ga0501034_0198046_36_893 284
237 3300049686 Ga0501257_000039 Ga0501257_000039_33706_34563 284
238 3300050509 nmdc:mga0qj67_23949_c2 nmdc:mga0qj67_23949_c2_1166_2023 284
239 3300050512 nmdc:mga0n895_148538_c1 nmdc:mga0n895_148538_c1_897_1754 284
240 3300053087 Ga0500643_000268 Ga0500643_000268_38039_38896 284
241 3300053087 Ga0500643_002236 Ga0500643_002236_7835_8692 284
242 3300053087 Ga0500643_016815 Ga0500643_016815_94_951 284
243 3300053094 Ga0500566_0004538 Ga0500566_0004538_3646_4503 284
244 3300053119 Ga0500595_000572 Ga0500595_000572_7689_8546 284
245 3300053134 Ga0500658_0009412 Ga0500658_0009412_709_1566 284
246 3300053134 Ga0500658_0024665 Ga0500658_0024665_1073_1930 284
247 3300053140 Ga0500573_0000114 Ga0500573_0000114_20011_20865 284
248 3300053140 Ga0500573_0076881 Ga0500573_0076881_897_1751 284
249 3300005329 Ga0070683_100387006 Ga0070683_1003870062 285
250 3300005355 Ga0070671_100000169 Ga0070671_10000016925 285
251 3300005841 Ga0068863_100000001 Ga0068863_100000001355 285
252 3300005843 Ga0068860_100629906 Ga0068860_1006299061 285
253 3300025304 Ga0209257_1003674 Ga0209257_10036745 285
254 3300025931 Ga0207644_10000012 Ga0207644_1000001263 285
255 3300025972 Ga0207668_10000304 Ga0207668_1000030422 285
256 3300026088 Ga0207641_10000001 Ga0207641_10000001691 285
257 3300028381 Ga0268264_10004259 Ga0268264_1000425911 285
258 3300053158 Ga0500627_0124036 Ga0500627_0124036_168_1085 285
259 3300002459 JGI24751J29686_10000660 JGI24751J29686_100006609 286
260 3300005347 Ga0070668_100199554 Ga0070668_1001995541 286
261 3300005353 Ga0070669_100000437 Ga0070669_10000043711 286
262 3300005544 Ga0070686_100085533 Ga0070686_1000855332 286
263 3300005563 Ga0068855_100010482 Ga0068855_1000104822 286
264 3300005617 Ga0068859_100260377 Ga0068859_1002603771 286
265 3300005842 Ga0068858_100010200 Ga0068858_1000102002 286
266 3300006931 Ga0097620_100260385 Ga0097620_1002603851 286
267 3300006946 Ga0079104_1007109 Ga0079104_10071095 286
268 3300009177 Ga0105248_10014065 Ga0105248_100140652 286
269 3300013306 Ga0163162_10054234 Ga0163162_100542347 286
270 3300025903 Ga0207680_10037307 Ga0207680_100373072 286
271 3300025923 Ga0207681_10000463 Ga0207681_100004639 286
272 3300025931 Ga0207644_10136303 Ga0207644_101363032 286
273 3300025941 Ga0207711_10113796 Ga0207711_101137961 286
274 3300025949 Ga0207667_10167891 Ga0207667_101678911 286
275 3300026035 Ga0207703_10006199 Ga0207703_1000619911 286
276 3300026088 Ga0207641_10151692 Ga0207641_101516922 286
277 3300027111 Ga0209281_1015295 Ga0209281_10152952 286
278 3300046616 Ga0495668_0048576 Ga0495668_0048576_655_1539 286
279 3300048906 Ga0496103_0131073 Ga0496103_0131073_484_1359 286
280 3300048907 Ga0496104_0018392 Ga0496104_0018392_859_1734 286
281 3300048908 Ga0496105_0276148 Ga0496105_0276148_367_1242 286
282 3300048909 Ga0496106_0001994 Ga0496106_0001994_7379_8254 286
283 3300048910 Ga0496107_0006186 Ga0496107_0006186_6818_7693 286
284 3300048912 Ga0496109_0315756 Ga0496109_0315756_410_1285 286
285 3300048914 Ga0496111_0344978 Ga0496111_0344978_202_1077 286
286 3300048915 Ga0496112_0356615 Ga0496112_0356615_58_933 286
287 3300048916 Ga0496113_0000998 Ga0496113_0000998_50_925 286
288 3300048924 Ga0496121_0000087 Ga0496121_0000087_183498_184367 286
289 3300048929 Ga0496126_0028348 Ga0496126_0028348_257_1132 286
290 3300053104 Ga0500556_0000197 Ga0500556_0000197_15407_16291 286
291 3300053130 Ga0500642_0000011 Ga0500642_0000011_197312_198196 286
292 3300003771 Ga0055526_1004784 Ga0055526_10047845 287
293 3300003773 Ga0055537_1001358 Ga0055537_100135811 287
294 3300003792 Ga0055540_1002064 Ga0055540_10020644 287
295 3300005262 Ga0065165_1011299 Ga0065165_10112993 287
296 3300005544 Ga0070686_100000352 Ga0070686_10000035222 287
297 3300006871 Ga0075434_100198543 Ga0075434_1001985432 287
