F439487

General Info

Members Datasets Scaffolds Average Seq Length
419 281 400 172

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100432045|Ga0068855_1004320452
Length 205
Sequence VAGLHKPCPGLILPELKLILYPGQHNTCSRIFFRMEIQENIVNKVAQSGLVTLDPATFYPAGDRVVYDIKDNLFQGLILREKDFREFVKTHDWSQYQGKNVAVTCSADAIVPGWAYMLLANRLAPYAAEVVFGNEEMLETILFIKNIAKMDVEQYRDQRIVIKGCGDVHVPVSAYVELTKKLTPVAKSLMFGEPCSTVPIYKRKD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2739367656 Pedobacter sp. CF523 Isolate Unclassified
8 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
9 2818991437 Pedobacter terrae 518 Isolate Unclassified
10 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
11 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
12 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
13 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
14 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
15 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
16 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
17 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
18 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
19 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
20 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
21 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
25 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
26 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
39 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
170 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
171 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
172 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
173 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
174 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
199 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
200 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
238 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
239 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
242 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
243 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
244 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
245 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
246 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
247 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
248 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
249 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
250 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
251 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
252 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
253 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
254 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
255 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
256 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
257 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
258 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
259 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
260 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
261 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
262 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
267 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
268 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
269 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
270 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
271 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
274 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
275 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
276 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
279 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
280 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
281 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.75
Metatranscriptomes 0.72
Isolates 4.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.79
Nodule 0
Rhizoplane 0.24
Rhizosphere 84.01
Stem 0
Stem Tuber 0
Unclassified 5.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2712303 2162886007 Bacteria 5315
2 SwRhRL2b_contig_761439 2162886007 Bacteria 3629
3 SwRhRL2b_contig_857275 2162886007 Bacteria 2252
4 MRS1b_contig_6247021 2162886011 Bacteria 917
5 JGI24741J21665_1008996 3300001915 Bacteria 1855
6 JGI24737J22298_10000116 3300001990 Bacteria 24197
7 JGI24735J21928_10000015 3300002067 Bacteria 167231
8 JGI25157J39369_1004384 3300002741 Bacteria 2574
9 JGI25152J39213_1000300 3300002773 Bacteria 31900
10 JGI25150J39212_1000023 3300002774 Bacteria 130663
11 JGI25151J46595_10000082 3300003187 Bacteria 130832
12 JGI25153J46596_10000060 3300003215 Bacteria 131744
13 rootH1_10013584 3300003316 Bacteria 4023
14 rootH2_10073496 3300003320 Bacteria 4789
15 rootH2_10264962 3300003320 Bacteria 1391
16 Ga0055535_1003450 3300003761 Bacteria 4479
17 Ga0055542_1001495 3300003762 Bacteria 11422
18 Ga0055530_10001816 3300003791 Bacteria 14771
19 Ga0055531_10008470 3300003794 Bacteria 5411
20 Ga0065165_1000302 3300005262 Bacteria 82711
21 Ga0065714_10064439 3300005288 Bacteria 112310
22 Ga0065714_10078965 3300005288 Bacteria 2555
23 Ga0065714_10213226 3300005288 Bacteria 859
24 Ga0065714_10243602 3300005288 Bacteria 790
25 Ga0065704_10204048 3300005289 Bacteria 1119
26 Ga0065704_10372805 3300005289 Bacteria 783
27 Ga0065712_10002545 3300005290 Bacteria 7222
28 Ga0065707_10153631 3300005295 Bacteria 1631
29 Ga0070658_10000008 3300005327 Bacteria 319912
30 Ga0070658_10020421 3300005327 Bacteria 5309
31 Ga0070658_10241133 3300005327 Bacteria 1532
32 Ga0070683_100006005 3300005329 Bacteria 10175
33 Ga0070670_100019935 3300005331 Bacteria 5757
34 Ga0068869_100141188 3300005334 Bacteria 1860
35 Ga0070680_100013348 3300005336 Bacteria 6397
36 Ga0070682_100480600 3300005337 Bacteria 958
37 Ga0070660_100224828 3300005339 Bacteria 1526
38 Ga0070660_100265553 3300005339 Bacteria 1402
39 Ga0070689_100008949 3300005340 Bacteria 7084
40 Ga0070691_10292338 3300005341 Bacteria 887
41 Ga0070687_100354182 3300005343 Bacteria 948
42 Ga0070668_100035905 3300005347 Bacteria 3782
43 Ga0070669_100004198 3300005353 Bacteria 10428
44 Ga0070675_100000416 3300005354 Bacteria 29034
45 Ga0070675_100068186 3300005354 Bacteria 2945
