F439831

General Info

Members Datasets Scaffolds Average Seq Length
420 254 840 295

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_0006035|Ga0496101_0006035_694_1689
Length 331
Sequence MADTASGSRRGGSAARALLSTDDSDRVPIGGYGQVTTFRIQPHVRLQEWVAEDLGFFRDEGLDYEFEAVGFAGASSTTSPSVSPGDAAPVAARSGAFEDMEQGRTCSVSSACHWAVNAAASSSHGRMWGKAYSICDSAIFVAADSPYRRPEDLAGAKVGVGYHSGSHYSAIQALEPFLERSEIALQFVGLPFDRVRLMQRGEIEVANVFGAGYYLLEQHGFRKLVDTTFVMGFLVAEDADAAQVDGYFRALRHAQREIDLEPERFKHYWRREIPEDLAGDIDVRRFGPGERIVFEPYTRDMFERTHRWMEGWGLFDPRGAARPDYDTAVLV

Samples

Sample ID Description Type Environment
1 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
149 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
154 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
162 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
163 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
164 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
165 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
252 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
253 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
254 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.24
Metatranscriptomes 4.05
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.33
Rhizosphere 87.62
Stem 0
Stem Tuber 0
Unclassified 5.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496101_0006035 3300048904 Bacteria 7772
2 JGI24751J29686_10010528 3300002459 Bacteria 1906
3 Ga0070658_10112792 3300005327 Bacteria 2254
4 Ga0070658_10153760 3300005327 Bacteria 1927
5 Ga0070676_10024664 3300005328 Bacteria 3391
6 Ga0070683_100002618 3300005329 Bacteria 14392
7 Ga0070683_100006492 3300005329 Bacteria 9820
8 Ga0070683_100588958 3300005329 Bacteria 1064
9 Ga0070670_100037221 3300005331 Bacteria 4186
10 Ga0068869_100008674 3300005334 Bacteria 6564
11 Ga0070680_100005037 3300005336 Bacteria 9966
12 Ga0070682_100044599 3300005337 Bacteria 2746
13 Ga0070682_100092220 3300005337 Bacteria 1984
14 Ga0068868_100010471 3300005338 Bacteria 6717
15 Ga0070660_100028932 3300005339 Bacteria 4149
16 Ga0070660_100103042 3300005339 Bacteria 2263
17 Ga0070661_100127628 3300005344 Bacteria 1909
18 Ga0070661_100134334 3300005344 Bacteria 1860
19 Ga0070692_10002014 3300005345 Bacteria 7708
20 Ga0070692_10209265 3300005345 Bacteria 1147
21 Ga0070675_100008783 3300005354 Bacteria 7848
22 Ga0070671_100007563 3300005355 Bacteria 8685
23 Ga0070673_100054091 3300005364 Bacteria 3157
24 Ga0070688_100109945 3300005365 Bacteria 1831
25 Ga0070709_10340783 3300005434 Unclassified 1105
26 Ga0070714_100026146 3300005435 Bacteria 4822
27 Ga0070714_100039627 3300005435 Bacteria 3967
28 Ga0070714_100132409 3300005435 Unclassified 2229
29 Ga0070713_100011422 3300005436 Bacteria 6468
30 Ga0070713_100077311 3300005436 Unclassified 2829
31 Ga0070713_100083018 3300005436 Bacteria 2738
32 Ga0070713_100147600 3300005436 Bacteria 2089
33 Ga0070711_100009709 3300005439 Bacteria 5928
34 Ga0070711_100380213 3300005439 Bacteria 1142
35 Ga0070705_100177163 3300005440 Bacteria 1441
36 Ga0070694_100067241 3300005444 Bacteria 2460
37 Ga0070663_100045841 3300005455 Bacteria 3090
38 Ga0070678_100024829 3300005456 Bacteria 4019
39 Ga0070662_100211728 3300005457 Bacteria 1543
40 Ga0070681_10047352 3300005458 Bacteria 4298
41 Ga0070681_10125188 3300005458 Bacteria 2502
42 Ga0070681_10224891 3300005458 Bacteria 1791
43 Ga0070685_10207631 3300005466 Bacteria 1277
44 Ga0070698_100113516 3300005471 Bacteria 2674
45 Ga0070679_100004869 3300005530 Bacteria 12393
46 Ga0070679_100401035 3300005530 Bacteria 1317
47 Ga0070684_100038902 3300005535 Bacteria 4089
48 Ga0070684_100241086 3300005535 Bacteria 1652
49 Ga0068853_100071173 3300005539 Bacteria 3028
50 Ga0068853_100132110 3300005539 Bacteria 2236
51 Ga0070672_100091272 3300005543 Bacteria 2457
52 Ga0070686_100380632 3300005544 Bacteria 1068
53 Ga0070695_100060989 3300005545 Bacteria 2446
54 Ga0070693_100075815 3300005547 Bacteria 1992
55 Ga0070665_100030026 3300005548 Bacteria 5470
56 Ga0070704_100001335 3300005549 Bacteria 13077
