F439235
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 418 | 262 | 408 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300005437|Ga0070710_10594148|Ga0070710_105941482 |
| Length | 177 |
| Sequence | MDTRKNSETNPTKNNTTVERKSDRELVVTRTFNGPAHVVFNAWTKPELFQRWWAPKDFGVLLLSCELDARTGGKYRLVFRHPSTGEPMPFFGRYVEVIPSKRIVWTNDEGEEPGAVTTVTFEENAGETVVVLHDLYPSKEALDEGIASGSTNGYPMQFEQLDELLVDLGASVGGSPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 2 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 3 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 4 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 5 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 6 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 7 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 8 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 9 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 10 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 11 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 14 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 15 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 175 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 176 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 177 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 189 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 190 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 191 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 192 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 193 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 194 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 195 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 196 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 197 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 198 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 199 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 200 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 201 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 202 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 203 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 204 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 205 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 206 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 225 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 226 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 228 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 229 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 230 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 231 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 232 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 257 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 258 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 259 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 260 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 261 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.89 |
| Metatranscriptomes | 0.72 |
| Isolates | 2.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.81 |
| Nodule | 0 |
| Rhizoplane | 1.44 |
| Rhizosphere | 82.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1004396 | 3300001915 | Bacteria | 3138 |
| 2 | JGI24740J21852_10004914 | 3300001979 | Bacteria | 5689 |
| 3 | JGI24740J21852_10038287 | 3300001979 | Bacteria | 1472 |
| 4 | JGI25156J39149_1031792 | 3300002705 | Bacteria | 783 |
| 5 | JGI25162J39368_1000938 | 3300002737 | Bacteria | 18755 |
| 6 | JGI25164J39214_1000109 | 3300002772 | Bacteria | 78254 |
