F439780

General Info

Members Datasets Scaffolds Average Seq Length
420 240 840 191

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0219249|Ga0373927_0219249_74_682
Length 202
Sequence MYACASPSFEEFMAALIDAITVKRKTFFEFENTPFCCLEADVNTPTARGGQTLVRLKMRNLLTNAVFEKTFKASDKFKEPDLDSVQASYLYSDGDGSHFLDQESYETITLNRQMVGDALDFLIEGALIELRKFNGNPIGLELPIFVELDVAYTEPAVRGDSSGGATKTARLETGLEIRVPLFIKEGEKVKVSTETREFAGRA

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
76 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 2.14
Rhizosphere 96.19
Stem 0
Stem Tuber 0
Unclassified 15.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0219249 3300035695 Bacteria 1250
2 Ga0065712_10195358 3300005290 Bacteria 1130
3 Ga0065715_10123215 3300005293 Bacteria 2183
4 Ga0065707_10007886 3300005295 Bacteria 3280
5 Ga0070658_10457587 3300005327 Bacteria 1100
6 Ga0070666_10450426 3300005335 Bacteria 929
7 Ga0068868_100034262 3300005338 Bacteria 3919
8 Ga0068868_100717402 3300005338 Bacteria 896
9 Ga0070660_100004000 3300005339 Bacteria 10175
10 Ga0070689_100515598 3300005340 Bacteria 1026
11 Ga0070661_100213420 3300005344 Bacteria 1478
12 Ga0070668_100281543 3300005347 Bacteria 1389
13 Ga0070675_100262126 3300005354 Bacteria 1515
14 Ga0070671_100254989 3300005355 Bacteria 1490
15 Ga0070674_100032698 3300005356 Bacteria 3455
16 Ga0070674_100251154 3300005356 Unclassified 1389
17 Ga0070674_100763068 3300005356 Bacteria 832
18 Ga0070688_100144193 3300005365 Bacteria 1621
19 Ga0070667_100943558 3300005367 Unclassified 804
20 Ga0070709_10065466 3300005434 Bacteria 2328
21 Ga0070709_10092153 3300005434 Unclassified 2001
22 Ga0070714_100165864 3300005435 Bacteria 2002
23 Ga0070714_100186628 3300005435 Bacteria 1890
24 Ga0070713_100015666 3300005436 Bacteria 5679
25 Ga0070713_100247185 3300005436 Bacteria 1626
26 Ga0070713_100385457 3300005436 Bacteria 1306
27 Ga0070713_100415274 3300005436 Bacteria 1259
28 Ga0070713_101123635 3300005436 Bacteria 760
29 Ga0070711_100156295 3300005439 Bacteria 1724
30 Ga0070711_100175483 3300005439 Bacteria 1637
31 Ga0070711_100178453 3300005439 Bacteria 1624
32 Ga0070711_100252746 3300005439 Bacteria 1383
33 Ga0070708_100164051 3300005445 Unclassified 2072
34 Ga0070663_100508497 3300005455 Bacteria 1001
35 Ga0070681_10025046 3300005458 Bacteria 6004
36 Ga0070681_10049434 3300005458 Bacteria 4199
37 Ga0068867_100145464 3300005459 Bacteria 1857
38 Ga0068867_100187889 3300005459 Bacteria 1647
39 Ga0070685_10683719 3300005466 Unclassified 747
40 Ga0070707_100073830 3300005468 Unclassified 3289
41 Ga0070707_100570652 3300005468 Bacteria 1094
42 Ga0070679_100004730 3300005530 Bacteria 12558
43 Ga0070684_100122944 3300005535 Bacteria 2336
44 Ga0070684_100163968 3300005535 Bacteria 2017
45 Ga0070684_101178823 3300005535 Bacteria 720
46 Ga0070684_101268806 3300005535 Bacteria 693
47 Ga0068853_100317409 3300005539 Bacteria 1444
48 Ga0068853_101179237 3300005539 Unclassified 739
49 Ga0068853_101526519 3300005539 Bacteria 647
50 Ga0070665_100470818 3300005548 Bacteria 1267
51 Ga0070665_100655837 3300005548 Bacteria 1062
52 Ga0068855_100232803 3300005563 Bacteria 2062
53 Ga0068855_100369836 3300005563 Bacteria 1576
54 Ga0068855_101655745 3300005563 Bacteria 653
55 Ga0068857_100077071 3300005577 Bacteria 2974
56 Ga0068856_100018599 3300005614 Bacteria 6733
57 Ga0068856_100277887 3300005614 Bacteria 1691
58 Ga0068856_101494470 3300005614 Bacteria 689
59 Ga0068859_100014305 3300005617 Bacteria 7960
60 Ga0068859_100029734 3300005617 Bacteria 5482
61 Ga0068859_101206665 3300005617 Bacteria 833
62 Ga0068864_100055893 3300005618 Bacteria 3410
63 Ga0068864_100113543 3300005618 Bacteria 2415
64 Ga0068864_100164537 3300005618 Bacteria 2019
65 Ga0068863_100151645 3300005841 Bacteria 2218
66 Ga0068863_100340267 3300005841 Bacteria 1459
67 Ga0068858_100001149 3300005842 Bacteria 27360
68 Ga0068858_100112190 3300005842 Bacteria 2546
69 Ga0068858_100943035 3300005842 Bacteria 845
70 Ga0068860_100341823 3300005843 Unclassified 1472
71 Ga0081538_10076158 3300005981 Bacteria 1815
72 Ga0081539_10000106 3300005985 Bacteria 195771
73 Ga0070717_10622157 3300006028 Unclassified 980
74 Ga0070715_10357285 3300006163 Bacteria 800
75 Ga0070715_10386620 3300006163 Bacteria 774
76 Ga0070716_100001462 3300006173 Bacteria 10526
77 Ga0070712_100013409 3300006175 Bacteria 5239
78 Ga0070712_100014815 3300006175 Bacteria 5010