57 Ga0070704_100121755 3300005549 Bacteria 2006
58 Ga0070704_100145496 3300005549 Bacteria 1856
59 Ga0068855_100051801 3300005563 Bacteria 4834
60 Ga0070664_100156106 3300005564 Bacteria 2016
61 Ga0070664_100161935 3300005564 Bacteria 1980
62 Ga0068854_100021351 3300005578 Bacteria 4393
63 Ga0068854_100158072 3300005578 Unclassified 1753
64 Ga0068854_100166288 3300005578 Bacteria 1713
65 Ga0068856_100015733 3300005614 Bacteria 7314
66 Ga0068856_100118848 3300005614 Bacteria 2644
67 Ga0068856_100133931 3300005614 Bacteria 2483
68 Ga0068856_100161041 3300005614 Bacteria 2254
69 Ga0068856_100204466 3300005614 Bacteria 1989
70 Ga0068856_100405540 3300005614 Bacteria 1383
71 Ga0070702_100002355 3300005615 Bacteria 8126
72 Ga0068852_100000468 3300005616 Bacteria 26515
73 Ga0068852_100031005 3300005616 Bacteria 4406
74 Ga0068859_100051182 3300005617 Bacteria 4151
75 Ga0068851_10020854 3300005834 Bacteria 3177
76 Ga0068870_10001173 3300005840 Bacteria 10502
77 Ga0068863_100069629 3300005841 Bacteria 3326
78 Ga0068863_100237566 3300005841 Bacteria 1759
79 Ga0068863_100315277 3300005841 Bacteria 1518
80 Ga0068858_100021230 3300005842 Bacteria 6065
81 Ga0068860_100037725 3300005843 Bacteria 4625
82 Ga0068862_100070394 3300005844 Bacteria 3020
83 Ga0081540_1000808 3300005983 Bacteria 28767
84 Ga0070717_10076596 3300006028 Bacteria 2800
85 Ga0070717_10113953 3300006028 Bacteria 2309
86 Ga0070717_10235033 3300006028 Bacteria 1614
87 Ga0070715_10111832 3300006163 Bacteria 1289
88 Ga0070716_100077006 3300006173 Bacteria 1978
89 Ga0070716_100232026 3300006173 Bacteria 1246
90 Ga0070712_100000801 3300006175 Bacteria 18657
91 Ga0070712_100025254 3300006175 Bacteria 3947
92 Ga0097621_100007394 3300006237 Bacteria 7859
93 Ga0097621_100190144 3300006237 Bacteria 1778
94 Ga0075428_100022172 3300006844 Bacteria 7031
95 Ga0075428_100464817 3300006844 Bacteria 1355
96 Ga0075431_100035113 3300006847 Bacteria 5164
97 Ga0075431_100242580 3300006847 Bacteria 1833
98 Ga0075433_10168596 3300006852 Bacteria 1949
99 Ga0075434_100055976 3300006871 Bacteria 3919
100 Ga0075434_100073018 3300006871 Bacteria 3423
101 Ga0075429_100000003 3300006880 Bacteria 130377
102 Ga0075436_100018107 3300006914 Bacteria 4824
103 Ga0097620_100051182 3300006931 Bacteria 4151
104 Ga0075435_100147962 3300007076 Bacteria 1973
105 Ga0099794_10040551 3300007265 Bacteria 2214
106 Ga0105251_10019585 3300009011 Bacteria 3571
107 Ga0105240_10092152 3300009093 Bacteria 3701
108 Ga0105240_10361363 3300009093 Bacteria 1644
109 Ga0111539_10108153 3300009094 Bacteria 3263
110 Ga0111539_10119263 3300009094 Bacteria 3092
111 Ga0111539_10154014 3300009094 Bacteria 2690
112 Ga0105245_10195208 3300009098 Bacteria 1941
113 Ga0105245_10507836 3300009098 Bacteria 1222
114 Ga0114129_10001806 3300009147 Bacteria 29163
115 Ga0114129_10005359 3300009147 Bacteria 18104
116 Ga0114129_10285105 3300009147 Bacteria 2206
117 Ga0105241_10006499 3300009174 Bacteria 8618
118 Ga0105241_10104641 3300009174 Bacteria 2255
119 Ga0105248_10026684 3300009177 Bacteria 6423
120 Ga0105237_10017552 3300009545 Bacteria 7416
121 Ga0105238_10013968 3300009551 Bacteria 8120
122 Ga0105249_10220350 3300009553 Bacteria 1866
123 Ga0105239_10225873 3300010375 Bacteria 2100
124 Ga0105239_10298615 3300010375 Bacteria 1814
125 Ga0105246_10014624 3300011119 Bacteria 4940
126 Ga0157373_10016052 3300013100 Bacteria 5466
127 Ga0157371_10017767 3300013102 Bacteria 5276
128 Ga0157370_10002228 3300013104 Bacteria 23588
129 Ga0157370_10030474 3300013104 Bacteria 5285
130 Ga0157370_10038458 3300013104 Bacteria 4627
131 Ga0157369_10043215 3300013105 Bacteria 4913
132 Ga0157369_10270382 3300013105 Bacteria 1771
133 Ga0163162_10415213 3300013306 Bacteria 1478
134 Ga0157372_10056801 3300013307 Bacteria 4373
135 Ga0157372_10617383 3300013307 Bacteria 1263
136 Ga0157375_10051751 3300013308 Bacteria 4035
137 Ga0163163_10149760 3300014325 Bacteria 2377
138 Ga0157376_10015916 3300014969 Bacteria 5696
139 Ga0197907_10099699 3300020069 Bacteria 2435
140 Ga0197907_11451998 3300020069 Bacteria 1007