46 Ga0070671_100009462 3300005355 Bacteria 7823
47 Ga0070671_100152944 3300005355 Bacteria 1948
48 Ga0070673_100070432 3300005364 Bacteria 2806
49 Ga0070673_100197310 3300005364 Bacteria 1732
50 Ga0070688_100024817 3300005365 Bacteria 3542
51 Ga0070688_100383060 3300005365 Bacteria 1037
52 Ga0070659_100049679 3300005366 Bacteria 3299
53 Ga0070659_100060784 3300005366 Bacteria 2985
54 Ga0070701_10122627 3300005438 Bacteria 1466
55 Ga0070694_100091628 3300005444 Bacteria 2134
56 Ga0070663_100002467 3300005455 Bacteria 10435
57 Ga0070662_100000863 3300005457 Bacteria 18571
58 Ga0070662_100026241 3300005457 Bacteria 4033
59 Ga0070681_10002959 3300005458 Bacteria 15767
60 Ga0068867_100060029 3300005459 Bacteria 2820
61 Ga0070679_100004682 3300005530 Bacteria 12624
62 Ga0070684_100016169 3300005535 Bacteria 6095
63 Ga0070684_100083190 3300005535 Bacteria 2835
64 Ga0070684_101318657 3300005535 Bacteria 679
65 Ga0068853_100029060 3300005539 Bacteria 4656
66 Ga0070672_100010449 3300005543 Bacteria 6442
67 Ga0070695_100422285 3300005545 Bacteria 1015
68 Ga0068855_100000130 3300005563 Bacteria 95659
69 Ga0068855_100051857 3300005563 Bacteria 4832
70 Ga0068855_100218901 3300005563 Bacteria 2136
71 Ga0068855_100221709 3300005563 Bacteria 2120
72 Ga0068855_100432045 3300005563 Bacteria 1439
73 Ga0068857_100011349 3300005577 Bacteria 7751
74 Ga0068857_100192101 3300005577 Bacteria 1860
75 Ga0068854_100390361 3300005578 Bacteria 1149
76 Ga0068856_100000112 3300005614 Bacteria 80466
77 Ga0068856_100015216 3300005614 Bacteria 7434
78 Ga0068856_100049148 3300005614 Bacteria 4157
79 Ga0068856_100435181 3300005614 Bacteria 1332
80 Ga0068856_100624615 3300005614 Bacteria 1098
81 Ga0068852_100055623 3300005616 Unclassified 3416
82 Ga0068859_100034519 3300005617 Bacteria 5077
83 Ga0068864_100447598 3300005618 Bacteria 1235
84 Ga0068861_100009649 3300005719 Bacteria 6668
85 Ga0068851_10016633 3300005834 Bacteria 3523
86 Ga0068870_10033797 3300005840 Bacteria 2613
87 Ga0068860_100143782 3300005843 Bacteria 2294
88 Ga0068862_100072112 3300005844 Bacteria 2983
89 Ga0070712_100314707 3300006175 Bacteria 1271
90 Ga0075366_10000929 3300006195 Bacteria 14226
91 Ga0075428_101683960 3300006844 Bacteria 662
92 Ga0068865_101002155 3300006881 Bacteria 731
93 Ga0097620_100034523 3300006931 Bacteria 5077
94 Ga0105244_10219430 3300009036 Bacteria 892
95 Ga0105240_10893566 3300009093 Bacteria 956
96 Ga0111539_10003763 3300009094 Bacteria 19972
97 Ga0105243_10000043 3300009148 Bacteria 158809
98 Ga0105241_10000116 3300009174 Bacteria 57591
99 Ga0105242_10012362 3300009176 Bacteria 6571
100 Ga0105242_10122230 3300009176 Unclassified 2236
101 Ga0105237_10024919 3300009545 Bacteria 6120
102 Ga0105249_10003256 3300009553 Bacteria 14068
103 Ga0105239_10000049 3300010375 Bacteria 177578
104 Ga0105239_10038256 3300010375 Bacteria 5257
105 Ga0105239_11489971 3300010375 Bacteria 782
106 Ga0157373_10000089 3300013100 Bacteria 78449
107 Ga0157373_10004564 3300013100 Bacteria 10416
108 Ga0157373_10005698 3300013100 Bacteria 9338
109 Ga0157373_10030332 3300013100 Bacteria 3890
110 Ga0157373_10098003 3300013100 Bacteria 2063
111 Ga0157373_10125062 3300013100 Bacteria 1808
112 Ga0157373_10620867 3300013100 Bacteria 788
113 Ga0157371_10000511 3300013102 Bacteria 46681
114 Ga0157371_10002079 3300013102 Bacteria 19608
115 Ga0157371_10006312 3300013102 Bacteria 9817
116 Ga0157371_10024916 3300013102 Bacteria 4365
117 Ga0157371_10033505 3300013102 Bacteria 3690
118 Ga0157370_10000637 3300013104 Bacteria 43772
119 Ga0157370_10019842 3300013104 Bacteria 6727
120 Ga0157370_10037726 3300013104 Bacteria 4681
121 Ga0157370_10084790 3300013104 Bacteria 2977
122 Ga0157370_10100876 3300013104 Unclassified 2704
123 Ga0157370_10109225 3300013104 Bacteria 2586
124 Ga0157370_10219387 3300013104 Bacteria 1762
125 Ga0157370_10676081 3300013104 Bacteria 943
126 Ga0157370_10758411 3300013104 Bacteria 884
127 Ga0157370_10827137 3300013104 Bacteria 842
128 Ga0157369_10000594 3300013105 Bacteria 47098
129 Ga0157369_10022085 3300013105 Bacteria 7109
130 Ga0157369_10055728 3300013105 Bacteria 4267
131 Ga0157369_10210057 3300013105 Unclassified 2040
132 Ga0157369_10247309 3300013105 Unclassified 1862
133 Ga0157369_10290295 3300013105 Bacteria 1703
134 Ga0157369_10355570 3300013105 Bacteria 1521
135 Ga0157369_10945236 3300013105 Bacteria 883
136 Ga0157374_10000427 3300013296 Bacteria 38121
137 Ga0157374_10206156 3300013296 Bacteria 1927
138 Ga0157374_10664592 3300013296 Unclassified 1054
139 Ga0157378_10096044 3300013297 Bacteria 2700
140 Ga0163162_10000123 3300013306 Bacteria 68905
141 Ga0163162_10075378 3300013306 Bacteria 3434
142 Ga0163162_11513701 3300013306 Bacteria 764
143 Ga0157372_10000039 3300013307 Bacteria 165839
144 Ga0157372_10000241 3300013307 Bacteria 60488
145 Ga0157372_10003208 3300013307 Bacteria 17660
146 Ga0157372_10007944 3300013307 Bacteria 11276
147 Ga0157372_10059391 3300013307 Bacteria 4277
148 Ga0157372_11653994 3300013307 Bacteria 737
149 Ga0157375_10017849 3300013308 Bacteria 6418
150 Ga0157375_10019499 3300013308 Bacteria 6171
151 Ga0157375_10058487 3300013308 Bacteria 3814
152 Ga0157375_10118634 3300013308 Bacteria 2752
153 Ga0157375_10192537 3300013308 Bacteria 2194
154 Ga0157380_10000545 3300014326 Bacteria 23181
155 Ga0182008_10000020 3300014497 Bacteria 228333
156 Ga0182008_10000461 3300014497 Bacteria 31061
157 Ga0157377_10002364 3300014745 Bacteria 8318
158 Ga0157377_10007790 3300014745 Bacteria 5190
159 Ga0182006_1000108 3300015261 Bacteria 89633
160 Ga0182006_1000360 3300015261 Bacteria 38015
161 Ga0182006_1004894 3300015261 Bacteria 6490
162 Ga0182007_10000024 3300015262 Bacteria 181761
163 Ga0183373_1002 3300015682 Bacteria 990153
164 Ga0163161_10000093 3300017792 Bacteria 90618
165 Ga0163161_10000094 3300017792 Bacteria 90423
166 Ga0163161_10001375 3300017792 Bacteria 18039
167 Ga0163161_10118688 3300017792 Bacteria 1985
168 Ga0163161_10323010 3300017792 Bacteria 1221
169 Ga0163161_10672817 3300017792 Bacteria 860
170 Ga0206353_11169242 3300020082 Bacteria 749
171 Ga0154015_1481443 3300020610 Bacteria 822
172 Ga0213872_10008236 3300021361 Bacteria 5049
173 Ga0224712_10514122 3300022467 Bacteria 580
174 Ga0209258_100116 3300025242 Bacteria 190317