79 Ga0070712_100070043 3300006175 Bacteria 2504
80 Ga0070712_100264378 3300006175 Bacteria 1380
81 Ga0070712_100310245 3300006175 Bacteria 1280
82 Ga0097621_100074495 3300006237 Unclassified 2812
83 Ga0068871_100004894 3300006358 Bacteria 9354
84 Ga0068871_100173094 3300006358 Bacteria 1852
85 Ga0075431_101035300 3300006847 Bacteria 787
86 Ga0068865_100261431 3300006881 Bacteria 1370
87 Ga0068865_100547968 3300006881 Bacteria 971
88 Ga0097620_100014305 3300006931 Bacteria 7960
89 Ga0097620_100029734 3300006931 Bacteria 5482
90 Ga0097620_101207100 3300006931 Bacteria 833
91 Ga0105240_10000025 3300009093 Bacteria 367124
92 Ga0105240_10005858 3300009093 Bacteria 18221
93 Ga0105240_10051093 3300009093 Bacteria 5205
94 Ga0105240_10079811 3300009093 Bacteria 4026
95 Ga0105240_10096618 3300009093 Bacteria 3600
96 Ga0105240_10354828 3300009093 Unclassified 1663
97 Ga0105240_10430653 3300009093 Bacteria 1480
98 Ga0111539_12282209 3300009094 Bacteria 628
99 Ga0105245_10357021 3300009098 Unclassified 1450
100 Ga0105245_10745516 3300009098 Unclassified 1015
101 Ga0105247_10131288 3300009101 Unclassified 1633
102 Ga0105247_10583688 3300009101 Unclassified 826
103 Ga0114129_10000069 3300009147 Bacteria 93426
104 Ga0105242_10206969 3300009176 Bacteria 1746
105 Ga0105242_10230051 3300009176 Bacteria 1661
106 Ga0105248_10022894 3300009177 Bacteria 6937
107 Ga0105248_10037644 3300009177 Bacteria 5412
108 Ga0105248_10352833 3300009177 Bacteria 1656
109 Ga0105248_10379584 3300009177 Bacteria 1591
110 Ga0105248_10417507 3300009177 Unclassified 1511
111 Ga0105248_10490408 3300009177 Bacteria 1385
112 Ga0105248_11268233 3300009177 Bacteria 833
113 Ga0105248_11328427 3300009177 Bacteria 813
114 Ga0105237_10065048 3300009545 Bacteria 3643
115 Ga0105237_10132996 3300009545 Unclassified 2482
116 Ga0105237_10320249 3300009545 Bacteria 1554
117 Ga0105237_10468719 3300009545 Unclassified 1265
118 Ga0105237_10642889 3300009545 Bacteria 1068
119 Ga0105238_10039328 3300009551 Bacteria 4796
120 Ga0105238_10064676 3300009551 Bacteria 3657
121 Ga0105249_10028748 3300009553 Bacteria 5018
122 Ga0105249_10680541 3300009553 Unclassified 1088
123 Ga0105249_11690744 3300009553 Unclassified 705
124 Ga0105239_10277346 3300010375 Bacteria 1887
125 Ga0157373_10385836 3300013100 Unclassified 1002
126 Ga0157371_10178061 3300013102 Bacteria 1520
127 Ga0157370_10003973 3300013104 Bacteria 17197
128 Ga0157370_10073635 3300013104 Bacteria 3223
129 Ga0157370_10180016 3300013104 Bacteria 1964
130 Ga0157370_10434883 3300013104 Unclassified 1207
131 Ga0157369_10035396 3300013105 Bacteria 5475
132 Ga0157369_10058237 3300013105 Bacteria 4167
133 Ga0157369_10505341 3300013105 Unclassified 1250
134 Ga0157374_10006266 3300013296 Bacteria 10088
135 Ga0157374_10009339 3300013296 Bacteria 8412
136 Ga0157374_10041484 3300013296 Bacteria 4242
137 Ga0157378_10013970 3300013297 Bacteria 7025
138 Ga0157378_10382162 3300013297 Bacteria 1383
139 Ga0157378_10788902 3300013297 Bacteria 975
140 Ga0157378_11416975 3300013297 Unclassified 738
141 Ga0163162_10049174 3300013306 Bacteria 4226
142 Ga0163162_10305435 3300013306 Unclassified 1723
143 Ga0157372_10002070 3300013307 Bacteria 21778
144 Ga0157372_10010375 3300013307 Bacteria 9902
145 Ga0157372_10114270 3300013307 Bacteria 3095
146 Ga0157372_10350839 3300013307 Bacteria 1719
147 Ga0157372_10521038 3300013307 Bacteria 1386
148 Ga0157372_10637897 3300013307 Unclassified 1241
149 Ga0157372_10910476 3300013307 Bacteria 1020
150 Ga0157372_11504753 3300013307 Unclassified 775
151 Ga0157375_10137773 3300013308 Bacteria 2566
152 Ga0157375_10632102 3300013308 Bacteria 1228
153 Ga0163163_10025279 3300014325 Bacteria 5662
154 Ga0163163_10665257 3300014325 Unclassified 1105
155 Ga0157379_10023485 3300014968 Bacteria 5473
156 Ga0157379_10347733 3300014968 Bacteria 1357
157 Ga0157379_10379834 3300014968 Bacteria 1296
158 Ga0157376_10080583 3300014969 Bacteria 2793
159 Ga0157376_10356190 3300014969 Bacteria 1402
160 Ga0163161_10574423 3300017792 Bacteria 927
161 Ga0213876_10180732 3300021384 Bacteria 1122
162 Ga0224572_1019960 3300024225 Bacteria 1287
163 Ga0228598_1008668 3300024227 Bacteria 2049
164 Ga0228598_1032166 3300024227 Bacteria 1033
165 Ga0209437_107221 3300025233 Bacteria 1819
166 Ga0209233_1014266 3300025261 Unclassified 2243
167 Ga0207710_10396887 3300025900 Unclassified 707