298 3300025263 Ga0209565_1000134 Ga0209565_100013453 287
299 3300025295 Ga0209564_1012455 Ga0209564_10124552 287
300 3300025298 Ga0209050_1014296 Ga0209050_10142963 287
301 3300045051 Ga0451576_0000393 Ga0451576_0000393_28529_29407 287
302 3300046530 Ga0495654_0032421 Ga0495654_0032421_1586_2452 287
303 3300046660 Ga0495625_0035851 Ga0495625_0035851_2004_2870 287
304 3300046694 Ga0495649_0112123 Ga0495649_0112123_514_1380 287
305 3300048903 Ga0496100_0400741 Ga0496100_0400741_16_930 287
306 3300048918 Ga0496115_0001129 Ga0496115_0001129_7563_8432 287
307 3300048928 Ga0496125_0126610 Ga0496125_0126610_877_1740 287
308 3300048929 Ga0496126_0126594 Ga0496126_0126594_771_1637 287
309 3300053087 Ga0500643_002015 Ga0500643_002015_2347_3213 287
310 3300053116 Ga0500592_000182 Ga0500592_000182_3976_4842 287
311 3300053151 Ga0500604_0000025 Ga0500604_0000025_11081_11947 287
312 3300053151 Ga0500604_0046596 Ga0500604_0046596_13_879 287
313 3300053153 Ga0500616_0000254 Ga0500616_0000254_73182_74048 287
314 3300053158 Ga0500627_0000208 Ga0500627_0000208_2828_3694 287
315 iso_pu_bacteria 2919709256 2919712717 287
316 3300003794 Ga0055531_10000013 Ga0055531_10000013175 290
317 3300005262 Ga0065165_1035594 Ga0065165_10355942 290
318 3300025298 Ga0209050_1000581 Ga0209050_100058114 290
319 3300025304 Ga0209257_1002898 Ga0209257_10028988 290
320 3300046513 Ga0495616_0001456 Ga0495616_0001456_8878_9756 290
321 3300046616 Ga0495668_0002221 Ga0495668_0002221_10542_11429 290
322 3300053151 Ga0500604_0001841 Ga0500604_0001841_3594_4481 290
323 3300053158 Ga0500627_0000332 Ga0500627_0000332_10107_10985 290
324 3300005331 Ga0070670_100130729 Ga0070670_1001307292 291
325 3300005347 Ga0070668_100000047 Ga0070668_10000004761 291
326 3300005353 Ga0070669_100119035 Ga0070669_1001190352 291
327 3300005367 Ga0070667_100000030 Ga0070667_100000030130 291
328 3300005841 Ga0068863_100000093 Ga0068863_1000000939 291
329 3300005843 Ga0068860_100017800 Ga0068860_1000178002 291
330 3300025923 Ga0207681_10027175 Ga0207681_100271752 291
331 3300025925 Ga0207650_10104123 Ga0207650_101041232 291
332 3300025972 Ga0207668_10000066 Ga0207668_1000006667 291
333 3300025986 Ga0207658_10000019 Ga0207658_10000019131 291
334 3300026088 Ga0207641_10000029 Ga0207641_10000029147 291
335 3300028381 Ga0268264_10012577 Ga0268264_1001257710 291
336 3300046471 Ga0495650_0001027 Ga0495650_0001027_25821_26702 291
337 3300046692 Ga0495671_0045784 Ga0495671_0045784_265_1140 291
338 3300001979 JGI24740J21852_10003247 JGI24740J21852_100032473 292
339 3300001989 JGI24739J22299_10010647 JGI24739J22299_100106474 292
340 3300001990 JGI24737J22298_10002289 JGI24737J22298_100022897 292
341 3300002067 JGI24735J21928_10001790 JGI24735J21928_100017902 292
342 3300005335 Ga0070666_10000234 Ga0070666_1000023433 292
343 3300005347 Ga0070668_100038200 Ga0070668_1000382004 292
344 3300005353 Ga0070669_100000008 Ga0070669_10000000877 292
345 3300005355 Ga0070671_100000010 Ga0070671_100000010194 292
346 3300005455 Ga0070663_100004887 Ga0070663_1000048874 292
347 3300005563 Ga0068855_100105901 Ga0068855_1001059011 292
348 3300005617 Ga0068859_100002317 Ga0068859_10000231710 292
349 3300005618 Ga0068864_100023017 Ga0068864_1000230174 292
350 3300005834 Ga0068851_10007559 Ga0068851_100075597 292
351 3300005834 Ga0068851_10142290 Ga0068851_101422902 292
352 3300005841 Ga0068863_100065620 Ga0068863_1000656201 292
353 3300005842 Ga0068858_100006839 Ga0068858_1000068394 292
354 3300005842 Ga0068858_100036302 Ga0068858_1000363023 292
355 3300005843 Ga0068860_100003988 Ga0068860_1000039888 292
356 3300005844 Ga0068862_100011082 Ga0068862_1000110822 292
357 3300006048 Ga0075363_100182305 Ga0075363_1001823052 292
358 3300006178 Ga0075367_10000607 Ga0075367_1000060716 292
359 3300006353 Ga0075370_10036426 Ga0075370_100364264 292