175 Ga0207425_1000051 3300025245 Bacteria 166795
176 Ga0209026_1000304 3300025250 Bacteria 53704
177 Ga0209026_1001474 3300025250 Bacteria 10370
178 Ga0209026_1004480 3300025250 Bacteria 4125
179 Ga0209148_1000251 3300025254 Bacteria 85638
180 Ga0209129_1000121 3300025258 Bacteria 135404
181 Ga0209233_1020336 3300025261 Unclassified 1744
182 Ga0207666_1059416 3300025271 Bacteria 611
183 Ga0209676_1000022 3300025292 Bacteria 605659
184 Ga0209676_1000363 3300025292 Bacteria 85613
185 Ga0209025_1000160 3300025294 Bacteria 166795
186 Ga0209758_1000147 3300025297 Bacteria 166795
187 Ga0209050_1000020 3300025298 Bacteria 605671
188 Ga0209257_1000007 3300025304 Bacteria 1564415
189 Ga0207697_10029818 3300025315 Bacteria 2233
190 Ga0207656_10073655 3300025321 Bacteria 1522
191 Ga0207647_10000018 3300025904 Bacteria 124816
192 Ga0207647_10000256 3300025904 Bacteria 43702
193 Ga0207647_10082917 3300025904 Bacteria 1920
194 Ga0207647_10108607 3300025904 Bacteria 1641
195 Ga0207647_10217096 3300025904 Bacteria 1103
196 Ga0207685_10152896 3300025905 Bacteria 1046
197 Ga0207643_10036345 3300025908 Bacteria 2762
198 Ga0207705_10000035 3300025909 Bacteria 201649
199 Ga0207705_10020066 3300025909 Bacteria 4779
200 Ga0207705_10606765 3300025909 Unclassified 851
201 Ga0207654_10006275 3300025911 Bacteria 5975
202 Ga0207707_10004330 3300025912 Bacteria 12569
203 Ga0207695_10011959 3300025913 Bacteria 10447
204 Ga0207671_10028615 3300025914 Bacteria 4162
205 Ga0207693_10290651 3300025915 Bacteria 1281
206 Ga0207660_10054438 3300025917 Bacteria 2855
207 Ga0207662_10106356 3300025918 Bacteria 1745
208 Ga0207657_10295608 3300025919 Bacteria 1283
209 Ga0207649_11009941 3300025920 Unclassified 655
210 Ga0207681_10005541 3300025923 Bacteria 7756
211 Ga0207650_10033959 3300025925 Bacteria 3698
212 Ga0207659_10051799 3300025926 Bacteria 2921
213 Ga0207659_10910310 3300025926 Bacteria 756
214 Ga0207664_10676440 3300025929 Bacteria 928
215 Ga0207644_10004990 3300025931 Bacteria 8662
216 Ga0207690_10001492 3300025932 Bacteria 14624
217 Ga0207690_10034122 3300025932 Bacteria 3277
218 Ga0207690_10038527 3300025932 Bacteria 3112
219 Ga0207706_10000013 3300025933 Bacteria 188236
220 Ga0207706_10015321 3300025933 Bacteria 6930
221 Ga0207686_10140025 3300025934 Bacteria 1671
222 Ga0207686_10144171 3300025934 Unclassified 1650
223 Ga0207709_10000021 3300025935 Bacteria 386722
224 Ga0207670_10004226 3300025936 Bacteria 7705
225 Ga0207704_10794458 3300025938 Bacteria 790
226 Ga0207691_10049996 3300025940 Bacteria 3828
227 Ga0207689_10148795 3300025942 Bacteria 1930
228 Ga0207661_10006414 3300025944 Bacteria 8321
229 Ga0207661_10031434 3300025944 Unclassified 4101
230 Ga0207667_10000274 3300025949 Bacteria 71328
231 Ga0207667_10602580 3300025949 Bacteria 1108
232 Ga0207667_10765021 3300025949 Bacteria 964
233 Ga0207651_10064422 3300025960 Bacteria 2565
234 Ga0207712_10042710 3300025961 Bacteria 3124
235 Ga0207677_10218176 3300026023 Bacteria 1528
236 Ga0207639_10035061 3300026041 Bacteria 3712
237 Ga0207639_11161115 3300026041 Bacteria 725
238 Ga0207678_10006451 3300026067 Bacteria 10409
239 Ga0207702_10000278 3300026078 Bacteria 58953
240 Ga0207702_10020477 3300026078 Bacteria 5476
241 Ga0207702_10046253 3300026078 Bacteria 3663
242 Ga0207702_10104436 3300026078 Bacteria 2507
243 Ga0207702_10635114 3300026078 Bacteria 1049
244 Ga0207648_10060664 3300026089 Bacteria 3298
245 Ga0207676_11054962 3300026095 Bacteria 802
246 Ga0207674_10017021 3300026116 Bacteria 7937
247 Ga0207674_10077096 3300026116 Bacteria 3339
248 Ga0207675_100000332 3300026118 Bacteria 45114
249 Ga0268265_10019100 3300028380 Bacteria 4757
250 Ga0268264_10073113 3300028381 Bacteria 2909
251 Ga0265338_10047663 3300028800 Bacteria 3911
252 Ga0316177_1003264 3300030731 Bacteria 926
253 Ga0316176_1102297 3300030732 Bacteria 14584
254 Ga0314311_1129672 3300030733 Bacteria 1238
255 Ga0316183_1003890 3300030742 Bacteria 25813
256 Ga0316181_1131993 3300030744 Bacteria 4241
257 Ga0316181_1132288 3300030744 Unclassified 3701
258 Ga0316181_1289094 3300030744 Bacteria 1329
259 Ga0316182_1277066 3300030745 Bacteria 1233
260 Ga0265327_10001093 3300031251 Bacteria 37634
261 Ga0265327_10094768 3300031251 Bacteria 1450
262 Ga0265327_10263153 3300031251 Bacteria 765
263 Ga0307509_10083601 3300031507 Unclassified 3290
264 Ga0307408_100000517 3300031548 Bacteria 33313
265 Ga0307408_100001538 3300031548 Bacteria 17127
266 Ga0307408_100055924 3300031548 Unclassified 2859
267 Ga0307408_101655932 3300031548 Bacteria 609
268 Ga0265314_10287936 3300031711 Bacteria 926
269 Ga0307405_10000011 3300031731 Bacteria 241071
270 Ga0307405_10131614 3300031731 Bacteria 1729
271 Ga0307410_10226897 3300031852 Bacteria 1440
272 Ga0307407_10000163 3300031903 Bacteria 20529
273 Ga0307412_10000001 3300031911 Bacteria 822691
274 Ga0307412_10001430 3300031911 Bacteria 13285
275 Ga0307412_10009032 3300031911 Bacteria 5710
276 Ga0307412_10033374 3300031911 Bacteria 3271
277 Ga0307412_10340290 3300031911 Bacteria 1201
278 Ga0307412_10590568 3300031911 Bacteria 939
279 Ga0307409_101110223 3300031995 Unclassified 812
280 Ga0307416_100000050 3300032002 Bacteria 116313
281 Ga0307416_100488223 3300032002 Bacteria 1293
282 Ga0307414_10005075 3300032004 Bacteria 7216
283 Ga0307414_10016198 3300032004 Bacteria 4525
284 Ga0307414_10048868 3300032004 Bacteria 2921
285 Ga0307414_10118515 3300032004 Bacteria 2030
286 Ga0307414_10199171 3300032004 Bacteria 1627
287 Ga0307414_10477061 3300032004 Bacteria 1099
288 Ga0307414_10785853 3300032004 Bacteria 867
289 Ga0307414_10880059 3300032004 Bacteria 820
290 Ga0307411_10073655 3300032005 Bacteria 2324
291 Ga0373934_0255602 3300035086 Bacteria 725
292 Ga0316574_0299551 3300035398 Bacteria 1023
293 Ga0373927_0055241 3300035695 Unclassified 2568
294 Ga0373937_0255463 3300036401 Bacteria 1652
295 Ga0316584_0130840 3300036712 Unclassified 1874
296 Ga0395899_0000282 3300037312 Bacteria 66053
297 Ga0395899_0052363 3300037312 Bacteria 3026
298 Ga0395899_0525764 3300037312 Bacteria 764
299 Ga0395900_0000195 3300037418 Bacteria 97204
300 Ga0395900_0009107 3300037418 Bacteria 10169
301 Ga0395900_0961876 3300037418 Bacteria 775
302 Ga0395898_0200160 3300037466 Bacteria 1907