168 Ga0207688_10082027 3300025901 Bacteria 1842
169 Ga0207647_10114300 3300025904 Bacteria 1595
170 Ga0207685_10024416 3300025905 Bacteria 2072
171 Ga0207699_10051201 3300025906 Unclassified 2439
172 Ga0207705_10227961 3300025909 Bacteria 1416
173 Ga0207707_10012791 3300025912 Bacteria 7300
174 Ga0207707_10026910 3300025912 Bacteria 5027
175 Ga0207695_10000025 3300025913 Bacteria 627211
176 Ga0207695_10054306 3300025913 Unclassified 4185
177 Ga0207695_10156820 3300025913 Bacteria 2211
178 Ga0207695_10194974 3300025913 Bacteria 1942
179 Ga0207671_10086730 3300025914 Bacteria 2353
180 Ga0207671_10172548 3300025914 Bacteria 1680
181 Ga0207671_10347744 3300025914 Bacteria 1175
182 Ga0207671_10542102 3300025914 Bacteria 927
183 Ga0207693_10012098 3300025915 Bacteria 6977
184 Ga0207693_10039435 3300025915 Bacteria 3720
185 Ga0207693_10102714 3300025915 Bacteria 2242
186 Ga0207693_10130564 3300025915 Bacteria 1975
187 Ga0207693_10133716 3300025915 Bacteria 1950
188 Ga0207693_10278572 3300025915 Bacteria 1310
189 Ga0207693_10305594 3300025915 Bacteria 1246
190 Ga0207663_10010064 3300025916 Bacteria 5015
191 Ga0207663_10058386 3300025916 Bacteria 2435
192 Ga0207663_10156814 3300025916 Bacteria 1602
193 Ga0207663_10218716 3300025916 Bacteria 1385
194 Ga0207657_10000521 3300025919 Bacteria 40692
195 Ga0207649_10844809 3300025920 Bacteria 716
196 Ga0207652_10000826 3300025921 Bacteria 29506
197 Ga0207652_10008738 3300025921 Bacteria 8153
198 Ga0207646_10020509 3300025922 Bacteria 6123
199 Ga0207694_10039150 3300025924 Bacteria 3647
200 Ga0207694_10294054 3300025924 Bacteria 1336
201 Ga0207694_10713405 3300025924 Unclassified 846
202 Ga0207659_10908777 3300025926 Bacteria 757
203 Ga0207687_10351282 3300025927 Unclassified 1201
204 Ga0207700_10010298 3300025928 Bacteria 5890
205 Ga0207700_10754186 3300025928 Unclassified 870
206 Ga0207664_10823366 3300025929 Bacteria 835
207 Ga0207664_10981313 3300025929 Bacteria 757
208 Ga0207644_10300606 3300025931 Bacteria 1293
209 Ga0207706_10491753 3300025933 Bacteria 1059
210 Ga0207686_10637457 3300025934 Unclassified 842
211 Ga0207670_10404415 3300025936 Bacteria 1092
212 Ga0207669_10002051 3300025937 Bacteria 8527
213 Ga0207704_10243883 3300025938 Unclassified 1344
214 Ga0207665_10015604 3300025939 Bacteria 4985
215 Ga0207665_10018691 3300025939 Unclassified 4554
216 Ga0207665_10127733 3300025939 Bacteria 1801
217 Ga0207691_10024503 3300025940 Bacteria 5674
218 Ga0207691_10634075 3300025940 Bacteria 904
219 Ga0207711_10074406 3300025941 Bacteria 2954
220 Ga0207711_10152286 3300025941 Bacteria 2087
221 Ga0207711_10367522 3300025941 Unclassified 1334
222 Ga0207711_10845604 3300025941 Bacteria 852
223 Ga0207711_11017119 3300025941 Unclassified 768
224 Ga0207689_10008120 3300025942 Bacteria 9155
225 Ga0207661_10057434 3300025944 Bacteria 3129
226 Ga0207661_10192432 3300025944 Bacteria 1789
227 Ga0207661_10252436 3300025944 Bacteria 1568
228 Ga0207667_10002557 3300025949 Bacteria 22626
229 Ga0207667_10322557 3300025949 Bacteria 1577
230 Ga0207712_10044355 3300025961 Bacteria 3073
231 Ga0207712_10053677 3300025961 Bacteria 2828
232 Ga0207677_10207183 3300026023 Unclassified 1563
233 Ga0207703_10025066 3300026035 Bacteria 4691
234 Ga0207703_10376500 3300026035 Bacteria 1312
235 Ga0207703_11128081 3300026035 Bacteria 753
236 Ga0207639_10994928 3300026041 Unclassified 785
237 Ga0207678_10122602 3300026067 Bacteria 2218
238 Ga0207702_10202408 3300026078 Bacteria 1841
239 Ga0207641_10120851 3300026088 Bacteria 2337
240 Ga0207648_10174223 3300026089 Bacteria 1902
241 Ga0207648_10229649 3300026089 Bacteria 1651
242 Ga0207676_10107565 3300026095 Unclassified 2326
243 Ga0207676_10251072 3300026095 Bacteria 1592
244 Ga0207674_10279485 3300026116 Bacteria 1617
245 Ga0207674_10687244 3300026116 Bacteria 988
246 Ga0207675_100194704 3300026118 Bacteria 1945
247 Ga0207683_10029677 3300026121 Bacteria 4736
248 Ga0207698_10046296 3300026142 Bacteria 3284
249 Ga0268266_10609030 3300028379 Bacteria 1049
250 Ga0268264_10951113 3300028381 Bacteria 864
251 Ga0265336_10003404 3300028666 Bacteria 6240
252 Ga0265338_10063148 3300028800 Bacteria 3231
253 Ga0265338_10213980 3300028800 Unclassified 1444
254 Ga0265330_10001452 3300031235 Bacteria 13815
255 Ga0265332_10009479 3300031238 Bacteria 4344
256 Ga0265328_10008305 3300031239 Unclassified 4288