| 7 | JGI25165J46597_1000347 | 3300003214 | Bacteria | 52707 |
| 8 | JGI25153J46596_10010148 | 3300003215 | Bacteria | 4287 |
| 9 | rootH1_10065909 | 3300003316 | Bacteria | 7222 |
| 10 | rootH1_10092899 | 3300003316 | Bacteria | 1650 |
| 11 | rootH2_10020055 | 3300003320 | Bacteria | 1709 |
| 12 | rootL2_10188422 | 3300003322 | Bacteria | 2193 |
| 13 | Ga0055539_1002038 | 3300003752 | Bacteria | 3314 |
| 14 | Ga0055527_1000109 | 3300003760 | Bacteria | 58566 |
| 15 | Ga0055527_1001940 | 3300003760 | Bacteria | 3823 |
| 16 | Ga0055535_1000344 | 3300003761 | Bacteria | 46295 |
| 17 | Ga0055535_1000538 | 3300003761 | Bacteria | 32551 |
| 18 | Ga0055535_1000871 | 3300003761 | Bacteria | 21152 |
| 19 | Ga0055542_1000101 | 3300003762 | Bacteria | 116277 |
| 20 | Ga0055542_1000166 | 3300003762 | Bacteria | 83233 |
| 21 | Ga0055542_1000265 | 3300003762 | Bacteria | 58566 |
| 22 | Ga0055529_1000105 | 3300003763 | Bacteria | 123670 |
| 23 | Ga0055529_1000347 | 3300003763 | Bacteria | 51358 |
| 24 | Ga0058861_11707922 | 3300004800 | Bacteria | 897 |
| 25 | Ga0065707_10155161 | 3300005295 | Bacteria | 1611 |
| 26 | Ga0070658_10542787 | 3300005327 | Bacteria | 1006 |
| 27 | Ga0070676_10809538 | 3300005328 | Bacteria | 692 |
| 28 | Ga0070683_100028598 | 3300005329 | Bacteria | 5039 |
| 29 | Ga0070670_100004148 | 3300005331 | Bacteria | 12116 |
| 30 | Ga0070666_10055804 | 3300005335 | Bacteria | 2667 |
| 31 | Ga0070680_100195024 | 3300005336 | Bacteria | 1707 |
| 32 | Ga0070680_100371762 | 3300005336 | Bacteria | 1216 |
| 33 | Ga0070680_100550617 | 3300005336 | Bacteria | 989 |
| 34 | Ga0070682_100008613 | 3300005337 | Bacteria | 5760 |
| 35 | Ga0070682_100201240 | 3300005337 | Bacteria | 1405 |
| 36 | Ga0070682_100420305 | 3300005337 | Bacteria | 1016 |
| 37 | Ga0068868_100041144 | 3300005338 | Bacteria | 3600 |
| 38 | Ga0068868_100809646 | 3300005338 | Bacteria | 846 |
| 39 | Ga0070660_100279254 | 3300005339 | Bacteria | 1366 |
| 40 | Ga0070689_100000006 | 3300005340 | Bacteria | 332562 |
| 41 | Ga0070691_10190104 | 3300005341 | Bacteria | 1073 |
| 42 | Ga0070661_100242842 | 3300005344 | Bacteria | 1387 |
| 43 | Ga0070692_10110011 | 3300005345 | Bacteria | 1522 |
| 44 | Ga0070659_100176035 | 3300005366 | Bacteria | 1754 |
| 45 | Ga0070703_10017054 | 3300005406 | Bacteria | 2091 |
| 46 | Ga0070709_10043762 | 3300005434 | Bacteria | 2770 |
| 47 | Ga0070710_10594148 | 3300005437 | Bacteria | 770 |
| 48 | Ga0070711_100294618 | 3300005439 | Bacteria | 1288 |
| 49 | Ga0070708_100084847 | 3300005445 | Bacteria | 2873 |
| 50 | Ga0070681_10027506 | 3300005458 | Bacteria | 5717 |
| 51 | Ga0070681_10035481 | 3300005458 | Bacteria | 5010 |
| 52 | Ga0070681_10412233 | 3300005458 | Bacteria | 1263 |
| 53 | Ga0068867_100031699 | 3300005459 | Bacteria | 3819 |
| 54 | Ga0070706_100570396 | 3300005467 | Bacteria | 1052 |
| 55 | Ga0070699_100004500 | 3300005518 | Bacteria | 12333 |
| 56 | Ga0070679_100030738 | 3300005530 | Bacteria | 5304 |
| 57 | Ga0070679_100039549 | 3300005530 | Bacteria | 4687 |
| 58 | Ga0070679_100043119 | 3300005530 | Bacteria | 4494 |
| 59 | Ga0070684_100008688 | 3300005535 | Bacteria | 7962 |
| 60 | Ga0070684_100014007 | 3300005535 | Bacteria | 6484 |
| 61 | Ga0070684_100240995 | 3300005535 | Bacteria | 1652 |
| 62 | Ga0070684_100812199 | 3300005535 | Bacteria | 874 |
| 63 | Ga0070697_100333711 | 3300005536 | Bacteria | 1307 |
| 64 | Ga0068853_100446225 | 3300005539 | Bacteria | 1216 |
| 65 | Ga0068853_100587000 | 3300005539 | Bacteria | 1057 |
| 66 | Ga0068853_101044146 | 3300005539 | Bacteria | 787 |
| 67 | Ga0070695_100018608 | 3300005545 | Bacteria | 4219 |