141 Ga0206356_10238611 3300020070 Bacteria 1366
142 Ga0206356_10691310 3300020070 Bacteria 1753
143 Ga0206356_10865200 3300020070 Bacteria 1450
144 Ga0206356_11333099 3300020070 Bacteria 4356
145 Ga0206352_10842244 3300020078 Bacteria 2249
146 Ga0206354_10567219 3300020081 Bacteria 1598
147 Ga0206354_10880043 3300020081 Bacteria 1366
148 Ga0206354_11666555 3300020081 Bacteria 1241
149 Ga0206353_11132117 3300020082 Bacteria 2222
150 Ga0206353_11220211 3300020082 Bacteria 2801
151 Ga0206353_11479186 3300020082 Bacteria 2289
152 Ga0213874_10036456 3300021377 Unclassified 1450
153 Ga0213876_10064638 3300021384 Bacteria 1931
154 Ga0224712_10071625 3300022467 Unclassified 1409
155 Ga0224712_10078205 3300022467 Bacteria 1359
156 Ga0224712_10084326 3300022467 Bacteria 1318
157 Ga0224712_10118818 3300022467 Bacteria 1142
158 Ga0207713_1045126 3300025735 Bacteria 1803
159 Ga0207692_10066670 3300025898 Bacteria 1882
160 Ga0207688_10027045 3300025901 Bacteria 3155
161 Ga0207680_10224380 3300025903 Bacteria 1289
162 Ga0207685_10090585 3300025905 Bacteria 1287
163 Ga0207699_10048495 3300025906 Bacteria 2495
164 Ga0207699_10177063 3300025906 Unclassified 1431
165 Ga0207645_10036502 3300025907 Bacteria 3155
166 Ga0207643_10000876 3300025908 Bacteria 18141
167 Ga0207705_10016503 3300025909 Bacteria 5291
168 Ga0207705_10273021 3300025909 Bacteria 1293
169 Ga0207654_10090645 3300025911 Bacteria 1863
170 Ga0207707_10007501 3300025912 Bacteria 9505
171 Ga0207707_10023432 3300025912 Bacteria 5400
172 Ga0207707_10026667 3300025912 Bacteria 5050
173 Ga0207707_10169422 3300025912 Bacteria 1908
174 Ga0207695_10069304 3300025913 Bacteria 3609
175 Ga0207671_10059482 3300025914 Bacteria 2833
176 Ga0207671_10153177 3300025914 Bacteria 1782
177 Ga0207693_10001195 3300025915 Bacteria 23193
178 Ga0207693_10173110 3300025915 Bacteria 1699
179 Ga0207693_10339445 3300025915 Bacteria 1176
180 Ga0207663_10070019 3300025916 Bacteria 2259
181 Ga0207660_10031194 3300025917 Bacteria 3668
182 Ga0207660_10058397 3300025917 Bacteria 2766
183 Ga0207660_10059576 3300025917 Bacteria 2741
184 Ga0207660_10393983 3300025917 Bacteria 1115
185 Ga0207662_10081679 3300025918 Bacteria 1973
186 Ga0207657_10013048 3300025919 Bacteria 8166
187 Ga0207657_10027939 3300025919 Bacteria 5157
188 Ga0207649_10034464 3300025920 Bacteria 3033
189 Ga0207649_10056709 3300025920 Bacteria 2447
190 Ga0207652_10004663 3300025921 Bacteria 11113
191 Ga0207652_10016661 3300025921 Bacteria 6005
192 Ga0207652_10023017 3300025921 Bacteria 5161
193 Ga0207652_10043856 3300025921 Bacteria 3809
194 Ga0207650_10006410 3300025925 Bacteria 8016
195 Ga0207687_10077336 3300025927 Bacteria 2393
196 Ga0207700_10138324 3300025928 Bacteria 1998
197 Ga0207700_10272379 3300025928 Bacteria 1453
198 Ga0207700_10348393 3300025928 Bacteria 1289
199 Ga0207664_10008923 3300025929 Bacteria 7021
200 Ga0207664_10047850 3300025929 Unclassified 3361
201 Ga0207664_10143829 3300025929 Bacteria 2020
202 Ga0207664_10193112 3300025929 Bacteria 1753
203 Ga0207690_10087340 3300025932 Bacteria 2194
204 Ga0207690_10148573 3300025932 Bacteria 1735
205 Ga0207706_10018437 3300025933 Bacteria 6281
206 Ga0207709_10021268 3300025935 Bacteria 3671
207 Ga0207665_10118420 3300025939 Bacteria 1869
208 Ga0207691_10084733 3300025940 Bacteria 2845
209 Ga0207711_10242638 3300025941 Bacteria 1652
210 Ga0207689_10009873 3300025942 Bacteria 8228
211 Ga0207661_10004185 3300025944 Bacteria 10098
212 Ga0207661_10007933 3300025944 Bacteria 7569
213 Ga0207679_10005345 3300025945 Bacteria 8052
214 Ga0207679_10139523 3300025945 Bacteria 1957
215 Ga0207679_10637721 3300025945 Unclassified 963
216 Ga0207667_10380850 3300025949 Bacteria 1437
217 Ga0207667_10607317 3300025949 Bacteria 1102
218 Ga0207651_10331519 3300025960 Bacteria 1275
219 Ga0207640_10118817 3300025981 Bacteria 1889
220 Ga0207658_10114208 3300025986 Bacteria 2141
221 Ga0207677_10128869 3300026023 Bacteria 1917
222 Ga0207703_10039814 3300026035 Bacteria 3758
223 Ga0207639_10110964 3300026041 Bacteria 2235
224 Ga0207678_10003135 3300026067 Bacteria 14966