303 Ga0395905_0000993 3300037471 Bacteria 36305
304 Ga0395901_0005293 3300038443 Bacteria 13041
305 Ga0395901_0526280 3300038443 Unclassified 1200
306 Ga0436361_1126675 3300039447 Bacteria 11002
307 Ga0451833_0138410 3300041491 Bacteria 646
308 Ga0439457_010490 3300042014 Unclassified 2128
309 Ga0450893_0066459 3300042532 Unclassified 695
310 Ga0466966_0008901 3300044684 Bacteria 6649
311 Ga0466961_0049757 3300044693 Bacteria 2678
312 Ga0453684_0073337 3300044712 Bacteria 4316
313 Ga0453684_0201862 3300044712 Bacteria 2317
314 Ga0466968_0239455 3300044735 Bacteria 859
315 Ga0466957_0354344 3300044842 Bacteria 996
316 Ga0451576_0047928 3300045051 Bacteria 4491
317 Ga0466958_0065994 3300045836 Bacteria 2209
318 Ga0495627_028556 3300046453 Bacteria 1782
319 Ga0495650_0000144 3300046471 Bacteria 165957
320 Ga0495580_0011568 3300046472 Bacteria 6826
321 Ga0495585_0000091 3300046492 Bacteria 95620
322 Ga0495606_0009276 3300046507 Bacteria 8350
323 Ga0495610_0000219 3300046512 Bacteria 61501
324 Ga0495610_0002599 3300046512 Bacteria 14973
325 Ga0495610_0007529 3300046512 Bacteria 7215
326 Ga0495616_0017439 3300046513 Bacteria 3961
327 Ga0495637_0040482 3300046520 Bacteria 2006
328 Ga0495644_0007582 3300046523 Bacteria 4183
329 Ga0495652_0582173 3300046529 Bacteria 766
330 Ga0495609_0015348 3300046538 Bacteria 3585
331 Ga0495609_0056150 3300046538 Bacteria 1745
332 Ga0495622_0184275 3300046557 Bacteria 935
333 Ga0495633_0005839 3300046558 Bacteria 7411
334 Ga0495633_0034796 3300046558 Bacteria 2421
335 Ga0495625_0000059 3300046660 Bacteria 180330
336 Ga0495635_0049654 3300046663 Bacteria 2892
337 Ga0495661_0018331 3300046665 Bacteria 4606
338 Ga0495649_0000031 3300046694 Bacteria 151547
339 Ga0495680_1095559 3300047322 Bacteria 503
340 Ga0495687_001100 3300047443 Bacteria 26388
341 Ga0495675_0595563 3300047444 Bacteria 627
342 Ga0495685_088254 3300047447 Bacteria 1029
343 Ga0495686_0091153 3300047472 Bacteria 1850
344 Ga0496116_0072647 3300048919 Bacteria 2173
345 Ga0496117_0008262 3300048920 Bacteria 9913
346 Ga0496118_0033378 3300048921 Bacteria 4224
347 Ga0496122_0026512 3300048925 Bacteria 4992
348 Ga0496123_0007418 3300048926 Bacteria 10339
349 Ga0496124_0080857 3300048927 Bacteria 2673
350 Ga0496126_0550132 3300048929 Bacteria 916
351 Ga0495678_137199 3300049459 Bacteria 804
352 Ga0501290_003892 3300049513 Bacteria 1869
353 Ga0501297_000533 3300049520 Unclassified 3434
354 Ga0501034_0790621 3300049571 Unclassified 842
355 Ga0501198_000167 3300049649 Bacteria 8710
356 Ga0501198_019543 3300049649 Bacteria 1068
357 Ga0501201_000104 3300049651 Bacteria 6685
358 Ga0501202_001568 3300049652 Bacteria 3688
359 Ga0501206_002921 3300049653 Bacteria 2159
360 Ga0501217_066156 3300049661 Bacteria 975
361 Ga0501223_001032 3300049663 Bacteria 6583
362 Ga0501235_007479 3300049669 Bacteria 2379
363 Ga0501240_001493 3300049673 Unclassified 2295
364 Ga0501242_004914 3300049674 Bacteria 1493
365 Ga0501246_003389 3300049676 Bacteria 1281
366 Ga0501249_027433 3300049679 Bacteria 1260
367 Ga0501250_008573 3300049680 Bacteria 1131
368 Ga0501252_002574 3300049682 Bacteria 1811
369 Ga0501256_002218 3300049685 Bacteria 1525
370 Ga0501259_000375 3300049688 Bacteria 7028
371 Ga0501221_000120 3300049704 Bacteria 9800
372 Ga0501225_0003232 3300049705 Bacteria 4976
373 Ga0501245_000053 3300049708 Bacteria 10632
374 Ga0501232_018290 3300049757 Bacteria 880
375 Ga0501241_007212 3300049758 Bacteria 2038
376 Ga0501241_014018 3300049758 Bacteria 1456
377 Ga0501212_003491 3300049851 Bacteria 1977
378 Ga0501284_08177 3300050005 Bacteria 621
379 nmdc:mga0k408_783_c1 3300050493 Bacteria 17509
380 nmdc:mga08y16_1594_c1 3300050511 Bacteria 22911
381 Ga0495619_0090368 3300053085 Bacteria 2073
382 Ga0500644_0000458 3300053088 Bacteria 18625
383 Ga0500646_0007092 3300053090 Bacteria 2859
384 Ga0500583_0021222 3300053092 Bacteria 2697
385 Ga0500651_0001126 3300053093 Bacteria 13227
386 Ga0500651_0355727 3300053093 Bacteria 830
387 Ga0500562_040253 3300053108 Unclassified 1242
388 Ga0500562_073294 3300053108 Bacteria 924
389 Ga0500569_000835 3300053109 Bacteria 5462
390 Ga0500658_0007044 3300053134 Bacteria 4160
391 Ga0500559_0019625 3300053136 Bacteria 2856
392 Ga0500561_0128625 3300053137 Bacteria 778
393 Ga0500577_0001396 3300053142 Bacteria 6180
394 Ga0500604_0019958 3300053151 Unclassified 1881
395 Ga0500616_0004658 3300053153 Bacteria 9670
396 Ga0500622_0000017 3300053156 Bacteria 332114
397 Ga0500622_0000387 3300053156 Bacteria 42589
398 Ga0500633_0001021 3300053160 Bacteria 4973
399 Ga0500633_0146302 3300053160 Bacteria 885
400 Ga0500645_036250 3300053730 Bacteria 1468

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047322 Ga0495680_1095559 Ga0495680_1095559_41_490 149
2 iso_pu_bacteria 2884634485 2884637931 164
3 iso_pu_bacteria 2842903701 2842904974 166
4 3300003320 rootH2_10073496 rootH2_100734966 167
5 3300003761 Ga0055535_1003450 Ga0055535_10034502 167
6 3300003762 Ga0055542_1001495 Ga0055542_10014958 167
7 3300005614 Ga0068856_100624615 Ga0068856_1006246152 167
8 3300009176 Ga0105242_10122230 Ga0105242_101222304 167
9 3300013296 Ga0157374_10664592 Ga0157374_106645922 167
10 3300025242 Ga0209258_100116 Ga0209258_10011627 167
11 3300025254 Ga0209148_1000251 Ga0209148_100025127 167
12 3300025934 Ga0207686_10144171 Ga0207686_101441712 167
13 3300035398 Ga0316574_0299551 Ga0316574_0299551_319_825 167
14 3300044712 Ga0453684_0073337 Ga0453684_0073337_1593_2105 167
15 3300049673 Ga0501240_001493 Ga0501240_001493_1006_1509 167
16 3300053088 Ga0500644_0000458 Ga0500644_0000458_299_802 167
17 3300053090 Ga0500646_0007092 Ga0500646_0007092_992_1495 167
18 3300053092 Ga0500583_0021222 Ga0500583_0021222_323_826 167
19 3300053093 Ga0500651_0355727 Ga0500651_0355727_224_727 167
20 3300053109 Ga0500569_000835 Ga0500569_000835_4857_5360 167
21 3300053134 Ga0500658_0007044 Ga0500658_0007044_1833_2336 167
22 3300053136 Ga0500559_0019625 Ga0500559_0019625_1940_2443 167
23 3300053137 Ga0500561_0128625 Ga0500561_0128625_11_514 167
24 3300053142 Ga0500577_0001396 Ga0500577_0001396_4342_4845 167
25 3300053153 Ga0500616_0004658 Ga0500616_0004658_4984_5487 167
26 3300053160 Ga0500633_0001021 Ga0500633_0001021_2144_2647 167
27 3300053160 Ga0500633_0146302 Ga0500633_0146302_312_815 167