| 68 | Ga0070695_100281640 | 3300005545 | Bacteria | 1222 |
| 69 | Ga0070696_100143774 | 3300005546 | Bacteria | 1746 |
| 70 | Ga0070696_100649611 | 3300005546 | Bacteria | 855 |
| 71 | Ga0070693_100048142 | 3300005547 | Bacteria | 2427 |
| 72 | Ga0070665_100010232 | 3300005548 | Bacteria | 9489 |
| 73 | Ga0070704_100035905 | 3300005549 | Bacteria | 3372 |
| 74 | Ga0068855_100320706 | 3300005563 | Bacteria | 1713 |
| 75 | Ga0068855_100454738 | 3300005563 | Bacteria | 1397 |
| 76 | Ga0068855_100575928 | 3300005563 | Bacteria | 1216 |
| 77 | Ga0068855_100699765 | 3300005563 | Bacteria | 1084 |
| 78 | Ga0070664_100000498 | 3300005564 | Bacteria | 29740 |
| 79 | Ga0070664_100046208 | 3300005564 | Bacteria | 3678 |
| 80 | Ga0070664_100939654 | 3300005564 | Bacteria | 811 |
| 81 | Ga0068857_100000091 | 3300005577 | Bacteria | 52422 |
| 82 | Ga0068857_100392232 | 3300005577 | Bacteria | 1291 |
| 83 | Ga0068857_100566341 | 3300005577 | Bacteria | 1071 |
| 84 | Ga0068854_100007548 | 3300005578 | Bacteria | 6950 |
| 85 | Ga0068854_100560489 | 3300005578 | Bacteria | 970 |
| 86 | Ga0068854_100783900 | 3300005578 | Bacteria | 830 |
| 87 | Ga0068856_100003014 | 3300005614 | Bacteria | 17243 |
| 88 | Ga0068856_100603160 | 3300005614 | Bacteria | 1119 |
| 89 | Ga0068852_100061068 | 3300005616 | Bacteria | 3274 |
| 90 | Ga0068852_100210954 | 3300005616 | Bacteria | 1842 |
| 91 | Ga0068859_100134848 | 3300005617 | Bacteria | 2541 |
| 92 | Ga0068864_100001844 | 3300005618 | Bacteria | 17428 |
| 93 | Ga0068866_10002628 | 3300005718 | Bacteria | 7426 |
| 94 | Ga0068866_10656311 | 3300005718 | Bacteria | 715 |
| 95 | Ga0068861_100230311 | 3300005719 | Bacteria | 1571 |
| 96 | Ga0068851_10092273 | 3300005834 | Bacteria | 1595 |
| 97 | Ga0068851_10752305 | 3300005834 | Bacteria | 603 |
| 98 | Ga0068870_11008459 | 3300005840 | Bacteria | 594 |
| 99 | Ga0068863_100021473 | 3300005841 | Bacteria | 6161 |
| 100 | Ga0068863_100122092 | 3300005841 | Bacteria | 2485 |
| 101 | Ga0068863_101049648 | 3300005841 | Bacteria | 819 |
| 102 | Ga0081455_10340971 | 3300005937 | Bacteria | 1061 |
| 103 | Ga0081538_10014827 | 3300005981 | Bacteria | 6076 |
| 104 | Ga0081539_10131904 | 3300005985 | Bacteria | 1226 |
| 105 | Ga0070717_10058759 | 3300006028 | Bacteria | 3180 |
| 106 | Ga0075364_10027407 | 3300006051 | Bacteria | 3639 |
| 107 | Ga0070715_10184048 | 3300006163 | Bacteria | 1049 |
| 108 | Ga0070716_100021410 | 3300006173 | Bacteria | 3407 |
| 109 | Ga0070712_100634753 | 3300006175 | Bacteria | 906 |
| 110 | Ga0097621_100315975 | 3300006237 | Bacteria | 1383 |
| 111 | Ga0068871_100068412 | 3300006358 | Bacteria | 2916 |
| 112 | Ga0068871_101221697 | 3300006358 | Bacteria | 705 |
| 113 | Ga0075428_100115428 | 3300006844 | Bacteria | 2925 |
| 114 | Ga0075433_10518666 | 3300006852 | Bacteria | 1048 |
| 115 | Ga0075434_100022953 | 3300006871 | Bacteria | 6073 |
| 116 | Ga0075436_100528549 | 3300006914 | Bacteria | 865 |
| 117 | Ga0097620_100134837 | 3300006931 | Bacteria | 2541 |
| 118 | Ga0075435_100106206 | 3300007076 | Bacteria | 2331 |
| 119 | Ga0105240_10000405 | 3300009093 | Bacteria | 80014 |
| 120 | Ga0105240_10083188 | 3300009093 | Bacteria | 3928 |
| 121 | Ga0105240_10466822 | 3300009093 | Bacteria | 1409 |
| 122 | Ga0111539_10985082 | 3300009094 | Bacteria | 980 |
| 123 | Ga0105243_11029928 | 3300009148 | Bacteria | 828 |
| 124 | Ga0105241_11154094 | 3300009174 | Bacteria | 732 |
| 125 | Ga0105248_10620037 | 3300009177 | Bacteria | 1220 |
| 126 | Ga0105237_10052067 | 3300009545 | Bacteria | 4111 |
| 127 | Ga0105237_10168382 | 3300009545 | Bacteria | 2190 |