225 Ga0207708_10017214 3300026075 Bacteria 5440
226 Ga0207702_10005255 3300026078 Bacteria 11368
227 Ga0207702_10012103 3300026078 Bacteria 7176
228 Ga0207702_10155636 3300026078 Bacteria 2083
229 Ga0207641_10011039 3300026088 Bacteria 7409
230 Ga0207648_10102412 3300026089 Bacteria 2510
231 Ga0207676_10006348 3300026095 Bacteria 8351
232 Ga0207674_10016795 3300026116 Bacteria 8001
233 Ga0207674_10152644 3300026116 Bacteria 2266
234 Ga0207683_10005870 3300026121 Bacteria 10529
235 Ga0207698_10002923 3300026142 Bacteria 10210
236 Ga0207428_10019405 3300027907 Bacteria 5798
237 Ga0207428_10035644 3300027907 Bacteria 4065
238 Ga0207428_10195008 3300027907 Bacteria 1525
239 Ga0268266_10030828 3300028379 Bacteria 4554
240 Ga0268264_10059808 3300028381 Bacteria 3193
241 Ga0265337_1003657 3300028556 Bacteria 6592
242 Ga0265326_10008437 3300028558 Bacteria 3109
243 Ga0265319_1015829 3300028563 Bacteria 2908
244 Ga0265334_10002422 3300028573 Bacteria 8769
245 Ga0265318_10025405 3300028577 Bacteria 2339
246 Ga0265322_10021048 3300028654 Bacteria 1868
247 Ga0265336_10020637 3300028666 Bacteria 2112
248 Ga0265338_10003193 3300028800 Bacteria 23375
249 Ga0265324_10016738 3300029957 Bacteria 2670
250 Ga0265332_10003653 3300031238 Bacteria 7370
251 Ga0265320_10132579 3300031240 Bacteria 1131
252 Ga0307513_10157007 3300031456 Bacteria 2173
253 Ga0265314_10053738 3300031711 Bacteria 2792
254 Ga0326468_10003476 3300031889 Bacteria 1335
255 Ga0316214_1001850 3300033545 Bacteria 2536
256 Ga0373948_0015733 3300034817 Bacteria 1392
257 Ga0373958_0004671 3300034819 Bacteria 2040
258 Ga0373934_0010530 3300035086 Bacteria 3472
259 Ga0373940_0006246 3300035088 Bacteria 2633
260 Ga0373923_0057303 3300035111 Bacteria 1647
261 Ga0373939_0025756 3300035114 Bacteria 1652
262 Ga0373962_0055363 3300035242 Bacteria 1152
263 Ga0373931_0286856 3300035691 Bacteria 1013
264 Ga0373935_0002659 3300035692 Bacteria 10277
265 Ga0373933_0004400 3300035724 Bacteria 7734
266 Ga0373947_0000001 3300035725 Bacteria 510932
267 Ga0373937_0014972 3300036401 Bacteria 6852
268 Ga0373937_0087933 3300036401 Bacteria 2876
269 Ga0373925_0000010 3300037068 Bacteria 229059
270 Ga0373925_0150919 3300037068 Bacteria 1825
271 Ga0436364_0346073 3300037853 Bacteria 8903
272 Ga0436364_0409665 3300037853 Bacteria 38199
273 Ga0395901_0006014 3300038443 Bacteria 12296
274 Ga0395901_0141763 3300038443 Bacteria 2526
275 Ga0395901_0567838 3300038443 Bacteria 1148
276 Ga0436365_0696108 3300039437 Bacteria 18390
277 Ga0436365_0700491 3300039437 Bacteria 8090
278 Ga0436365_0832259 3300039437 Bacteria 8106
279 Ga0436365_0984403 3300039437 Bacteria 2267
280 Ga0436365_1354371 3300039437 Bacteria 14263
281 Ga0436365_1434344 3300039437 Bacteria 2477
282 Ga0436365_1529010 3300039437 Bacteria 14229
283 Ga0436363_0267133 3300039450 Bacteria 2551
284 Ga0436363_0664067 3300039450 Bacteria 4824
285 Ga0436362_1236243 3300039453 Bacteria 1746
286 Ga0439441_001301 3300042001 Bacteria 3217
287 Ga0439448_0006280 3300042005 Bacteria 3413
288 Ga0439463_018523 3300042016 Bacteria 1733
289 Ga0466966_0044273 3300044684 Bacteria 2850
290 Ga0466966_0062710 3300044684 Bacteria 2343
291 Ga0466961_0146135 3300044693 Unclassified 1478
292 Ga0466963_0062341 3300044694 Bacteria 2494
293 Ga0466963_0157968 3300044694 Bacteria 1577
294 Ga0466971_0033332 3300044719 Bacteria 2308
295 Ga0466971_0148775 3300044719 Bacteria 1092
296 Ga0466968_0083879 3300044735 Bacteria 1404
297 Ga0466968_0103606 3300044735 Unclassified 1273
298 Ga0466970_0059727 3300044765 Bacteria 2042
299 Ga0466970_0111484 3300044765 Bacteria 1494
300 Ga0466957_0030120 3300044842 Bacteria 3239
301 Ga0466957_0128615 3300044842 Bacteria 1620
302 Ga0466960_0001959 3300044901 Bacteria 7616
303 Ga0466960_0028432 3300044901 Bacteria 2558
304 Ga0466959_0032657 3300045049 Bacteria 3853
305 Ga0466959_0110778 3300045049 Bacteria 1959
306 Ga0451576_0440597 3300045051 Bacteria 1367
307 Ga0466958_0008449 3300045836 Bacteria 5712
308 Ga0466958_0311917 3300045836 Bacteria 1010
309 Ga0466967_0035826 3300045976 Bacteria 4228