28 iso_pu_bacteria 2721755487 2722726324 167
29 iso_pu_bacteria 2738541284 2738763285 167
30 iso_pu_bacteria 2739367651 2739591461 167
31 iso_pu_bacteria 2739367656 2739615273 167
32 iso_pu_bacteria 2775506987 2776616109 167
33 iso_pu_bacteria 2818991437 2819549553 167
34 iso_pu_bacteria 2857627736 2857632432 167
35 iso_pu_bacteria 2896344016 2896346115 167
36 iso_pu_bacteria 2898713307 2898716242 167
37 iso_pu_bacteria 2904445276 2904447307 167
38 iso_pu_bacteria 2904780799 2904783789 167
39 iso_pu_bacteria 2919177583 2919181961 167
40 iso_pu_bacteria 2928078545 2928082112 167
41 iso_pu_bacteria 2932082852 2932087954 167
42 iso_pu_bacteria 2945997725 2945998366 167
43 iso_pu_bacteria 8055588893 8055589932 167
44 3300003794 Ga0055531_10008470 Ga0055531_100084706 168
45 3300005843 Ga0068860_100143782 Ga0068860_1001437822 168
46 3300009176 Ga0105242_10012362 Ga0105242_100123623 168
47 3300025304 Ga0209257_1000007 Ga0209257_10000071429 168
48 3300025934 Ga0207686_10140025 Ga0207686_101400253 168
49 3300026078 Ga0207702_10104436 Ga0207702_101044363 168
50 3300028381 Ga0268264_10073113 Ga0268264_100731134 168
51 3300031251 Ga0265327_10001093 Ga0265327_1000109331 168
52 3300031251 Ga0265327_10094768 Ga0265327_100947682 168
53 3300031548 Ga0307408_101655932 Ga0307408_1016559321 168
54 3300031711 Ga0265314_10287936 Ga0265314_102879362 168
55 3300050005 Ga0501284_08177 Ga0501284_08177_63_569 168
56 3300053730 Ga0500645_036250 Ga0500645_036250_487_993 168
57 2162886011 MRS1b_contig_6247021 MRS1b_0420.00001830 169
58 3300005289 Ga0065704_10204048 Ga0065704_102040481 169
59 3300005290 Ga0065712_10002545 Ga0065712_100025453 169
60 3300005295 Ga0065707_10153631 Ga0065707_101536312 169
61 3300005331 Ga0070670_100019935 Ga0070670_1000199354 169
62 3300005334 Ga0068869_100141188 Ga0068869_1001411882 169
63 3300005337 Ga0070682_100480600 Ga0070682_1004806002 169
64 3300005340 Ga0070689_100008949 Ga0070689_1000089493 169
65 3300005343 Ga0070687_100354182 Ga0070687_1003541821 169
66 3300005347 Ga0070668_100035905 Ga0070668_1000359052 169
67 3300005353 Ga0070669_100004198 Ga0070669_1000041982 169
68 3300005354 Ga0070675_100000416 Ga0070675_10000041627 169
69 3300005354 Ga0070675_100068186 Ga0070675_1000681862 169
70 3300005355 Ga0070671_100152944 Ga0070671_1001529442 169
71 3300005364 Ga0070673_100070432 Ga0070673_1000704322 169
72 3300005365 Ga0070688_100024817 Ga0070688_1000248174 169
73 3300005365 Ga0070688_100383060 Ga0070688_1003830602 169
74 3300005438 Ga0070701_10122627 Ga0070701_101226272 169
75 3300005444 Ga0070694_100091628 Ga0070694_1000916282 169
76 3300005457 Ga0070662_100026241 Ga0070662_1000262413 169
77 3300005459 Ga0068867_100060029 Ga0068867_1000600292 169
78 3300005535 Ga0070684_100083190 Ga0070684_1000831902 169
79 3300005543 Ga0070672_100010449 Ga0070672_1000104497 169
80 3300005563 Ga0068855_100051857 Ga0068855_1000518573 169
81 3300005577 Ga0068857_100192101 Ga0068857_1001921012 169
82 3300005578 Ga0068854_100390361 Ga0068854_1003903612 169
83 3300005616 Ga0068852_100055623 Ga0068852_1000556232 169
84 3300005617 Ga0068859_100034519 Ga0068859_1000345193 169
85 3300005618 Ga0068864_100447598 Ga0068864_1004475982 169
86 3300005719 Ga0068861_100009649 Ga0068861_1000096492 169
87 3300005834 Ga0068851_10016633 Ga0068851_100166332 169
88 3300005840 Ga0068870_10033797 Ga0068870_100337973 169
89 3300005844 Ga0068862_100072112 Ga0068862_1000721122 169
90 3300006844 Ga0075428_101683960 Ga0075428_1016839601 169
91 3300006881 Ga0068865_101002155 Ga0068865_1010021552 169
92 3300006931 Ga0097620_100034523 Ga0097620_1000345233 169
93 3300009094 Ga0111539_10003763 Ga0111539_1000376310 169
94 3300009553 Ga0105249_10003256 Ga0105249_100032567 169
95 3300013105 Ga0157369_10247309 Ga0157369_102473091 169
96 3300013105 Ga0157369_10290295 Ga0157369_102902952 169
97 3300013306 Ga0163162_11513701 Ga0163162_115137012 169
98 3300013308 Ga0157375_10118634 Ga0157375_101186342 169
99 3300014326 Ga0157380_10000545 Ga0157380_100005452 169
100 3300014745 Ga0157377_10002364 Ga0157377_100023648 169
101 3300014745 Ga0157377_10007790 Ga0157377_100077903 169
102 3300017792 Ga0163161_10672817 Ga0163161_106728172 169
103 3300025271 Ga0207666_1059416 Ga0207666_10594161 169
104 3300025315 Ga0207697_10029818 Ga0207697_100298182 169
105 3300025321 Ga0207656_10073655 Ga0207656_100736552 169
106 3300025904 Ga0207647_10217096 Ga0207647_102170962 169
107 3300025905 Ga0207685_10152896 Ga0207685_101528962 169
108 3300025908 Ga0207643_10036345 Ga0207643_100363452 169
109 3300025918 Ga0207662_10106356 Ga0207662_101063562 169
110 3300025920 Ga0207649_11009941 Ga0207649_110099411 169
111 3300025923 Ga0207681_10005541 Ga0207681_100055418 169
112 3300025925 Ga0207650_10033959 Ga0207650_100339592 169
113 3300025926 Ga0207659_10051799 Ga0207659_100517992 169
114 3300025926 Ga0207659_10910310 Ga0207659_109103102 169
115 3300025933 Ga0207706_10015321 Ga0207706_100153212 169
116 3300025936 Ga0207670_10004226 Ga0207670_100042263 169
117 3300025938 Ga0207704_10794458 Ga0207704_107944582 169
118 3300025940 Ga0207691_10049996 Ga0207691_100499963 169
119 3300025942 Ga0207689_10148795 Ga0207689_101487952 169
120 3300025944 Ga0207661_10031434 Ga0207661_100314343 169
121 3300025949 Ga0207667_10765021 Ga0207667_107650212 169
122 3300025960 Ga0207651_10064422 Ga0207651_100644223 169
123 3300025961 Ga0207712_10042710 Ga0207712_100427102 169
124 3300026041 Ga0207639_11161115 Ga0207639_111611152 169
125 3300026089 Ga0207648_10060664 Ga0207648_100606642 169
126 3300026095 Ga0207676_11054962 Ga0207676_110549621 169
127 3300026116 Ga0207674_10017021 Ga0207674_100170217 169
128 3300026118 Ga0207675_100000332 Ga0207675_1000003323 169
129 3300028380 Ga0268265_10019100 Ga0268265_100191002 169
130 3300031507 Ga0307509_10083601 Ga0307509_100836011 169
131 3300032002 Ga0307416_100488223 Ga0307416_1004882232 169
132 3300032004 Ga0307414_10785853 Ga0307414_107858532 169
133 3300035695 Ga0373927_0055241 Ga0373927_0055241_1829_2341 169
134 3300046472 Ga0495580_0011568 Ga0495580_0011568_4676_5200 169
135 3300046529 Ga0495652_0582173 Ga0495652_0582173_165_689 169
136 3300047444 Ga0495675_0595563 Ga0495675_0595563_36_560 169
137 3300049513 Ga0501290_003892 Ga0501290_003892_642_1151 169