257 Ga0265325_10001471 3300031241 Bacteria 16577
258 Ga0265325_10143535 3300031241 Unclassified 1134
259 Ga0265329_10105043 3300031242 Bacteria 901
260 Ga0265340_10006365 3300031247 Bacteria 6507
261 Ga0265339_10003038 3300031249 Bacteria 11821
262 Ga0265327_10006096 3300031251 Bacteria 9772
263 Ga0265316_10016941 3300031344 Bacteria 6309
264 Ga0265316_10221663 3300031344 Unclassified 1395
265 Ga0265313_10003370 3300031595 Bacteria 13008
266 Ga0265314_10000028 3300031711 Bacteria 278016
267 Ga0265314_10009647 3300031711 Bacteria 8130
268 Ga0265342_10001560 3300031712 Bacteria 21198
269 Ga0373951_0004936 3300035091 Bacteria 3128
270 Ga0373957_0277542 3300035120 Unclassified 708
271 Ga0373955_0081744 3300035172 Bacteria 1827
272 Ga0373931_0185990 3300035691 Bacteria 1233
273 Ga0373937_0131513 3300036401 Bacteria 2337
274 Ga0373937_0229142 3300036401 Bacteria 1749
275 Ga0373937_0815182 3300036401 Bacteria 881
276 Ga0395901_0442806 3300038443 Bacteria 1330
277 Ga0439433_0107960 3300041999 Unclassified 695
278 Ga0439464_0007001 3300042439 Unclassified 2946
279 Ga0451577_0000591 3300042876 Bacteria 58202
280 Ga0451577_0675265 3300042876 Bacteria 936
281 Ga0439440_0114218 3300042993 Bacteria 746
282 Ga0466963_0115693 3300044694 Unclassified 1843
283 Ga0453684_0000252 3300044712 Bacteria 231665
284 Ga0453684_0091640 3300044712 Bacteria 3751
285 Ga0451576_0047560 3300045051 Bacteria 4509
286 Ga0466967_0602819 3300045976 Unclassified 1084
287 Ga0495592_0044129 3300046454 Unclassified 3332
288 Ga0495592_0264518 3300046454 Bacteria 1131
289 Ga0495629_0047642 3300046459 Bacteria 3007
290 Ga0495651_0045439 3300046462 Bacteria 3402
291 Ga0495651_0194437 3300046462 Bacteria 1425
292 Ga0495653_0022502 3300046463 Bacteria 5100
293 Ga0495653_0145228 3300046463 Unclassified 1663
294 Ga0495580_0000352 3300046472 Bacteria 37485
295 Ga0495580_0007649 3300046472 Bacteria 8667
296 Ga0495580_0117900 3300046472 Bacteria 1843
297 Ga0495580_0527922 3300046472 Unclassified 786
298 Ga0495582_0003357 3300046473 Bacteria 9004
299 Ga0495639_0008447 3300046475 Bacteria 4418
300 Ga0495662_0002428 3300046476 Bacteria 9367
301 Ga0495662_0003019 3300046476 Bacteria 8491
302 Ga0495664_0004370 3300046477 Bacteria 7730
303 Ga0495664_0004492 3300046477 Bacteria 7633
304 Ga0495594_0011059 3300046499 Bacteria 4688
305 Ga0495606_0081682 3300046507 Bacteria 2009
306 Ga0495608_0039983 3300046511 Bacteria 3142
307 Ga0495628_0016626 3300046516 Bacteria 6133
308 Ga0495630_0034685 3300046517 Bacteria 3768
309 Ga0495630_0488065 3300046517 Unclassified 945
310 Ga0495663_0231538 3300046525 Bacteria 652
311 Ga0495666_0005136 3300046526 Bacteria 6619
312 Ga0495666_0277170 3300046526 Unclassified 761
313 Ga0495652_0006574 3300046529 Bacteria 10800
314 Ga0495652_0041392 3300046529 Bacteria 3977
315 Ga0495652_0365334 3300046529 Bacteria 1030
316 Ga0495665_0009461 3300046531 Bacteria 5274
317 Ga0495640_0018524 3300046533 Bacteria 5158
318 Ga0495640_0035097 3300046533 Bacteria 3551
319 Ga0495586_0009972 3300046535 Bacteria 5060
320 Ga0495587_0032186 3300046536 Unclassified 3171
321 Ga0495645_0004029 3300046543 Bacteria 10034
322 Ga0495645_0018090 3300046543 Bacteria 5057
323 Ga0495633_0244694 3300046558 Unclassified 819
324 Ga0495667_0014264 3300046559 Bacteria 5367
325 Ga0495667_0024182 3300046559 Unclassified 4091
326 Ga0495634_0005580 3300046642 Bacteria 9654
327 Ga0495634_0008351 3300046642 Bacteria 7718
328 Ga0495635_0007277 3300046663 Bacteria 7733
329 Ga0495635_0107184 3300046663 Unclassified 1908
330 Ga0495635_0390519 3300046663 Unclassified 925
331 Ga0495661_0441032 3300046665 Bacteria 628
332 Ga0495657_0808077 3300046675 Bacteria 536
333 Ga0495599_0003988 3300046678 Bacteria 8697
334 Ga0495599_0020676 3300046678 Bacteria 4101
335 Ga0495646_0019118 3300046680 Bacteria 4337
336 Ga0495646_0341423 3300046680 Unclassified 786
337 Ga0495613_0028471 3300046689 Unclassified 4155
338 Ga0495613_0090046 3300046689 Bacteria 2222
339 Ga0495624_0007928 3300046690 Bacteria 7449
340 Ga0495600_0005600 3300046809 Bacteria 7583
341 Ga0495600_0008363 3300046809 Bacteria 6354
342 Ga0495581_0008386 3300047315 Bacteria 5990
343 Ga0495581_0524214 3300047315 Unclassified 688
344 Ga0495604_0005826 3300047317 Bacteria 9769
345 Ga0495604_0016375 3300047317 Bacteria 5926
346 Ga0495604_0179286 3300047317 Bacteria 1483
347 Ga0495674_0021827 3300047319 Bacteria 5914