| 128 | Ga0105237_10352671 | 3300009545 | Bacteria | 1476 |
| 129 | Ga0105237_10536076 | 3300009545 | Bacteria | 1177 |
| 130 | Ga0105237_10537069 | 3300009545 | Bacteria | 1176 |
| 131 | Ga0105238_10058059 | 3300009551 | Bacteria | 3879 |
| 132 | Ga0105238_10189017 | 3300009551 | Bacteria | 2036 |
| 133 | Ga0105238_10938642 | 3300009551 | Bacteria | 884 |
| 134 | Ga0105249_10114047 | 3300009553 | Bacteria | 2558 |
| 135 | Ga0105249_11142214 | 3300009553 | Bacteria | 849 |
| 136 | Ga0157373_10050007 | 3300013100 | Bacteria | 2978 |
| 137 | Ga0157371_10206251 | 3300013102 | Bacteria | 1410 |
| 138 | Ga0157370_10000504 | 3300013104 | Bacteria | 48796 |
| 139 | Ga0157370_10034591 | 3300013104 | Bacteria | 4917 |
| 140 | Ga0157370_10044577 | 3300013104 | Bacteria | 4261 |
| 141 | Ga0157369_10027237 | 3300013105 | Bacteria | 6337 |
| 142 | Ga0157369_10288224 | 3300013105 | Bacteria | 1709 |
| 143 | Ga0157372_10049251 | 3300013307 | Bacteria | 4684 |
| 144 | Ga0157372_10096818 | 3300013307 | Bacteria | 3364 |
| 145 | Ga0157372_10468782 | 3300013307 | Bacteria | 1468 |
| 146 | Ga0157372_10504613 | 3300013307 | Bacteria | 1410 |
| 147 | Ga0163163_10050457 | 3300014325 | Bacteria | 4098 |
| 148 | Ga0163163_10053802 | 3300014325 | Bacteria | 3975 |
| 149 | Ga0163163_11585409 | 3300014325 | Bacteria | 716 |
| 150 | Ga0157379_10113089 | 3300014968 | Bacteria | 2440 |
| 151 | Ga0182005_1007244 | 3300015265 | Bacteria | 3337 |
| 152 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 153 | Ga0206353_11119431 | 3300020082 | Bacteria | 1259 |
| 154 | Ga0154015_1684742 | 3300020610 | Bacteria | 2762 |
| 155 | Ga0209672_100048 | 3300025228 | Bacteria | 240458 |
| 156 | Ga0209672_100183 | 3300025228 | Bacteria | 50722 |
| 157 | Ga0209672_100803 | 3300025228 | Bacteria | 14847 |
| 158 | Ga0209563_100065 | 3300025230 | Bacteria | 257430 |
| 159 | Ga0207427_100153 | 3300025231 | Bacteria | 78306 |
| 160 | Ga0209437_100247 | 3300025233 | Bacteria | 87403 |
| 161 | Ga0209258_100086 | 3300025242 | Bacteria | 240458 |
| 162 | Ga0209258_100198 | 3300025242 | Bacteria | 124013 |
| 163 | Ga0209258_100286 | 3300025242 | Bacteria | 83264 |
| 164 | Ga0209026_1001537 | 3300025250 | Bacteria | 10026 |
| 165 | Ga0209148_1000024 | 3300025254 | Bacteria | 669890 |
| 166 | Ga0209148_1000095 | 3300025254 | Bacteria | 240458 |
| 167 | Ga0209148_1000135 | 3300025254 | Bacteria | 169939 |
| 168 | Ga0209759_1000785 | 3300025256 | Bacteria | 26511 |
| 169 | Ga0209129_1000440 | 3300025258 | Bacteria | 30999 |
| 170 | Ga0209233_1000023 | 3300025261 | Bacteria | 738870 |
| 171 | Ga0209455_1000025 | 3300025272 | Bacteria | 670673 |
| 172 | Ga0209455_1000087 | 3300025272 | Bacteria | 240458 |
| 173 | Ga0209455_1000920 | 3300025272 | Bacteria | 15191 |
| 174 | Ga0209025_1001496 | 3300025294 | Bacteria | 30216 |
| 175 | Ga0209758_1001700 | 3300025297 | Bacteria | 24739 |
| 176 | Ga0209256_1015633 | 3300025299 | Bacteria | 2640 |
| 177 | Ga0207653_10017487 | 3300025885 | Bacteria | 2257 |
| 178 | Ga0207642_10009404 | 3300025899 | Bacteria | 3398 |
| 179 | Ga0207642_10331474 | 3300025899 | Bacteria | 892 |
| 180 | Ga0207680_10039433 | 3300025903 | Bacteria | 2741 |
| 181 | Ga0207647_10002489 | 3300025904 | Bacteria | 13948 |
| 182 | Ga0207647_10078430 | 3300025904 | Bacteria | 1984 |
| 183 | Ga0207647_10189779 | 3300025904 | Bacteria | 1191 |
| 184 | Ga0207699_10034559 | 3300025906 | Bacteria | 2869 |
| 185 | Ga0207645_10058456 | 3300025907 | Bacteria | 2462 |
| 186 | Ga0207705_10032086 | 3300025909 | Bacteria | 3752 |
| 187 | Ga0207705_10266030 | 3300025909 | Bacteria | 1310 |
| 188 | Ga0207684_10059142 | 3300025910 | Bacteria | 3253 |