310 Ga0466967_0043978 3300045976 Bacteria 3870
311 Ga0466967_0082643 3300045976 Bacteria 2903
312 Ga0466967_0171627 3300045976 Unclassified 2041
313 Ga0466967_0406566 3300045976 Bacteria 1325
314 Ga0495592_0022975 3300046454 Bacteria 4745
315 Ga0495629_0038052 3300046459 Bacteria 3390
316 Ga0495651_0012340 3300046462 Bacteria 6585
317 Ga0495651_0017556 3300046462 Bacteria 5540
318 Ga0495653_0006140 3300046463 Bacteria 9852
319 Ga0495653_0071855 3300046463 Unclassified 2585
320 Ga0495594_0077459 3300046499 Bacteria 1855
321 Ga0495608_0001421 3300046511 Bacteria 17037
322 Ga0495608_0038221 3300046511 Bacteria 3224
323 Ga0495618_0287278 3300046514 Bacteria 1024
324 Ga0495628_0004895 3300046516 Bacteria 11790
325 Ga0495628_0053657 3300046516 Bacteria 3180
326 Ga0495630_0016195 3300046517 Bacteria 5448
327 Ga0495630_0123827 3300046517 Bacteria 1961
328 Ga0495666_0015901 3300046526 Bacteria 3748
329 Ga0495652_0071766 3300046529 Bacteria 2888
330 Ga0495652_0134066 3300046529 Bacteria 1956
331 Ga0495665_0061952 3300046531 Bacteria 1975
332 Ga0495640_0034624 3300046533 Bacteria 3578
333 Ga0495640_0049443 3300046533 Bacteria 2899
334 Ga0495586_0095696 3300046535 Bacteria 1644
335 Ga0495587_0005141 3300046536 Bacteria 8554
336 Ga0495587_0007390 3300046536 Bacteria 7117
337 Ga0495667_0039740 3300046559 Bacteria 3126
338 Ga0495635_0006002 3300046663 Bacteria 8474
339 Ga0495635_0026197 3300046663 Bacteria 4060
340 Ga0495635_0028268 3300046663 Unclassified 3897
341 Ga0495657_0032539 3300046675 Bacteria 3637
342 Ga0495599_0012091 3300046678 Bacteria 5312
343 Ga0495599_0177733 3300046678 Bacteria 1312
344 Ga0495599_0320587 3300046678 Unclassified 933
345 Ga0495623_0030827 3300046679 Unclassified 3450
346 Ga0495623_0226140 3300046679 Bacteria 1064
347 Ga0495646_0037326 3300046680 Bacteria 3006
348 Ga0495646_0268572 3300046680 Unclassified 909
349 Ga0495613_0030075 3300046689 Unclassified 4035
350 Ga0495600_0028548 3300046809 Bacteria 3610
351 Ga0495600_0127546 3300046809 Unclassified 1654
352 Ga0495604_0006180 3300047317 Bacteria 9503
353 Ga0495604_0029491 3300047317 Bacteria 4365
354 Ga0495674_0023522 3300047319 Bacteria 5677
355 Ga0495674_0090032 3300047319 Bacteria 2622
356 Ga0495674_0167623 3300047319 Bacteria 1834
357 Ga0495676_0214575 3300047321 Bacteria 1329
358 Ga0495680_0007284 3300047322 Bacteria 10181
359 Ga0495684_0028753 3300047471 Unclassified 4267
360 Ga0495684_0071234 3300047471 Bacteria 2641
361 Ga0495684_0146902 3300047471 Bacteria 1765
362 Ga0495602_0003268 3300048088 Bacteria 16746
363 Ga0495602_0021863 3300048088 Bacteria 6279
364 Ga0495614_0030476 3300048089 Bacteria 2322
365 Ga0496100_0012988 3300048903 Bacteria 4792
366 Ga0496101_0016918 3300048904 Bacteria 4937
367 Ga0496102_0004271 3300048905 Bacteria 12080
368 Ga0496102_0081681 3300048905 Bacteria 2980
369 Ga0496103_0091634 3300048906 Bacteria 1918
370 Ga0496103_0140393 3300048906 Bacteria 1545
371 Ga0496104_0024567 3300048907 Bacteria 5544
372 Ga0496104_0068107 3300048907 Unclassified 3382
373 Ga0496104_0131666 3300048907 Bacteria 2402
374 Ga0496105_0007128 3300048908 Bacteria 8623
375 Ga0496105_0039219 3300048908 Bacteria 3903
376 Ga0496105_0163862 3300048908 Bacteria 1824
377 Ga0496106_0008102 3300048909 Bacteria 7763
378 Ga0496106_0027428 3300048909 Bacteria 4241
379 Ga0496107_0022361 3300048910 Bacteria 4468
380 Ga0496107_0080407 3300048910 Bacteria 2377
381 Ga0496108_0001197 3300048911 Bacteria 20322
382 Ga0496108_0046751 3300048911 Bacteria 3616
383 Ga0496109_0005545 3300048912 Bacteria 10568
384 Ga0496109_0113216 3300048912 Bacteria 2523
385 Ga0496109_0443286 3300048912 Unclassified 1227
386 Ga0496110_0000358 3300048913 Bacteria 30516
387 Ga0496110_0007764 3300048913 Bacteria 8590
388 Ga0496111_0003187 3300048914 Bacteria 10114
389 Ga0496111_0090910 3300048914 Bacteria 2236
390 Ga0496112_0005036 3300048915 Bacteria 11344
391 Ga0496112_0079373 3300048915 Bacteria 3246
392 Ga0496112_0219729 3300048915 Bacteria 1856
393 Ga0496112_0229329 3300048915 Bacteria 1812
394 Ga0496113_0015470 3300048916 Bacteria 5245