348 Ga0495674_0148454 3300047319 Bacteria 1967
349 Ga0495672_0003932 3300047320 Bacteria 12459
350 Ga0495680_0010815 3300047322 Bacteria 8125
351 Ga0495675_0007400 3300047444 Bacteria 6760
352 Ga0495675_0018264 3300047444 Bacteria 4451
353 Ga0495684_0006562 3300047471 Bacteria 9023
354 Ga0495684_0021733 3300047471 Bacteria 4941
355 Ga0495686_0000009 3300047472 Bacteria 661643
356 Ga0495686_0002016 3300047472 Bacteria 20079
357 Ga0495593_0016640 3300047673 Bacteria 4145
358 Ga0495593_0258430 3300047673 Bacteria 872
359 Ga0495614_0002252 3300048089 Bacteria 8556
360 Ga0496104_0000019 3300048907 Bacteria 249440
361 Ga0496104_0196227 3300048907 Bacteria 1931
362 Ga0496105_0262292 3300048908 Bacteria 1397
363 Ga0496106_0155221 3300048909 Bacteria 1807
364 Ga0496106_0520457 3300048909 Unclassified 955
365 Ga0496112_0033405 3300048915 Bacteria 5002
366 Ga0496112_0161027 3300048915 Bacteria 2211
367 Ga0496112_0760611 3300048915 Bacteria 895
368 Ga0496113_0105092 3300048916 Bacteria 2192
369 Ga0496126_0000029 3300048929 Bacteria 389370
370 Ga0496126_0005906 3300048929 Bacteria 13805
371 Ga0501031_0001972 3300049568 Bacteria 12962
372 Ga0501032_0065935 3300049569 Bacteria 2420
373 Ga0501032_0673068 3300049569 Bacteria 657
374 Ga0501033_0020621 3300049570 Bacteria 4980
375 Ga0501034_0052679 3300049571 Bacteria 4099
376 Ga0501036_0101609 3300049572 Bacteria 2432
377 Ga0501037_0019744 3300049573 Bacteria 4972
378 Ga0501037_0293331 3300049573 Bacteria 1131
379 Ga0501038_0011067 3300049574 Bacteria 8239
380 Ga0501038_0334602 3300049574 Bacteria 1182
381 Ga0501039_0021538 3300049575 Bacteria 4944
382 Ga0501040_0616221 3300049576 Bacteria 784
383 Ga0501042_0022617 3300049578 Bacteria 4392
384 Ga0501043_0094770 3300049579 Bacteria 2346
385 Ga0501043_0109930 3300049579 Bacteria 2164
386 Ga0501046_0004593 3300049580 Bacteria 12468
387 Ga0501047_0032223 3300049581 Bacteria 5058
388 Ga0501048_0011162 3300049582 Bacteria 6698
389 Ga0501067_0005169 3300049583 Bacteria 7255
390 Ga0501068_0003779 3300049584 Bacteria 8203
391 Ga0501069_0017382 3300049585 Bacteria 3869
392 Ga0501069_0018142 3300049585 Bacteria 3795
393 Ga0501070_0018941 3300049586 Bacteria 5773
394 Ga0501070_0354331 3300049586 Bacteria 1191
395 Ga0501071_0134401 3300049587 Bacteria 1839
396 Ga0501072_0081431 3300049588 Bacteria 2566
397 Ga0501073_0028546 3300049589 Bacteria 3987
398 Ga0501074_0080161 3300049590 Bacteria 2342
399 Ga0501074_0243970 3300049590 Bacteria 1278
400 Ga0501076_0110045 3300049592 Bacteria 2227
401 Ga0501079_0013412 3300049741 Bacteria 6250
402 Ga0501080_0109071 3300049742 Bacteria 2565
403 Ga0501083_0032397 3300049744 Bacteria 3584
404 Ga0501035_0014689 3300049822 Bacteria 7228
405 Ga0501035_0079655 3300049822 Bacteria 2893
406 Ga0501044_0001012 3300049823 Bacteria 33764
407 Ga0501044_0112885 3300049823 Bacteria 2724
408 Ga0501044_0324880 3300049823 Bacteria 1462
409 Ga0501045_0048138 3300049824 Bacteria 3107
410 nmdc:mga05p37_395_c1 3300050507 Bacteria 47304
411 nmdc:mga05p37_644615_c1 3300050507 Unclassified 1187
412 Ga0500595_000049 3300053119 Bacteria 88728
413 Ga0500559_0124678 3300053136 Bacteria 1200
414 Ga0501084_0013224 3300054114 Bacteria 6830
415 Ga0590071_000015 3300059421 Bacteria 45213
416 Ga0590074_000964 3300059423 Bacteria 4514
417 Ga0590075_000781 3300059424 Bacteria 8374
418 Ga0590077_000188 3300059426 Bacteria 17667
419 Ga0501082_0027061 3300060353 Bacteria 4941
420 Ga0501082_0827449 3300060353 Bacteria 810
421 Ga0373927_0219249
422 Ga0065712_10195358
423 Ga0065715_10123215
424 Ga0065707_10007886
425 Ga0070658_10457587
426 Ga0070666_10450426
427 Ga0068868_100034262
428 Ga0068868_100717402
429 Ga0070660_100004000
430 Ga0070689_100515598
431 Ga0070661_100213420
432 Ga0070668_100281543
433 Ga0070675_100262126
434 Ga0070671_100254989
435 Ga0070674_100032698
436 Ga0070674_100251154
437 Ga0070674_100763068
438 Ga0070688_100144193
439 Ga0070667_100943558
440 Ga0070709_10065466
441 Ga0070709_10092153
442 Ga0070714_100165864
443 Ga0070714_100186628
444 Ga0070713_100015666
445 Ga0070713_100247185
446 Ga0070713_100385457
447 Ga0070713_100415274
448 Ga0070713_101123635
449 Ga0070711_100156295
450 Ga0070711_100175483
451 Ga0070711_100178453
452 Ga0070711_100252746
453 Ga0070708_100164051
454 Ga0070663_100508497
455 Ga0070681_10025046
456 Ga0070681_10049434
457 Ga0068867_100145464
458 Ga0068867_100187889