| 189 | Ga0207654_10249973 | 3300025911 | Bacteria | 1188 |
| 190 | Ga0207654_10453923 | 3300025911 | Bacteria | 899 |
| 191 | Ga0207707_10001178 | 3300025912 | Bacteria | 24639 |
| 192 | Ga0207707_10012437 | 3300025912 | Bacteria | 7399 |
| 193 | Ga0207707_10022952 | 3300025912 | Bacteria | 5458 |
| 194 | Ga0207695_10015925 | 3300025913 | Bacteria | 8830 |
| 195 | Ga0207695_10059806 | 3300025913 | Bacteria | 3948 |
| 196 | Ga0207695_10741429 | 3300025913 | Bacteria | 863 |
| 197 | Ga0207671_10820688 | 3300025914 | Bacteria | 737 |
| 198 | Ga0207660_10006902 | 3300025917 | Bacteria | 7350 |
| 199 | Ga0207660_10012864 | 3300025917 | Bacteria | 5480 |
| 200 | Ga0207660_10015650 | 3300025917 | Bacteria | 5010 |
| 201 | Ga0207660_10162255 | 3300025917 | Bacteria | 1725 |
| 202 | Ga0207660_10186084 | 3300025917 | Bacteria | 1615 |
| 203 | Ga0207660_11432716 | 3300025917 | Bacteria | 559 |
| 204 | Ga0207662_10078773 | 3300025918 | Bacteria | 2006 |
| 205 | Ga0207657_10014092 | 3300025919 | Bacteria | 7823 |
| 206 | Ga0207657_10081446 | 3300025919 | Bacteria | 2719 |
| 207 | Ga0207649_10006172 | 3300025920 | Bacteria | 6503 |
| 208 | Ga0207649_10258119 | 3300025920 | Bacteria | 1258 |
| 209 | Ga0207652_10003182 | 3300025921 | Bacteria | 13654 |
| 210 | Ga0207652_10011326 | 3300025921 | Bacteria | 7186 |
| 211 | Ga0207652_10061250 | 3300025921 | Bacteria | 3249 |
| 212 | Ga0207652_10304457 | 3300025921 | Bacteria | 1439 |
| 213 | Ga0207646_10009423 | 3300025922 | Bacteria | 9653 |
| 214 | Ga0207694_10215529 | 3300025924 | Bacteria | 1565 |
| 215 | Ga0207694_10548850 | 3300025924 | Bacteria | 970 |
| 216 | Ga0207650_10041976 | 3300025925 | Bacteria | 3355 |
| 217 | Ga0207659_10326357 | 3300025926 | Bacteria | 1267 |
| 218 | Ga0207700_10111699 | 3300025928 | Bacteria | 2200 |
| 219 | Ga0207644_10534139 | 3300025931 | Bacteria | 970 |
| 220 | Ga0207644_10717368 | 3300025931 | Bacteria | 834 |
| 221 | Ga0207690_10049579 | 3300025932 | Bacteria | 2800 |
| 222 | Ga0207690_10155158 | 3300025932 | Bacteria | 1701 |
| 223 | Ga0207706_10005342 | 3300025933 | Bacteria | 11973 |
| 224 | Ga0207670_10000003 | 3300025936 | Bacteria | 760449 |
| 225 | Ga0207665_10439877 | 3300025939 | Bacteria | 999 |
| 226 | Ga0207711_10579511 | 3300025941 | Bacteria | 1047 |
| 227 | Ga0207689_10199563 | 3300025942 | Bacteria | 1651 |
| 228 | Ga0207661_10017862 | 3300025944 | Bacteria | 5258 |
| 229 | Ga0207661_10027649 | 3300025944 | Bacteria | 4334 |
| 230 | Ga0207661_10100365 | 3300025944 | Bacteria | 2429 |
| 231 | Ga0207679_10003746 | 3300025945 | Bacteria | 9428 |
| 232 | Ga0207679_10498545 | 3300025945 | Bacteria | 1086 |
| 233 | Ga0207667_10002617 | 3300025949 | Bacteria | 22307 |
| 234 | Ga0207667_10014185 | 3300025949 | Bacteria | 9094 |
| 235 | Ga0207667_10063415 | 3300025949 | Bacteria | 3861 |
| 236 | Ga0207667_10284309 | 3300025949 | Bacteria | 1690 |
| 237 | Ga0207667_10334209 | 3300025949 | Bacteria | 1547 |
| 238 | Ga0207640_10013036 | 3300025981 | Bacteria | 4754 |
| 239 | Ga0207640_10225293 | 3300025981 | Bacteria | 1438 |
| 240 | Ga0207640_11197625 | 3300025981 | Bacteria | 675 |
| 241 | Ga0207640_11411684 | 3300025981 | Bacteria | 624 |
| 242 | Ga0207677_10017768 | 3300026023 | Bacteria | 4251 |
| 243 | Ga0207639_10017805 | 3300026041 | Bacteria | 5038 |
| 244 | Ga0207639_10049588 | 3300026041 | Bacteria | 3184 |
| 245 | Ga0207639_10110867 | 3300026041 | Bacteria | 2236 |
| 246 | Ga0207639_10556085 | 3300026041 | Bacteria | 1054 |
| 247 | Ga0207678_10081928 | 3300026067 | Bacteria | 2761 |
| 248 | Ga0207678_10205678 | 3300026067 | Bacteria | 1684 |