395 Ga0496113_0036210 3300048916 Bacteria 3614
396 Ga0496114_0038361 3300048917 Bacteria 3964
397 Ga0496115_0036169 3300048918 Bacteria 3908
398 Ga0496115_0065619 3300048918 Bacteria 2932
399 nmdc:mga05p37_226334_c1 3300050507 Bacteria 2255
400 nmdc:mga05p37_312421_c1 3300050507 Bacteria 1862
401 nmdc:mga05p37_69444_c1 3300050507 Bacteria 4334
402 nmdc:mga05p37_77_c1 3300050507 Bacteria 86224
403 nmdc:mga09592_140_c1 3300050508 Bacteria 48059
404 nmdc:mga08y16_74000_c1 3300050511 Bacteria 3549
405 nmdc:mga08y16_81706_c1 3300050511 Bacteria 3369
406 nmdc:mga0n895_30481_c1 3300050512 Bacteria 5156
407 nmdc:mga0rr50_32116_c1 3300050513 Bacteria 3737
408 nmdc:mga08x19_128107_c1 3300050514 Bacteria 1706
409 nmdc:mga08x19_7483_c1 3300050514 Bacteria 6487
410 nmdc:mga0a205_100203_c1 3300050515 Bacteria 2796
411 nmdc:mga0a205_33770_c1 3300050515 Bacteria 4907
412 nmdc:mga0a205_376801_c1 3300050515 Bacteria 1284
413 Ga0495612_0107849 3300053078 Unclassified 1190
414 Ga0495595_0003719 3300053084 Bacteria 6065
415 Ga0495619_0011435 3300053085 Bacteria 5592
416 Ga0495619_0195171 3300053085 Bacteria 1401
417 Ga0466962_0176532 3300061719 Unclassified 1041
418 2558912924 2558860112 Bacteria 9931328
419 2870786865 2870782633 Bacteria 9624083
420 8054473782 8054472261 Bacteria 7464355
421 Ga0496101_0006035
422 JGI24751J29686_10010528
423 Ga0070658_10112792
424 Ga0070658_10153760
425 Ga0070676_10024664
426 Ga0070683_100002618
427 Ga0070683_100006492
428 Ga0070683_100588958
429 Ga0070670_100037221
430 Ga0068869_100008674
431 Ga0070680_100005037
432 Ga0070682_100044599
433 Ga0070682_100092220
434 Ga0068868_100010471
435 Ga0070660_100028932
436 Ga0070660_100103042
437 Ga0070661_100127628
438 Ga0070661_100134334
439 Ga0070692_10002014
440 Ga0070692_10209265
441 Ga0070675_100008783
442 Ga0070671_100007563
443 Ga0070673_100054091
444 Ga0070688_100109945
445 Ga0070709_10340783
446 Ga0070714_100026146
447 Ga0070714_100039627
448 Ga0070714_100132409
449 Ga0070713_100011422
450 Ga0070713_100077311
451 Ga0070713_100083018
452 Ga0070713_100147600
453 Ga0070711_100009709
454 Ga0070711_100380213
455 Ga0070705_100177163
456 Ga0070694_100067241
457 Ga0070663_100045841
458 Ga0070678_100024829
459 Ga0070662_100211728
460 Ga0070681_10047352
461 Ga0070681_10125188
462 Ga0070681_10224891
463 Ga0070685_10207631
464 Ga0070698_100113516
465 Ga0070679_100004869
466 Ga0070679_100401035
467 Ga0070684_100038902
468 Ga0070684_100241086
469 Ga0068853_100071173
470 Ga0068853_100132110
471 Ga0070672_100091272
472 Ga0070686_100380632
473 Ga0070695_100060989
474 Ga0070693_100075815
475 Ga0070665_100030026
476 Ga0070704_100001335
477 Ga0070704_100121755
478 Ga0070704_100145496
479 Ga0068855_100051801
480 Ga0070664_100156106
481 Ga0070664_100161935
482 Ga0068854_100021351
483 Ga0068854_100158072
484 Ga0068854_100166288
485 Ga0068856_100015733
486 Ga0068856_100118848
487 Ga0068856_100133931
488 Ga0068856_100161041
489 Ga0068856_100204466
490 Ga0068856_100405540
491 Ga0070702_100002355
492 Ga0068852_100000468
493 Ga0068852_100031005
494 Ga0068859_100051182
495 Ga0068851_10020854
496 Ga0068870_10001173
497 Ga0068863_100069629
498 Ga0068863_100237566
499 Ga0068863_100315277
500 Ga0068858_100021230
501 Ga0068860_100037725
502 Ga0068862_100070394
503 Ga0081540_1000808
504 Ga0070717_10076596
505 Ga0070717_10113953
506 Ga0070717_10235033
507 Ga0070715_10111832
508 Ga0070716_100077006
509 Ga0070716_100232026
510 Ga0070712_100000801
511 Ga0070712_100025254
512 Ga0097621_100007394
513 Ga0097621_100190144
514 Ga0075428_100022172
515 Ga0075428_100464817
516 Ga0075431_100035113
517 Ga0075431_100242580
518 Ga0075433_10168596
519 Ga0075434_100055976
520 Ga0075434_100073018
521 Ga0075429_100000003
522 Ga0075436_100018107
523 Ga0097620_100051182
524 Ga0075435_100147962
525 Ga0099794_10040551
526 Ga0105251_10019585
527 Ga0105240_10092152
528 Ga0105240_10361363
529 Ga0111539_10108153
530 Ga0111539_10119263
531 Ga0111539_10154014
532 Ga0105245_10195208
533 Ga0105245_10507836
534 Ga0114129_10001806
535 Ga0114129_10005359
536 Ga0114129_10285105