459 Ga0070685_10683719
460 Ga0070707_100073830
461 Ga0070707_100570652
462 Ga0070679_100004730
463 Ga0070684_100122944
464 Ga0070684_100163968
465 Ga0070684_101178823
466 Ga0070684_101268806
467 Ga0068853_100317409
468 Ga0068853_101179237
469 Ga0068853_101526519
470 Ga0070665_100470818
471 Ga0070665_100655837
472 Ga0068855_100232803
473 Ga0068855_100369836
474 Ga0068855_101655745
475 Ga0068857_100077071
476 Ga0068856_100018599
477 Ga0068856_100277887
478 Ga0068856_101494470
479 Ga0068859_100014305
480 Ga0068859_100029734
481 Ga0068859_101206665
482 Ga0068864_100055893
483 Ga0068864_100113543
484 Ga0068864_100164537
485 Ga0068863_100151645
486 Ga0068863_100340267
487 Ga0068858_100001149
488 Ga0068858_100112190
489 Ga0068858_100943035
490 Ga0068860_100341823
491 Ga0081538_10076158
492 Ga0081539_10000106
493 Ga0070717_10622157
494 Ga0070715_10357285
495 Ga0070715_10386620
496 Ga0070716_100001462
497 Ga0070712_100013409
498 Ga0070712_100014815
499 Ga0070712_100070043
500 Ga0070712_100264378
501 Ga0070712_100310245
502 Ga0097621_100074495
503 Ga0068871_100004894
504 Ga0068871_100173094
505 Ga0075431_101035300
506 Ga0068865_100261431
507 Ga0068865_100547968
508 Ga0097620_100014305
509 Ga0097620_100029734
510 Ga0097620_101207100
511 Ga0105240_10000025
512 Ga0105240_10005858
513 Ga0105240_10051093
514 Ga0105240_10079811
515 Ga0105240_10096618
516 Ga0105240_10354828
517 Ga0105240_10430653
518 Ga0111539_12282209
519 Ga0105245_10357021
520 Ga0105245_10745516
521 Ga0105247_10131288
522 Ga0105247_10583688
523 Ga0114129_10000069
524 Ga0105242_10206969
525 Ga0105242_10230051
526 Ga0105248_10022894
527 Ga0105248_10037644
528 Ga0105248_10352833
529 Ga0105248_10379584
530 Ga0105248_10417507
531 Ga0105248_10490408
532 Ga0105248_11268233
533 Ga0105248_11328427
534 Ga0105237_10065048
535 Ga0105237_10132996
536 Ga0105237_10320249
537 Ga0105237_10468719
538 Ga0105237_10642889
539 Ga0105238_10039328
540 Ga0105238_10064676
541 Ga0105249_10028748
542 Ga0105249_10680541
543 Ga0105249_11690744
544 Ga0105239_10277346
545 Ga0157373_10385836
546 Ga0157371_10178061
547 Ga0157370_10003973
548 Ga0157370_10073635
549 Ga0157370_10180016
550 Ga0157370_10434883
551 Ga0157369_10035396
552 Ga0157369_10058237
553 Ga0157369_10505341
554 Ga0157374_10006266
555 Ga0157374_10009339
556 Ga0157374_10041484
557 Ga0157378_10013970
558 Ga0157378_10382162
559 Ga0157378_10788902
560 Ga0157378_11416975
561 Ga0163162_10049174
562 Ga0163162_10305435
563 Ga0157372_10002070
564 Ga0157372_10010375
565 Ga0157372_10114270
566 Ga0157372_10350839
567 Ga0157372_10521038
568 Ga0157372_10637897
569 Ga0157372_10910476
570 Ga0157372_11504753
571 Ga0157375_10137773
572 Ga0157375_10632102
573 Ga0163163_10025279
574 Ga0163163_10665257
575 Ga0157379_10023485
576 Ga0157379_10347733
577 Ga0157379_10379834
578 Ga0157376_10080583
579 Ga0157376_10356190
580 Ga0163161_10574423
581 Ga0213876_10180732
582 Ga0224572_1019960
583 Ga0228598_1008668
584 Ga0228598_1032166
585 Ga0209437_107221
586 Ga0209233_1014266
587 Ga0207710_10396887
588 Ga0207688_10082027
589 Ga0207647_10114300
590 Ga0207685_10024416
591 Ga0207699_10051201
592 Ga0207705_10227961
593 Ga0207707_10012791
594 Ga0207707_10026910
595 Ga0207695_10000025
596 Ga0207695_10054306
597 Ga0207695_10156820
598 Ga0207695_10194974
599 Ga0207671_10086730
600 Ga0207671_10172548
601 Ga0207671_10347744
602 Ga0207671_10542102
603 Ga0207693_10012098
604 Ga0207693_10039435
605 Ga0207693_10102714
606 Ga0207693_10130564
607 Ga0207693_10133716
608 Ga0207693_10278572
609 Ga0207693_10305594
610 Ga0207663_10010064
611 Ga0207663_10058386
612 Ga0207663_10156814
613 Ga0207663_10218716
614 Ga0207657_10000521
615 Ga0207649_10844809
616 Ga0207652_10000826
617 Ga0207652_10008738
618 Ga0207646_10020509
619 Ga0207694_10039150
620 Ga0207694_10294054
621 Ga0207694_10713405
622 Ga0207659_10908777
623 Ga0207687_10351282
624 Ga0207700_10010298
625 Ga0207700_10754186
626 Ga0207664_10823366
627 Ga0207664_10981313
628 Ga0207644_10300606
629 Ga0207706_10491753
630 Ga0207686_10637457
631 Ga0207670_10404415
632 Ga0207669_10002051
633 Ga0207704_10243883
634 Ga0207665_10015604
635 Ga0207665_10018691
636 Ga0207665_10127733
637 Ga0207691_10024503
638 Ga0207691_10634075
639 Ga0207711_10074406
640 Ga0207711_10152286
641 Ga0207711_10367522
642 Ga0207711_10845604
643 Ga0207711_11017119
644 Ga0207689_10008120
645 Ga0207661_10057434