| 249 | Ga0207702_10052748 | 3300026078 | Bacteria | 3442 |
| 250 | Ga0207702_10126996 | 3300026078 | Bacteria | 2291 |
| 251 | Ga0207702_10690765 | 3300026078 | Bacteria | 1005 |
| 252 | Ga0207702_10896489 | 3300026078 | Bacteria | 879 |
| 253 | Ga0207702_11172923 | 3300026078 | Bacteria | 762 |
| 254 | Ga0207641_10007542 | 3300026088 | Bacteria | 9050 |
| 255 | Ga0207641_10273371 | 3300026088 | Bacteria | 1586 |
| 256 | Ga0207641_10397160 | 3300026088 | Bacteria | 1323 |
| 257 | Ga0207648_10014095 | 3300026089 | Bacteria | 7396 |
| 258 | Ga0207676_10004120 | 3300026095 | Bacteria | 10263 |
| 259 | Ga0207676_10202064 | 3300026095 | Bacteria | 1757 |
| 260 | Ga0207674_10000126 | 3300026116 | Bacteria | 88965 |
| 261 | Ga0207674_10009779 | 3300026116 | Bacteria | 10923 |
| 262 | Ga0207674_10104006 | 3300026116 | Bacteria | 2818 |
| 263 | Ga0207674_10140909 | 3300026116 | Bacteria | 2370 |
| 264 | Ga0207675_100280499 | 3300026118 | Bacteria | 1619 |
| 265 | Ga0207683_10924261 | 3300026121 | Bacteria | 810 |
| 266 | Ga0207698_10003097 | 3300026142 | Bacteria | 9981 |
| 267 | Ga0207698_10050027 | 3300026142 | Bacteria | 3185 |
| 268 | Ga0207698_10971590 | 3300026142 | Bacteria | 859 |
| 269 | Ga0268266_10055239 | 3300028379 | Bacteria | 3413 |
| 270 | Ga0268264_10377415 | 3300028381 | Bacteria | 1357 |
| 271 | Ga0307413_10173349 | 3300031824 | Bacteria | 1529 |
| 272 | Ga0307410_10001157 | 3300031852 | Bacteria | 11609 |
| 273 | Ga0307410_10439531 | 3300031852 | Unclassified | 1062 |
| 274 | Ga0307407_10107321 | 3300031903 | Bacteria | 1746 |
| 275 | Ga0307414_10022314 | 3300032004 | Bacteria | 3990 |
| 276 | Ga0307414_11878678 | 3300032004 | Bacteria | 559 |
| 277 | Ga0307411_10071451 | 3300032005 | Bacteria | 2352 |
| 278 | Ga0373958_0124533 | 3300034819 | Bacteria | 625 |
| 279 | Ga0373928_0069403 | 3300035084 | Bacteria | 868 |
| 280 | Ga0373929_0027345 | 3300035085 | Bacteria | 1198 |
| 281 | Ga0373952_0109613 | 3300035092 | Bacteria | 737 |
| 282 | Ga0373941_0046970 | 3300035115 | Bacteria | 1358 |
| 283 | Ga0373960_0015553 | 3300035121 | Bacteria | 1944 |
| 284 | Ga0373931_0019572 | 3300035691 | Bacteria | 3381 |
| 285 | Ga0373931_0808299 | 3300035691 | Bacteria | 625 |
| 286 | Ga0373927_0916013 | 3300035695 | Unclassified | 578 |
| 287 | Ga0373937_1657017 | 3300036401 | Bacteria | 587 |
| 288 | Ga0395899_0024742 | 3300037312 | Bacteria | 4538 |
| 289 | Ga0395900_0200943 | 3300037418 | Bacteria | 2017 |
| 290 | Ga0395900_1096574 | 3300037418 | Bacteria | 713 |
| 291 | Ga0395905_1476504 | 3300037471 | Bacteria | 584 |
| 292 | Ga0436364_0336095 | 3300037853 | Bacteria | 1962 |
| 293 | Ga0436364_0829546 | 3300037853 | Bacteria | 716 |
| 294 | Ga0395901_0027426 | 3300038443 | Bacteria | 5851 |
| 295 | Ga0395901_0170702 | 3300038443 | Bacteria | 2282 |
| 296 | Ga0395901_0869094 | 3300038443 | Bacteria | 886 |
| 297 | Ga0436365_1204574 | 3300039437 | Bacteria | 616 |
| 298 | Ga0436362_0231279 | 3300039453 | Bacteria | 564 |
| 299 | Ga0439436_0011145 | 3300041404 | Bacteria | 2732 |
| 300 | Ga0439439_0003978 | 3300041406 | Bacteria | 3295 |
| 301 | Ga0439445_0024361 | 3300042004 | Bacteria | 1538 |
| 302 | Ga0439449_0106817 | 3300042007 | Bacteria | 1036 |
| 303 | Ga0439434_0152430 | 3300042435 | Bacteria | 766 |
| 304 | Ga0466969_0006538 | 3300044656 | Bacteria | 6200 |
| 305 | Ga0466969_0123669 | 3300044656 | Bacteria | 1203 |
| 306 | Ga0466989_0230362 | 3300044663 | Bacteria | 1075 |
| 307 | Ga0466965_0146003 | 3300044683 | Bacteria | 1234 |
| 308 | Ga0466966_0035928 | 3300044684 | Bacteria | 3200 |
| 309 | Ga0466961_0010597 | 3300044693 | Bacteria | 5882 |