138 3300049520 Ga0501297_000533 Ga0501297_000533_1770_2279 169
139 3300049649 Ga0501198_000167 Ga0501198_000167_7525_8034 169
140 3300049651 Ga0501201_000104 Ga0501201_000104_1491_2000 169
141 3300049652 Ga0501202_001568 Ga0501202_001568_615_1124 169
142 3300049653 Ga0501206_002921 Ga0501206_002921_38_547 169
143 3300049669 Ga0501235_007479 Ga0501235_007479_17_526 169
144 3300049674 Ga0501242_004914 Ga0501242_004914_912_1421 169
145 3300049676 Ga0501246_003389 Ga0501246_003389_95_604 169
146 3300049680 Ga0501250_008573 Ga0501250_008573_104_613 169
147 3300049682 Ga0501252_002574 Ga0501252_002574_1260_1769 169
148 3300049685 Ga0501256_002218 Ga0501256_002218_17_526 169
149 3300049688 Ga0501259_000375 Ga0501259_000375_727_1236 169
150 3300049704 Ga0501221_000120 Ga0501221_000120_2476_2985 169
151 3300049705 Ga0501225_0003232 Ga0501225_0003232_1736_2245 169
152 3300049708 Ga0501245_000053 Ga0501245_000053_8626_9135 169
153 3300049757 Ga0501232_018290 Ga0501232_018290_102_611 169
154 3300049851 Ga0501212_003491 Ga0501212_003491_626_1135 169
155 3300050511 nmdc:mga08y16_1594_c1 nmdc:mga08y16_1594_c1_6797_7309 169
156 3300053085 Ga0495619_0090368 Ga0495619_0090368_1295_1819 169
157 2162886007 SwRhRL2b_contig_761439 SwRhRL2b_0306.00005820 170
158 3300005262 Ga0065165_1000302 Ga0065165_100030235 170
159 3300005289 Ga0065704_10372805 Ga0065704_103728052 170
160 3300013100 Ga0157373_10620867 Ga0157373_106208672 170
161 3300013104 Ga0157370_10827137 Ga0157370_108271372 170
162 3300025292 Ga0209676_1000363 Ga0209676_100036371 170
163 3300025929 Ga0207664_10676440 Ga0207664_106764401 170
164 3300030732 Ga0316176_1102297 Ga0316176_11022977 170
165 3300030733 Ga0314311_1129672 Ga0314311_11296721 170
166 3300030744 Ga0316181_1132288 Ga0316181_11322882 170
167 3300031852 Ga0307410_10226897 Ga0307410_102268971 170
168 3300031911 Ga0307412_10033374 Ga0307412_100333743 170
169 3300031911 Ga0307412_10340290 Ga0307412_103402902 170
170 3300032005 Ga0307411_10073655 Ga0307411_100736551 170
171 2162886007 SwRhRL2b_contig_2712303 SwRhRL2b_0469.00004360 171
172 2162886007 SwRhRL2b_contig_857275 SwRhRL2b_0805.00002430 171
173 3300001915 JGI24741J21665_1008996 JGI24741J21665_10089962 171
174 3300001990 JGI24737J22298_10000116 JGI24737J22298_100001163 171
175 3300002067 JGI24735J21928_10000015 JGI24735J21928_1000001527 171
176 3300002741 JGI25157J39369_1004384 JGI25157J39369_10043842 171
177 3300002773 JGI25152J39213_1000300 JGI25152J39213_100030019 171
178 3300002774 JGI25150J39212_1000023 JGI25150J39212_100002312 171
179 3300003187 JGI25151J46595_10000082 JGI25151J46595_1000008212 171
180 3300003215 JGI25153J46596_10000060 JGI25153J46596_1000006013 171
181 3300003316 rootH1_10013584 rootH1_100135846 171
182 3300003320 rootH2_10264962 rootH2_102649621 171
183 3300003791 Ga0055530_10001816 Ga0055530_1000181610 171
184 3300005288 Ga0065714_10064439 Ga0065714_100644394 171
185 3300005288 Ga0065714_10078965 Ga0065714_100789652 171
186 3300005288 Ga0065714_10213226 Ga0065714_102132262 171
187 3300005288 Ga0065714_10243602 Ga0065714_102436022 171
188 3300005327 Ga0070658_10000008 Ga0070658_10000008261 171
189 3300005327 Ga0070658_10020421 Ga0070658_100204214 171
190 3300005327 Ga0070658_10241133 Ga0070658_102411332 171
191 3300005329 Ga0070683_100006005 Ga0070683_1000060056 171
192 3300005336 Ga0070680_100013348 Ga0070680_1000133484 171
193 3300005339 Ga0070660_100224828 Ga0070660_1002248282 171
194 3300005339 Ga0070660_100265553 Ga0070660_1002655532 171
195 3300005341 Ga0070691_10292338 Ga0070691_102923381 171
196 3300005355 Ga0070671_100009462 Ga0070671_1000094627 171
197 3300005364 Ga0070673_100197310 Ga0070673_1001973101 171
198 3300005366 Ga0070659_100049679 Ga0070659_1000496792 171
199 3300005366 Ga0070659_100060784 Ga0070659_1000607842 171
200 3300005455 Ga0070663_100002467 Ga0070663_1000024672 171
201 3300005457 Ga0070662_100000863 Ga0070662_10000086313 171
202 3300005458 Ga0070681_10002959 Ga0070681_1000295914 171
203 3300005530 Ga0070679_100004682 Ga0070679_10000468210 171
204 3300005535 Ga0070684_100016169 Ga0070684_1000161693 171
205 3300005535 Ga0070684_101318657 Ga0070684_1013186571 171
206 3300005539 Ga0068853_100029060 Ga0068853_1000290602 171
207 3300005545 Ga0070695_100422285 Ga0070695_1004222851 171
208 3300005563 Ga0068855_100000130 Ga0068855_10000013024 171
209 3300005563 Ga0068855_100218901 Ga0068855_1002189012 171
210 3300005563 Ga0068855_100221709 Ga0068855_1002217092 171
211 3300005563 Ga0068855_100432045 Ga0068855_1004320452 171
212 3300005577 Ga0068857_100011349 Ga0068857_1000113494 171
213 3300005614 Ga0068856_100000112 Ga0068856_10000011242 171
214 3300005614 Ga0068856_100015216 Ga0068856_1000152166 171
215 3300005614 Ga0068856_100049148 Ga0068856_1000491483 171
216 3300005614 Ga0068856_100435181 Ga0068856_1004351812 171
217 3300006175 Ga0070712_100314707 Ga0070712_1003147072 171
218 3300006195 Ga0075366_10000929 Ga0075366_1000092913 171
219 3300009036 Ga0105244_10219430 Ga0105244_102194301 171
220 3300009093 Ga0105240_10893566 Ga0105240_108935662 171
221 3300009148 Ga0105243_10000043 Ga0105243_1000004344 171
222 3300009174 Ga0105241_10000116 Ga0105241_1000011635 171
223 3300009545 Ga0105237_10024919 Ga0105237_100249192 171
224 3300010375 Ga0105239_10000049 Ga0105239_1000004993 171
225 3300010375 Ga0105239_10038256 Ga0105239_100382564 171
226 3300010375 Ga0105239_11489971 Ga0105239_114899711 171
227 3300013100 Ga0157373_10000089 Ga0157373_1000008913 171
228 3300013100 Ga0157373_10004564 Ga0157373_100045646 171
229 3300013100 Ga0157373_10005698 Ga0157373_100056984 171
230 3300013100 Ga0157373_10030332 Ga0157373_100303325 171
231 3300013100 Ga0157373_10098003 Ga0157373_100980032 171
232 3300013100 Ga0157373_10125062 Ga0157373_101250622 171
233 3300013102 Ga0157371_10000511 Ga0157371_1000051114 171
234 3300013102 Ga0157371_10002079 Ga0157371_1000207912 171
235 3300013102 Ga0157371_10006312 Ga0157371_100063124 171
236 3300013102 Ga0157371_10024916 Ga0157371_100249164 171
237 3300013102 Ga0157371_10033505 Ga0157371_100335052 171
238 3300013104 Ga0157370_10000637 Ga0157370_1000063741 171
239 3300013104 Ga0157370_10019842 Ga0157370_100198425 171
240 3300013104 Ga0157370_10037726 Ga0157370_100377263 171