537 Ga0105241_10006499
538 Ga0105241_10104641
539 Ga0105248_10026684
540 Ga0105237_10017552
541 Ga0105238_10013968
542 Ga0105249_10220350
543 Ga0105239_10225873
544 Ga0105239_10298615
545 Ga0105246_10014624
546 Ga0157373_10016052
547 Ga0157371_10017767
548 Ga0157370_10002228
549 Ga0157370_10030474
550 Ga0157370_10038458
551 Ga0157369_10043215
552 Ga0157369_10270382
553 Ga0163162_10415213
554 Ga0157372_10056801
555 Ga0157372_10617383
556 Ga0157375_10051751
557 Ga0163163_10149760
558 Ga0157376_10015916
559 Ga0197907_10099699
560 Ga0197907_11451998
561 Ga0206356_10238611
562 Ga0206356_10691310
563 Ga0206356_10865200
564 Ga0206356_11333099
565 Ga0206352_10842244
566 Ga0206354_10567219
567 Ga0206354_10880043
568 Ga0206354_11666555
569 Ga0206353_11132117
570 Ga0206353_11220211
571 Ga0206353_11479186
572 Ga0213874_10036456
573 Ga0213876_10064638
574 Ga0224712_10071625
575 Ga0224712_10078205
576 Ga0224712_10084326
577 Ga0224712_10118818
578 Ga0207713_1045126
579 Ga0207692_10066670
580 Ga0207688_10027045
581 Ga0207680_10224380
582 Ga0207685_10090585
583 Ga0207699_10048495
584 Ga0207699_10177063
585 Ga0207645_10036502
586 Ga0207643_10000876
587 Ga0207705_10016503
588 Ga0207705_10273021
589 Ga0207654_10090645
590 Ga0207707_10007501
591 Ga0207707_10023432
592 Ga0207707_10026667
593 Ga0207707_10169422
594 Ga0207695_10069304
595 Ga0207671_10059482
596 Ga0207671_10153177
597 Ga0207693_10001195
598 Ga0207693_10173110
599 Ga0207693_10339445
600 Ga0207663_10070019
601 Ga0207660_10031194
602 Ga0207660_10058397
603 Ga0207660_10059576
604 Ga0207660_10393983
605 Ga0207662_10081679
606 Ga0207657_10013048
607 Ga0207657_10027939
608 Ga0207649_10034464
609 Ga0207649_10056709
610 Ga0207652_10004663
611 Ga0207652_10016661
612 Ga0207652_10023017
613 Ga0207652_10043856
614 Ga0207650_10006410
615 Ga0207687_10077336
616 Ga0207700_10138324
617 Ga0207700_10272379
618 Ga0207700_10348393
619 Ga0207664_10008923
620 Ga0207664_10047850
621 Ga0207664_10143829
622 Ga0207664_10193112
623 Ga0207690_10087340
624 Ga0207690_10148573
625 Ga0207706_10018437
626 Ga0207709_10021268
627 Ga0207665_10118420
628 Ga0207691_10084733
629 Ga0207711_10242638
630 Ga0207689_10009873
631 Ga0207661_10004185
632 Ga0207661_10007933
633 Ga0207679_10005345
634 Ga0207679_10139523
635 Ga0207679_10637721
636 Ga0207667_10380850
637 Ga0207667_10607317
638 Ga0207651_10331519
639 Ga0207640_10118817
640 Ga0207658_10114208
641 Ga0207677_10128869
642 Ga0207703_10039814
643 Ga0207639_10110964
644 Ga0207678_10003135
645 Ga0207708_10017214
646 Ga0207702_10005255
647 Ga0207702_10012103
648 Ga0207702_10155636
649 Ga0207641_10011039
650 Ga0207648_10102412
651 Ga0207676_10006348
652 Ga0207674_10016795
653 Ga0207674_10152644
654 Ga0207683_10005870
655 Ga0207698_10002923
656 Ga0207428_10019405
657 Ga0207428_10035644
658 Ga0207428_10195008
659 Ga0268266_10030828
660 Ga0268264_10059808
661 Ga0265337_1003657
662 Ga0265326_10008437
663 Ga0265319_1015829
664 Ga0265334_10002422
665 Ga0265318_10025405
666 Ga0265322_10021048
667 Ga0265336_10020637
668 Ga0265338_10003193
669 Ga0265324_10016738
670 Ga0265332_10003653
671 Ga0265320_10132579
672 Ga0307513_10157007
673 Ga0265314_10053738
674 Ga0326468_10003476
675 Ga0316214_1001850
676 Ga0373948_0015733
677 Ga0373958_0004671
678 Ga0373934_0010530
679 Ga0373940_0006246
680 Ga0373923_0057303
681 Ga0373939_0025756
682 Ga0373962_0055363
683 Ga0373931_0286856
684 Ga0373935_0002659
685 Ga0373933_0004400
686 Ga0373947_0000001
687 Ga0373937_0014972
688 Ga0373937_0087933
689 Ga0373925_0000010
690 Ga0373925_0150919
691 Ga0436364_0346073
692 Ga0436364_0409665
693 Ga0395901_0006014
694 Ga0395901_0141763
695 Ga0395901_0567838
696 Ga0436365_0696108
697 Ga0436365_0700491
698 Ga0436365_0832259
699 Ga0436365_0984403
700 Ga0436365_1354371
701 Ga0436365_1434344
702 Ga0436365_1529010
703 Ga0436363_0267133
704 Ga0436363_0664067
705 Ga0436362_1236243
706 Ga0439441_001301
707 Ga0439448_0006280
708 Ga0439463_018523
709 Ga0466966_0044273
710 Ga0466966_0062710
711 Ga0466961_0146135
712 Ga0466963_0062341
713 Ga0466963_0157968
714 Ga0466971_0033332