| 310 | Ga0466961_0011336 | 3300044693 | Bacteria | 5700 |
| 311 | Ga0466961_0025716 | 3300044693 | Bacteria | 3784 |
| 312 | Ga0466961_0084887 | 3300044693 | Bacteria | 2002 |
| 313 | Ga0466964_0010085 | 3300044706 | Bacteria | 3560 |
| 314 | Ga0453684_0076459 | 3300044712 | Bacteria | 4203 |
| 315 | Ga0466971_0023105 | 3300044719 | Bacteria | 2771 |
| 316 | Ga0466971_0094494 | 3300044719 | Bacteria | 1370 |
| 317 | Ga0466968_0007475 | 3300044735 | Bacteria | 4156 |
| 318 | Ga0466968_0204548 | 3300044735 | Bacteria | 926 |
| 319 | Ga0466968_0542791 | 3300044735 | Bacteria | 583 |
| 320 | Ga0466970_0012844 | 3300044765 | Bacteria | 4287 |
| 321 | Ga0466970_0164948 | 3300044765 | Bacteria | 1226 |
| 322 | Ga0466957_0024604 | 3300044842 | Bacteria | 3564 |
| 323 | Ga0466957_0058949 | 3300044842 | Bacteria | 2352 |
| 324 | Ga0466959_0124236 | 3300045049 | Bacteria | 1832 |
| 325 | Ga0466959_0147684 | 3300045049 | Bacteria | 1658 |
| 326 | Ga0466958_0139519 | 3300045836 | Bacteria | 1525 |
| 327 | Ga0466958_0168564 | 3300045836 | Bacteria | 1386 |
| 328 | Ga0466967_0016206 | 3300045976 | Bacteria | 5868 |
| 329 | Ga0495603_0067059 | 3300046455 | Bacteria | 2113 |
| 330 | Ga0495580_0008307 | 3300046472 | Bacteria | 8262 |
| 331 | Ga0495580_0133154 | 3300046472 | Bacteria | 1724 |
| 332 | Ga0495582_0000961 | 3300046473 | Bacteria | 16088 |
| 333 | Ga0495639_0263166 | 3300046475 | Bacteria | 855 |
| 334 | Ga0495607_0000038 | 3300046501 | Bacteria | 134124 |
| 335 | Ga0495645_0104890 | 3300046543 | Bacteria | 2006 |
| 336 | Ga0495645_0341680 | 3300046543 | Bacteria | 967 |
| 337 | Ga0495622_0081557 | 3300046557 | Bacteria | 1488 |
| 338 | Ga0495667_0188590 | 3300046559 | Bacteria | 1322 |
| 339 | Ga0495635_0684026 | 3300046663 | Bacteria | 666 |
| 340 | Ga0495588_0072271 | 3300046674 | Bacteria | 1795 |
| 341 | Ga0495657_0217436 | 3300046675 | Bacteria | 1160 |
| 342 | Ga0495623_0144849 | 3300046679 | Bacteria | 1410 |
| 343 | Ga0495623_0320743 | 3300046679 | Bacteria | 851 |
| 344 | Ga0495669_0190081 | 3300046684 | Bacteria | 980 |
| 345 | Ga0495581_0278255 | 3300047315 | Bacteria | 978 |
| 346 | Ga0495604_0079769 | 3300047317 | Bacteria | 2454 |
| 347 | Ga0495604_0258601 | 3300047317 | Bacteria | 1184 |
| 348 | Ga0495675_0045325 | 3300047444 | Bacteria | 2800 |
| 349 | Ga0495675_0113986 | 3300047444 | Bacteria | 1686 |
| 350 | Ga0496104_0718333 | 3300048907 | Bacteria | 907 |
| 351 | Ga0496106_1031130 | 3300048909 | Bacteria | 646 |
| 352 | Ga0496109_0781980 | 3300048912 | Bacteria | 892 |
| 353 | Ga0496112_0328866 | 3300048915 | Bacteria | 1472 |
| 354 | Ga0496113_0597122 | 3300048916 | Bacteria | 884 |
| 355 | Ga0496115_0117634 | 3300048918 | Bacteria | 2186 |
| 356 | Ga0496121_0085815 | 3300048924 | Bacteria | 2476 |
| 357 | Ga0496121_0198141 | 3300048924 | Bacteria | 1434 |
| 358 | Ga0496126_0001142 | 3300048929 | Bacteria | 44140 |
| 359 | Ga0496126_0080874 | 3300048929 | Bacteria | 2874 |
| 360 | Ga0501031_0124483 | 3300049568 | Bacteria | 1684 |
| 361 | Ga0501031_0234200 | 3300049568 | Bacteria | 1194 |
| 362 | Ga0501032_0052055 | 3300049569 | Bacteria | 2759 |
| 363 | Ga0501033_0002213 | 3300049570 | Bacteria | 16756 |
| 364 | Ga0501033_0758883 | 3300049570 | Bacteria | 657 |
| 365 | Ga0501034_0566438 | 3300049571 | Bacteria | 1044 |
| 366 | Ga0501036_0275230 | 3300049572 | Bacteria | 1409 |
| 367 | Ga0501036_0537985 | 3300049572 | Bacteria | 971 |
| 368 | Ga0501037_0124984 | 3300049573 | Bacteria | 1847 |
| 369 | Ga0501038_0047231 | 3300049574 | Bacteria | 3730 |
| 370 | Ga0501038_0049475 | 3300049574 | Bacteria | 3634 |