360 3300006931 Ga0097620_100002317 Ga0097620_1000023178 292
361 3300009101 Ga0105247_10000673 Ga0105247_100006738 292
362 3300009177 Ga0105248_10004862 Ga0105248_100048628 292
363 3300009545 Ga0105237_10005899 Ga0105237_100058997 292
364 3300009551 Ga0105238_10574796 Ga0105238_105747961 292
365 3300009553 Ga0105249_10037210 Ga0105249_100372104 292
366 3300010375 Ga0105239_10129322 Ga0105239_101293221 292
367 3300013104 Ga0157370_10018262 Ga0157370_100182627 292
368 3300013105 Ga0157369_10345800 Ga0157369_103458002 292
369 3300013306 Ga0163162_10012502 Ga0163162_100125022 292
370 3300025315 Ga0207697_10000036 Ga0207697_1000003647 292
371 3300025321 Ga0207656_10076003 Ga0207656_100760032 292
372 3300025903 Ga0207680_10000097 Ga0207680_100000977 292
373 3300025904 Ga0207647_10001988 Ga0207647_1000198811 292
374 3300025909 Ga0207705_10053618 Ga0207705_100536182 292
375 3300025923 Ga0207681_10000002 Ga0207681_10000002169 292
376 3300025931 Ga0207644_10000002 Ga0207644_10000002168 292
377 3300025972 Ga0207668_10001421 Ga0207668_100014218 292
378 3300025981 Ga0207640_10021246 Ga0207640_100212462 292
379 3300025986 Ga0207658_10003580 Ga0207658_100035802 292
380 3300026035 Ga0207703_10001492 Ga0207703_100014929 292
381 3300026035 Ga0207703_10042647 Ga0207703_100426473 292
382 3300026041 Ga0207639_10008795 Ga0207639_100087957 292
383 3300026041 Ga0207639_10023944 Ga0207639_100239444 292
384 3300026067 Ga0207678_10000857 Ga0207678_1000085711 292
385 3300026088 Ga0207641_10091771 Ga0207641_100917711 292
386 3300026095 Ga0207676_10015768 Ga0207676_100157685 292
387 3300026116 Ga0207674_10009584 Ga0207674_100095848 292
388 3300026116 Ga0207674_10024053 Ga0207674_100240537 292
389 3300026118 Ga0207675_100000358 Ga0207675_10000035837 292
390 3300027866 Ga0209813_10000075 Ga0209813_1000007540 292
391 3300028380 Ga0268265_10000339 Ga0268265_1000033935 292
392 3300028381 Ga0268264_10000010 Ga0268264_10000010387 292
393 3300031548 Ga0307408_100090798 Ga0307408_1000907983 292
394 3300031548 Ga0307408_100165945 Ga0307408_1001659452 292
395 3300031731 Ga0307405_10012300 Ga0307405_100123003 292
396 3300031852 Ga0307410_10118754 Ga0307410_101187542 292
397 3300031852 Ga0307410_10206636 Ga0307410_102066362 292
398 3300031901 Ga0307406_10227908 Ga0307406_102279082 292
399 3300032004 Ga0307414_10091196 Ga0307414_100911962 292
400 3300032004 Ga0307414_10210331 Ga0307414_102103312 292
401 3300046453 Ga0495627_000024 Ga0495627_000024_36368_37264 292
402 3300046520 Ga0495637_0003303 Ga0495637_0003303_3714_4592 292
403 3300046520 Ga0495637_0008486 Ga0495637_0008486_2901_3779 292
404 3300046522 Ga0495643_0000030 Ga0495643_0000030_182797_183675 292
405 3300046524 Ga0495648_0001960 Ga0495648_0001960_18572_19450 292
406 3300046524 Ga0495648_0006668 Ga0495648_0006668_665_1543 292
407 3300046558 Ga0495633_0002794 Ga0495633_0002794_11152_12030 292
408 3300046692 Ga0495671_0000072 Ga0495671_0000072_19883_20761 292
409 3300047470 Ga0495681_0000858 Ga0495681_0000858_4361_5239 292
410 3300048911 Ga0496108_0060537 Ga0496108_0060537_591_1481 292
411 3300048919 Ga0496116_0037014 Ga0496116_0037014_108_986 292
412 3300048920 Ga0496117_0040966 Ga0496117_0040966_1417_2295 292
413 3300048925 Ga0496122_0000603 Ga0496122_0000603_9335_10258 292
414 3300048926 Ga0496123_0000155 Ga0496123_0000155_92981_93904 292
415 3300048928 Ga0496125_0015219 Ga0496125_0015219_470_1360 292
416 3300049663 Ga0501223_000039 Ga0501223_000039_27699_28577 292
417 3300049705 Ga0501225_0000010 Ga0501225_0000010_63280_64158 292
418 3300050494 nmdc:mga06z11_17_c1 nmdc:mga06z11_17_c1_49564_50442 292
419 3300050495 nmdc:mga04h51_23_c1 nmdc:mga04h51_23_c1_33532_34410 292
420 3300053087 Ga0500643_002195 Ga0500643_002195_2460_3341 292
421 3300053157 Ga0500624_000002 Ga0500624_000002_29639_30517 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17778