241 3300013104 Ga0157370_10084790 Ga0157370_100847902 171
242 3300013104 Ga0157370_10100876 Ga0157370_101008762 171
243 3300013104 Ga0157370_10109225 Ga0157370_101092252 171
244 3300013104 Ga0157370_10219387 Ga0157370_102193872 171
245 3300013104 Ga0157370_10676081 Ga0157370_106760812 171
246 3300013104 Ga0157370_10758411 Ga0157370_107584111 171
247 3300013105 Ga0157369_10000594 Ga0157369_100005945 171
248 3300013105 Ga0157369_10022085 Ga0157369_100220858 171
249 3300013105 Ga0157369_10055728 Ga0157369_100557285 171
250 3300013105 Ga0157369_10210057 Ga0157369_102100573 171
251 3300013105 Ga0157369_10355570 Ga0157369_103555702 171
252 3300013105 Ga0157369_10945236 Ga0157369_109452361 171
253 3300013296 Ga0157374_10000427 Ga0157374_100004276 171
254 3300013296 Ga0157374_10206156 Ga0157374_102061562 171
255 3300013297 Ga0157378_10096044 Ga0157378_100960442 171
256 3300013306 Ga0163162_10000123 Ga0163162_1000012336 171
257 3300013306 Ga0163162_10075378 Ga0163162_100753782 171
258 3300013307 Ga0157372_10000039 Ga0157372_1000003981 171
259 3300013307 Ga0157372_10000241 Ga0157372_1000024136 171
260 3300013307 Ga0157372_10003208 Ga0157372_100032089 171
261 3300013307 Ga0157372_10007944 Ga0157372_100079445 171
262 3300013307 Ga0157372_10059391 Ga0157372_100593913 171
263 3300013307 Ga0157372_11653994 Ga0157372_116539941 171
264 3300013308 Ga0157375_10017849 Ga0157375_100178493 171
265 3300013308 Ga0157375_10019499 Ga0157375_100194995 171
266 3300013308 Ga0157375_10058487 Ga0157375_100584872 171
267 3300013308 Ga0157375_10192537 Ga0157375_101925372 171
268 3300014497 Ga0182008_10000020 Ga0182008_10000020155 171
269 3300014497 Ga0182008_10000461 Ga0182008_100004612 171
270 3300015261 Ga0182006_1000108 Ga0182006_100010872 171
271 3300015261 Ga0182006_1000360 Ga0182006_10003605 171
272 3300015261 Ga0182006_1004894 Ga0182006_10048942 171
273 3300015262 Ga0182007_10000024 Ga0182007_1000002436 171
274 3300015682 Ga0183373_1002 Ga0183373_100237 171
275 3300017792 Ga0163161_10000093 Ga0163161_1000009338 171
276 3300017792 Ga0163161_10000094 Ga0163161_1000009427 171
277 3300017792 Ga0163161_10001375 Ga0163161_1000137511 171
278 3300017792 Ga0163161_10118688 Ga0163161_101186881 171
279 3300017792 Ga0163161_10323010 Ga0163161_103230102 171
280 3300020082 Ga0206353_11169242 Ga0206353_111692421 171
281 3300020610 Ga0154015_1481443 Ga0154015_14814431 171
282 3300021361 Ga0213872_10008236 Ga0213872_100082363 171
283 3300022467 Ga0224712_10514122 Ga0224712_105141221 171
284 3300025245 Ga0207425_1000051 Ga0207425_100005146 171
285 3300025250 Ga0209026_1000304 Ga0209026_100030432 171
286 3300025250 Ga0209026_1001474 Ga0209026_10014746 171
287 3300025250 Ga0209026_1004480 Ga0209026_10044802 171
288 3300025258 Ga0209129_1000121 Ga0209129_100012113 171
289 3300025261 Ga0209233_1020336 Ga0209233_10203362 171
290 3300025292 Ga0209676_1000022 Ga0209676_100002234 171
291 3300025294 Ga0209025_1000160 Ga0209025_1000160114 171
292 3300025297 Ga0209758_1000147 Ga0209758_1000147114 171
293 3300025298 Ga0209050_1000020 Ga0209050_1000020507 171
294 3300025904 Ga0207647_10000018 Ga0207647_1000001838 171
295 3300025904 Ga0207647_10000256 Ga0207647_1000025612 171
296 3300025904 Ga0207647_10082917 Ga0207647_100829172 171
297 3300025904 Ga0207647_10108607 Ga0207647_101086072 171
298 3300025909 Ga0207705_10000035 Ga0207705_100000352 171
299 3300025909 Ga0207705_10020066 Ga0207705_100200663 171
300 3300025909 Ga0207705_10606765 Ga0207705_106067652 171
301 3300025911 Ga0207654_10006275 Ga0207654_100062756 171
302 3300025912 Ga0207707_10004330 Ga0207707_100043305 171
303 3300025913 Ga0207695_10011959 Ga0207695_100119592 171
304 3300025914 Ga0207671_10028615 Ga0207671_100286152 171
305 3300025915 Ga0207693_10290651 Ga0207693_102906512 171
306 3300025917 Ga0207660_10054438 Ga0207660_100544382 171
307 3300025919 Ga0207657_10295608 Ga0207657_102956082 171
308 3300025931 Ga0207644_10004990 Ga0207644_100049908 171
309 3300025932 Ga0207690_10001492 Ga0207690_1000149210 171
310 3300025932 Ga0207690_10034122 Ga0207690_100341223 171
311 3300025932 Ga0207690_10038527 Ga0207690_100385272 171
312 3300025933 Ga0207706_10000013 Ga0207706_10000013152 171
313 3300025935 Ga0207709_10000021 Ga0207709_10000021267 171
314 3300025944 Ga0207661_10006414 Ga0207661_100064147 171
315 3300025949 Ga0207667_10000274 Ga0207667_1000027432 171
316 3300025949 Ga0207667_10602580 Ga0207667_106025802 171
317 3300026023 Ga0207677_10218176 Ga0207677_102181761 171
318 3300026041 Ga0207639_10035061 Ga0207639_100350612 171
319 3300026067 Ga0207678_10006451 Ga0207678_100064519 171
320 3300026078 Ga0207702_10000278 Ga0207702_1000027837 171
321 3300026078 Ga0207702_10020477 Ga0207702_100204773 171
322 3300026078 Ga0207702_10046253 Ga0207702_100462534 171
323 3300026078 Ga0207702_10635114 Ga0207702_106351142 171
324 3300026116 Ga0207674_10077096 Ga0207674_100770964 171
325 3300028800 Ga0265338_10047663 Ga0265338_100476633 171
326 3300030731 Ga0316177_1003264 Ga0316177_10032642 171
327 3300030742 Ga0316183_1003890 Ga0316183_100389022 171
328 3300030744 Ga0316181_1131993 Ga0316181_11319932 171
329 3300030744 Ga0316181_1289094 Ga0316181_12890942 171
330 3300030745 Ga0316182_1277066 Ga0316182_12770661 171
331 3300031251 Ga0265327_10263153 Ga0265327_102631532 171
332 3300031548 Ga0307408_100000517 Ga0307408_1000005174 171
333 3300031548 Ga0307408_100001538 Ga0307408_1000015385 171
334 3300031548 Ga0307408_100055924 Ga0307408_1000559241 171
335 3300031731 Ga0307405_10000011 Ga0307405_1000001131 171
336 3300031731 Ga0307405_10131614 Ga0307405_101316142 171
337 3300031903 Ga0307407_10000163 Ga0307407_100001636 171
338 3300031911 Ga0307412_10000001 Ga0307412_10000001240 171
339 3300031911 Ga0307412_10001430 Ga0307412_100014303 171
340 3300031911 Ga0307412_10009032 Ga0307412_100090326 171
341 3300031911 Ga0307412_10590568 Ga0307412_105905682 171
342 3300031995 Ga0307409_101110223 Ga0307409_1011102232 171
343 3300032002 Ga0307416_100000050 Ga0307416_10000005058 171
344 3300032004 Ga0307414_10005075 Ga0307414_100050754 171
345 3300032004 Ga0307414_10016198 Ga0307414_100161985 171
346 3300032004 Ga0307414_10048868 Ga0307414_100488683 171
347 3300032004 Ga0307414_10118515 Ga0307414_101185152 171