646 Ga0207661_10192432
647 Ga0207661_10252436
648 Ga0207667_10002557
649 Ga0207667_10322557
650 Ga0207712_10044355
651 Ga0207712_10053677
652 Ga0207677_10207183
653 Ga0207703_10025066
654 Ga0207703_10376500
655 Ga0207703_11128081
656 Ga0207639_10994928
657 Ga0207678_10122602
658 Ga0207702_10202408
659 Ga0207641_10120851
660 Ga0207648_10174223
661 Ga0207648_10229649
662 Ga0207676_10107565
663 Ga0207676_10251072
664 Ga0207674_10279485
665 Ga0207674_10687244
666 Ga0207675_100194704
667 Ga0207683_10029677
668 Ga0207698_10046296
669 Ga0268266_10609030
670 Ga0268264_10951113
671 Ga0265336_10003404
672 Ga0265338_10063148
673 Ga0265338_10213980
674 Ga0265330_10001452
675 Ga0265332_10009479
676 Ga0265328_10008305
677 Ga0265325_10001471
678 Ga0265325_10143535
679 Ga0265329_10105043
680 Ga0265340_10006365
681 Ga0265339_10003038
682 Ga0265327_10006096
683 Ga0265316_10016941
684 Ga0265316_10221663
685 Ga0265313_10003370
686 Ga0265314_10000028
687 Ga0265314_10009647
688 Ga0265342_10001560
689 Ga0373951_0004936
690 Ga0373957_0277542
691 Ga0373955_0081744
692 Ga0373931_0185990
693 Ga0373937_0131513
694 Ga0373937_0229142
695 Ga0373937_0815182
696 Ga0395901_0442806
697 Ga0439433_0107960
698 Ga0439464_0007001
699 Ga0451577_0000591
700 Ga0451577_0675265
701 Ga0439440_0114218
702 Ga0466963_0115693
703 Ga0453684_0000252
704 Ga0453684_0091640
705 Ga0451576_0047560
706 Ga0466967_0602819
707 Ga0495592_0044129
708 Ga0495592_0264518
709 Ga0495629_0047642
710 Ga0495651_0045439
711 Ga0495651_0194437
712 Ga0495653_0022502
713 Ga0495653_0145228
714 Ga0495580_0000352
715 Ga0495580_0007649
716 Ga0495580_0117900
717 Ga0495580_0527922
718 Ga0495582_0003357
719 Ga0495639_0008447
720 Ga0495662_0002428
721 Ga0495662_0003019
722 Ga0495664_0004370
723 Ga0495664_0004492
724 Ga0495594_0011059
725 Ga0495606_0081682
726 Ga0495608_0039983
727 Ga0495628_0016626
728 Ga0495630_0034685
729 Ga0495630_0488065
730 Ga0495663_0231538
731 Ga0495666_0005136
732 Ga0495666_0277170
733 Ga0495652_0006574
734 Ga0495652_0041392
735 Ga0495652_0365334
736 Ga0495665_0009461
737 Ga0495640_0018524
738 Ga0495640_0035097
739 Ga0495586_0009972
740 Ga0495587_0032186
741 Ga0495645_0004029
742 Ga0495645_0018090
743 Ga0495633_0244694
744 Ga0495667_0014264
745 Ga0495667_0024182
746 Ga0495634_0005580
747 Ga0495634_0008351
748 Ga0495635_0007277
749 Ga0495635_0107184
750 Ga0495635_0390519
751 Ga0495661_0441032
752 Ga0495657_0808077
753 Ga0495599_0003988
754 Ga0495599_0020676
755 Ga0495646_0019118
756 Ga0495646_0341423
757 Ga0495613_0028471
758 Ga0495613_0090046
759 Ga0495624_0007928
760 Ga0495600_0005600
761 Ga0495600_0008363
762 Ga0495581_0008386
763 Ga0495581_0524214
764 Ga0495604_0005826
765 Ga0495604_0016375
766 Ga0495604_0179286
767 Ga0495674_0021827
768 Ga0495674_0148454
769 Ga0495672_0003932
770 Ga0495680_0010815
771 Ga0495675_0007400
772 Ga0495675_0018264
773 Ga0495684_0006562
774 Ga0495684_0021733
775 Ga0495686_0000009
776 Ga0495686_0002016
777 Ga0495593_0016640
778 Ga0495593_0258430
779 Ga0495614_0002252
780 Ga0496104_0000019
781 Ga0496104_0196227
782 Ga0496105_0262292
783 Ga0496106_0155221
784 Ga0496106_0520457
785 Ga0496112_0033405
786 Ga0496112_0161027
787 Ga0496112_0760611
788 Ga0496113_0105092
789 Ga0496126_0000029
790 Ga0496126_0005906
791 Ga0501031_0001972
792 Ga0501032_0065935
793 Ga0501032_0673068
794 Ga0501033_0020621
795 Ga0501034_0052679
796 Ga0501036_0101609
797 Ga0501037_0019744
798 Ga0501037_0293331
799 Ga0501038_0011067
800 Ga0501038_0334602
801 Ga0501039_0021538
802 Ga0501040_0616221
803 Ga0501042_0022617
804 Ga0501043_0094770
805 Ga0501043_0109930
806 Ga0501046_0004593
807 Ga0501047_0032223
808 Ga0501048_0011162
809 Ga0501067_0005169
810 Ga0501068_0003779
811 Ga0501069_0017382
812 Ga0501069_0018142
813 Ga0501070_0018941
814 Ga0501070_0354331
815 Ga0501071_0134401
816 Ga0501072_0081431
817 Ga0501073_0028546
818 Ga0501074_0080161
819 Ga0501074_0243970
820 Ga0501076_0110045
821 Ga0501079_0013412
822 Ga0501080_0109071
823 Ga0501083_0032397
824 Ga0501035_0014689
825 Ga0501035_0079655
826 Ga0501044_0001012
827 Ga0501044_0112885
828 Ga0501044_0324880
829 Ga0501045_0048138
830 nmdc:mga05p37_395_c1
831 nmdc:mga05p37_644615_c1
832 Ga0500595_000049
833 Ga0500559_0124678
834 Ga0501084_0013224
835 Ga0590071_000015
836 Ga0590074_000964
837 Ga0590075_000781
838 Ga0590077_000188
839 Ga0501082_0027061
840 Ga0501082_0827449