BLACT_WH

Beta-lactamase associated winged helix domain

257

301

0.98

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

47

222

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.868 225 292
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.8536 225 291
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.8422 225 292
1xmk-assembly1.cif.gz_A the crystal structure of the zb domain from the rna editing enzyme adar1 0.8352 225 291
5u8o-assembly2.cif.gz_D crystal structure of beta-lactamase domain protein, from burkholderia multivorans 0.8345 10 291
ID Description Score Start End Superfamily
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9095 226 291 1.10.10.10
af_Q99KR3_205_288_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9035 219 291 1.10.10.10
af_Q6NYF0_205_289_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8852 219 291 1.10.10.10
af_Q95Q18_202_279_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8731 219 292 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8684 226 292 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A526XMU4-F1-model_v4 MBL fold metallo-hydrolase 0.9818 11 84 GO:0016787
AF-A0A848TXB8-F1-model_v4 MBL fold metallo-hydrolase 0.9792 11 98 GO:0016787
GO:0046872
AF-A0A2E6X934-F1-model_v4 MBL fold metallo-hydrolase 0.9741 21 105 GO:0016787
AF-A0A526XMU4-F1-model_v4 MBL fold metallo-hydrolase 0.9689 11 84 GO:0016787
AF-A0A352KMR6-F1-model_v4 MBL fold metallo-hydrolase 0.9658 10 79 GO:0016787

Feature Viewer

pLDDT pTM Quality
91.09 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map