715 Ga0466971_0148775
716 Ga0466968_0083879
717 Ga0466968_0103606
718 Ga0466970_0059727
719 Ga0466970_0111484
720 Ga0466957_0030120
721 Ga0466957_0128615
722 Ga0466960_0001959
723 Ga0466960_0028432
724 Ga0466959_0032657
725 Ga0466959_0110778
726 Ga0451576_0440597
727 Ga0466958_0008449
728 Ga0466958_0311917
729 Ga0466967_0035826
730 Ga0466967_0043978
731 Ga0466967_0082643
732 Ga0466967_0171627
733 Ga0466967_0406566
734 Ga0495592_0022975
735 Ga0495629_0038052
736 Ga0495651_0012340
737 Ga0495651_0017556
738 Ga0495653_0006140
739 Ga0495653_0071855
740 Ga0495594_0077459
741 Ga0495608_0001421
742 Ga0495608_0038221
743 Ga0495618_0287278
744 Ga0495628_0004895
745 Ga0495628_0053657
746 Ga0495630_0016195
747 Ga0495630_0123827
748 Ga0495666_0015901
749 Ga0495652_0071766
750 Ga0495652_0134066
751 Ga0495665_0061952
752 Ga0495640_0034624
753 Ga0495640_0049443
754 Ga0495586_0095696
755 Ga0495587_0005141
756 Ga0495587_0007390
757 Ga0495667_0039740
758 Ga0495635_0006002
759 Ga0495635_0026197
760 Ga0495635_0028268
761 Ga0495657_0032539
762 Ga0495599_0012091
763 Ga0495599_0177733
764 Ga0495599_0320587
765 Ga0495623_0030827
766 Ga0495623_0226140
767 Ga0495646_0037326
768 Ga0495646_0268572
769 Ga0495613_0030075
770 Ga0495600_0028548
771 Ga0495600_0127546
772 Ga0495604_0006180
773 Ga0495604_0029491
774 Ga0495674_0023522
775 Ga0495674_0090032
776 Ga0495674_0167623
777 Ga0495676_0214575
778 Ga0495680_0007284
779 Ga0495684_0028753
780 Ga0495684_0071234
781 Ga0495684_0146902
782 Ga0495602_0003268
783 Ga0495602_0021863
784 Ga0495614_0030476
785 Ga0496100_0012988
786 Ga0496101_0016918
787 Ga0496102_0004271
788 Ga0496102_0081681
789 Ga0496103_0091634
790 Ga0496103_0140393
791 Ga0496104_0024567
792 Ga0496104_0068107
793 Ga0496104_0131666
794 Ga0496105_0007128
795 Ga0496105_0039219
796 Ga0496105_0163862
797 Ga0496106_0008102
798 Ga0496106_0027428
799 Ga0496107_0022361
800 Ga0496107_0080407
801 Ga0496108_0001197
802 Ga0496108_0046751
803 Ga0496109_0005545
804 Ga0496109_0113216
805 Ga0496109_0443286
806 Ga0496110_0000358
807 Ga0496110_0007764
808 Ga0496111_0003187
809 Ga0496111_0090910
810 Ga0496112_0005036
811 Ga0496112_0079373
812 Ga0496112_0219729
813 Ga0496112_0229329
814 Ga0496113_0015470
815 Ga0496113_0036210
816 Ga0496114_0038361
817 Ga0496115_0036169
818 Ga0496115_0065619
819 nmdc:mga05p37_226334_c1
820 nmdc:mga05p37_312421_c1
821 nmdc:mga05p37_69444_c1
822 nmdc:mga05p37_77_c1
823 nmdc:mga09592_140_c1
824 nmdc:mga08y16_74000_c1
825 nmdc:mga08y16_81706_c1
826 nmdc:mga0n895_30481_c1
827 nmdc:mga0rr50_32116_c1
828 nmdc:mga08x19_128107_c1
829 nmdc:mga08x19_7483_c1
830 nmdc:mga0a205_100203_c1
831 nmdc:mga0a205_33770_c1
832 nmdc:mga0a205_376801_c1
833 Ga0495612_0107849
834 Ga0495595_0003719
835 Ga0495619_0011435
836 Ga0495619_0195171
837 Ga0466962_0176532
838 2558912924
839 2870786865
840 8054473782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.7202 2 293
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.7048 2 293
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.6906 2 278
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.6863 2 293
6det-assembly1.cif.gz_A the crystal structure of tv2483 bound to l-arginine 0.6852 84 231
ID Description Score Start End Superfamily
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8726 99 188 3.40.190.10
2de4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.8256 99 188 3.40.190.270
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.786 99 188 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7729 98 188 3.40.190.10
1zbmA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7635 90 188 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2D7D9S0-F1-model_v4 ABC transporter substrate-binding protein 0.9673 65 293
AF-A0A317J1M6-F1-model_v4 ABC transporter substrate-binding protein 0.9629 95 293
AF-A0A2D7D9S0-F1-model_v4 ABC transporter substrate-binding protein 0.9591 65 293
AF-A0A558AFE2-F1-model_v4 ABC transporter substrate-binding protein 0.9529 1 293
AF-A0A558AFE2-F1-model_v4 ABC transporter substrate-binding protein 0.9497 1 293

Map