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

146

201

0.98

PF01132

EFP

Elongation factor P (EF-P) OB domain

85

138

0.97

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

18

77

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a5z-assembly1.cif.gz_B crystal structure of escherichia coli genx in complex with elongation factor p 0.9136 4 129
3a5z-assembly2.cif.gz_H crystal structure of escherichia coli genx in complex with elongation factor p 0.8961 4 189
5j3b-assembly2.cif.gz_B structure of translation elongation factor p from acinetobacter baumannii 0.8853 3 189
3a5z-assembly2.cif.gz_H crystal structure of escherichia coli genx in complex with elongation factor p 0.8821 4 189
5j3b-assembly2.cif.gz_B structure of translation elongation factor p from acinetobacter baumannii 0.8763 3 189
ID Description Score Start End Superfamily
5j3bA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9719 132 189 2.40.50.140
3oyyB01 Mainly Beta;Roll;SH3 type barrels.; 0.9606 4 65 2.30.30.30
af_I1L709_180_237_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9528 132 189 2.40.50.140
af_Q2QYK4_39_108_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9491 2 65 2.30.30.30
af_P9WNM3_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9482 68 129 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2V9NYJ0-F1-model_v4 Elongation factor P 0.9714 1 140 GO:0003746
GO:0005737
AF-A0A2V8NME1-F1-model_v4 Elongation factor P 0.9627 71 189 GO:0003746
GO:0005737
GO:0043043
AF-B3E1X9-F1-model_v4 Elongation factor P (EF-P) 0.9587 3 189 GO:0003746
GO:0005737
GO:0043043
AF-A0A0G0TQ70-F1-model_v4 Elongation factor P 0.9585 3 189 GO:0003746
GO:0005737
GO:0043043
AF-A0A562VPM7-F1-model_v4 Elongation factor P (EF-P) 0.9583 3 189 GO:0003746
GO:0005737
GO:0043043

Map