348 3300032004 Ga0307414_10199171 Ga0307414_101991712 171
349 3300032004 Ga0307414_10477061 Ga0307414_104770611 171
350 3300032004 Ga0307414_10880059 Ga0307414_108800592 171
351 3300035086 Ga0373934_0255602 Ga0373934_0255602_83_670 171
352 3300036401 Ga0373937_0255463 Ga0373937_0255463_819_1406 171
353 3300036712 Ga0316584_0130840 Ga0316584_0130840_533_1048 171
354 3300037312 Ga0395899_0000282 Ga0395899_0000282_47314_47832 171
355 3300037312 Ga0395899_0052363 Ga0395899_0052363_2305_2823 171
356 3300037312 Ga0395899_0525764 Ga0395899_0525764_226_741 171
357 3300037418 Ga0395900_0000195 Ga0395900_0000195_49280_49795 171
358 3300037418 Ga0395900_0009107 Ga0395900_0009107_235_753 171
359 3300037418 Ga0395900_0961876 Ga0395900_0961876_100_618 171
360 3300037466 Ga0395898_0200160 Ga0395898_0200160_703_1221 171
361 3300037471 Ga0395905_0000993 Ga0395905_0000993_27796_28314 171
362 3300038443 Ga0395901_0005293 Ga0395901_0005293_4493_5011 171
363 3300038443 Ga0395901_0526280 Ga0395901_0526280_569_1084 171
364 3300039447 Ga0436361_1126675 Ga0436361_1126675_5543_6058 171
365 3300041491 Ga0451833_0138410 Ga0451833_0138410_38_553 171
366 3300042014 Ga0439457_010490 Ga0439457_010490_1376_1891 171
367 3300042532 Ga0450893_0066459 Ga0450893_0066459_25_549 171
368 3300044684 Ga0466966_0008901 Ga0466966_0008901_4131_4649 171
369 3300044693 Ga0466961_0049757 Ga0466961_0049757_1703_2221 171
370 3300044712 Ga0453684_0201862 Ga0453684_0201862_983_1534 171
371 3300044735 Ga0466968_0239455 Ga0466968_0239455_307_822 171
372 3300044842 Ga0466957_0354344 Ga0466957_0354344_126_644 171
373 3300045051 Ga0451576_0047928 Ga0451576_0047928_830_1381 171
374 3300045836 Ga0466958_0065994 Ga0466958_0065994_1116_1634 171
375 3300046453 Ga0495627_028556 Ga0495627_028556_736_1251 171
376 3300046471 Ga0495650_0000144 Ga0495650_0000144_125192_125707 171
377 3300046492 Ga0495585_0000091 Ga0495585_0000091_42142_42657 171
378 3300046507 Ga0495606_0009276 Ga0495606_0009276_7275_7790 171
379 3300046512 Ga0495610_0000219 Ga0495610_0000219_45812_46327 171
380 3300046512 Ga0495610_0002599 Ga0495610_0002599_3023_3538 171
381 3300046512 Ga0495610_0007529 Ga0495610_0007529_2787_3302 171
382 3300046513 Ga0495616_0017439 Ga0495616_0017439_13_528 171
383 3300046520 Ga0495637_0040482 Ga0495637_0040482_975_1490 171
384 3300046523 Ga0495644_0007582 Ga0495644_0007582_1523_2041 171
385 3300046538 Ga0495609_0015348 Ga0495609_0015348_2954_3469 171
386 3300046538 Ga0495609_0056150 Ga0495609_0056150_571_1086 171
387 3300046557 Ga0495622_0184275 Ga0495622_0184275_33_548 171
388 3300046558 Ga0495633_0005839 Ga0495633_0005839_239_754 171
389 3300046558 Ga0495633_0034796 Ga0495633_0034796_1237_1752 171
390 3300046660 Ga0495625_0000059 Ga0495625_0000059_51058_51573 171
391 3300046663 Ga0495635_0049654 Ga0495635_0049654_2161_2748 171
392 3300046665 Ga0495661_0018331 Ga0495661_0018331_1005_1520 171
393 3300046694 Ga0495649_0000031 Ga0495649_0000031_23768_24283 171
394 3300047443 Ga0495687_001100 Ga0495687_001100_2338_2853 171
395 3300047447 Ga0495685_088254 Ga0495685_088254_151_669 171
396 3300047472 Ga0495686_0091153 Ga0495686_0091153_966_1514 171
397 3300048919 Ga0496116_0072647 Ga0496116_0072647_293_814 171
398 3300048920 Ga0496117_0008262 Ga0496117_0008262_4479_5000 171
399 3300048921 Ga0496118_0033378 Ga0496118_0033378_976_1497 171
400 3300048925 Ga0496122_0026512 Ga0496122_0026512_2509_3030 171
401 3300048926 Ga0496123_0007418 Ga0496123_0007418_7725_8246 171
402 3300048927 Ga0496124_0080857 Ga0496124_0080857_1954_2475 171
403 3300048929 Ga0496126_0550132 Ga0496126_0550132_78_599 171
404 3300049459 Ga0495678_137199 Ga0495678_137199_152_667 171
405 3300049571 Ga0501034_0790621 Ga0501034_0790621_49_564 171
406 3300049649 Ga0501198_019543 Ga0501198_019543_80_595 171
407 3300049661 Ga0501217_066156 Ga0501217_066156_317_832 171
408 3300049663 Ga0501223_001032 Ga0501223_001032_2682_3197 171
409 3300049679 Ga0501249_027433 Ga0501249_027433_391_906 171
410 3300049758 Ga0501241_007212 Ga0501241_007212_282_797 171
411 3300049758 Ga0501241_014018 Ga0501241_014018_323_838 171
412 3300050493 nmdc:mga0k408_783_c1 nmdc:mga0k408_783_c1_16107_16622 171
413 3300053093 Ga0500651_0001126 Ga0500651_0001126_8227_8742 171
414 3300053108 Ga0500562_040253 Ga0500562_040253_522_1040 171
415 3300053108 Ga0500562_073294 Ga0500562_073294_97_615 171
416 3300053151 Ga0500604_0019958 Ga0500604_0019958_1179_1697 171
417 3300053156 Ga0500622_0000017 Ga0500622_0000017_235_753 171
418 3300053156 Ga0500622_0000387 Ga0500622_0000387_292_810 171
419 iso_pu_bacteria 2599185184 2599482003 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10652

DUF2480

Protein of unknown function (DUF2480)

39

203

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nte-assembly1.cif.gz_A crystal structure of deph 0.4711 27 99
6hts-assembly1.cif.gz_H cryo-em structure of the human ino80 complex bound to nucleosome 0.4458 38 110
4weo-assembly1.cif.gz_A crystal structure of a putative acetoin(diacetyl) reductase burkholderia cenocepacia 0.4377 27 134
4weo-assembly1.cif.gz_B crystal structure of a putative acetoin(diacetyl) reductase burkholderia cenocepacia 0.4374 27 134
4weo-assembly1.cif.gz_C crystal structure of a putative acetoin(diacetyl) reductase burkholderia cenocepacia 0.4259 27 134
ID Description Score Start End Superfamily
af_Q2R4H4_170_321_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5782 62 98 3.40.50.300
3lklB00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.5486 29 98 3.30.750.24
af_A0A7I2V3D3_1_121_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5313 38 100 3.30.420.40
2q0xA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.5278 50 114 3.40.50.1820
af_P80428_1_151_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5176 38 99 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A496P0Q0-F1-model_v4 DUF2480 family protein 0.9713 105 169
AF-A0A7C5MZ91-F1-model_v4 DUF2480 family protein 0.9693 45 171
AF-A0A2I2DWX7-F1-model_v4 DUF2480 domain containing protein 0.9688 17 170
AF-A0A7Y1VN74-F1-model_v4 DUF2480 family protein 0.9683 39 170
AF-A0A2T2VLA3-F1-model_v4 DUF2480 domain-containing protein 0.9636 24 170

Feature Viewer

pLDDT pTM Quality
89.91 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map