| 371 | Ga0501039_0094906 | 3300049575 | Bacteria | 2325 |
| 372 | Ga0501042_0571648 | 3300049578 | Bacteria | 822 |
| 373 | Ga0501043_0077717 | 3300049579 | Bacteria | 2607 |
| 374 | Ga0501043_0088716 | 3300049579 | Bacteria | 2430 |
| 375 | Ga0501046_0158841 | 3300049580 | Bacteria | 1701 |
| 376 | Ga0501046_0368162 | 3300049580 | Bacteria | 1041 |
| 377 | Ga0501047_0028609 | 3300049581 | Bacteria | 5374 |
| 378 | Ga0501047_0031592 | 3300049581 | Bacteria | 5108 |
| 379 | Ga0501047_0754836 | 3300049581 | Bacteria | 789 |
| 380 | Ga0501048_0152087 | 3300049582 | Bacteria | 1637 |
| 381 | Ga0501069_0200679 | 3300049585 | Bacteria | 1156 |
| 382 | Ga0501073_0080642 | 3300049589 | Bacteria | 2264 |
| 383 | Ga0501074_0367404 | 3300049590 | Bacteria | 1021 |
| 384 | Ga0501079_0637942 | 3300049741 | Bacteria | 839 |
| 385 | Ga0501035_0001136 | 3300049822 | Bacteria | 27827 |
| 386 | Ga0501035_0193750 | 3300049822 | Bacteria | 1746 |
| 387 | Ga0501035_0373406 | 3300049822 | Bacteria | 1190 |
| 388 | Ga0501044_0022782 | 3300049823 | Bacteria | 6671 |
| 389 | Ga0501044_0026653 | 3300049823 | Bacteria | 6117 |
| 390 | Ga0501044_0081258 | 3300049823 | Bacteria | 3281 |
| 391 | Ga0501044_0361045 | 3300049823 | Bacteria | 1370 |
| 392 | Ga0501044_0362365 | 3300049823 | Bacteria | 1367 |
| 393 | Ga0501044_0367900 | 3300049823 | Bacteria | 1355 |
| 394 | Ga0501044_0369385 | 3300049823 | Bacteria | 1351 |
| 395 | Ga0501044_0480880 | 3300049823 | Bacteria | 1145 |
| 396 | Ga0501045_0216710 | 3300049824 | Bacteria | 1426 |
| 397 | nmdc:mga0n895_102638_c1 | 3300050512 | Bacteria | 2871 |
| 398 | nmdc:mga0rr50_132874_c2 | 3300050513 | Bacteria | 1444 |
| 399 | nmdc:mga08x19_306437_c1 | 3300050514 | Bacteria | 1104 |
| 400 | nmdc:mga0a205_75222_c1 | 3300050515 | Bacteria | 3263 |
| 401 | Ga0500557_220487 | 3300053105 | Bacteria | 603 |
| 402 | Ga0500618_051357 | 3300053125 | Bacteria | 933 |
| 403 | Ga0500568_0022542 | 3300053139 | Bacteria | 2692 |
| 404 | Ga0500590_023725 | 3300053148 | Bacteria | 3183 |
| 405 | Ga0500645_029934 | 3300053730 | Bacteria | 1641 |
| 406 | Ga0501082_0430835 | 3300060353 | Bacteria | 1152 |
| 407 | Ga0466962_0019559 | 3300061719 | Bacteria | 3255 |
| 408 | Ga0466962_0044944 | 3300061719 | Bacteria | 2112 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_1476504 | Ga0395905_1476504_18_533 | 149 |
| 2 | 3300009545 | Ga0105237_10537069 | Ga0105237_105370692 | 150 |
| 3 | 3300013104 | Ga0157370_10034591 | Ga0157370_100345912 | 150 |
| 4 | 3300013105 | Ga0157369_10027237 | Ga0157369_100272377 | 150 |
| 5 | 3300039453 | Ga0436362_0231279 | Ga0436362_0231279_97_549 | 150 |
| 6 | 3300048929 | Ga0496126_0080874 | Ga0496126_0080874_1863_2315 | 150 |
| 7 | 3300049568 | Ga0501031_0124483 | Ga0501031_0124483_1055_1507 | 150 |
| 8 | 3300049571 | Ga0501034_0566438 | Ga0501034_0566438_250_714 | 150 |
| 9 | 3300049823 | Ga0501044_0480880 | Ga0501044_0480880_649_1101 | 150 |
| 10 | 3300053125 | Ga0500618_051357 | Ga0500618_051357_303_764 | 150 |
| 11 | 3300053148 | Ga0500590_023725 | Ga0500590_023725_122_583 | 150 |
| 12 | 3300009094 | Ga0111539_10985082 | Ga0111539_109850822 | 153 |
| 13 | 3300005458 | Ga0070681_10412233 | Ga0070681_104122332 | 154 |
| 14 | 3300031824 | Ga0307413_10173349 | Ga0307413_101733494 | 154 |
| 15 | 3300031852 | Ga0307410_10001157 | Ga0307410_1000115713 | 154 |
| 16 | 3300031852 | Ga0307410_10439531 | Ga0307410_104395313 | 154 |
| 17 | 3300031903 | Ga0307407_10107321 | Ga0307407_101073213 | 154 |
| 18 | 3300032004 | Ga0307414_10022314 | Ga0307414_100223143 | 154 |
| 19 | 3300032004 | Ga0307414_11878678 | Ga0307414_118786781 | 154 |
| 20 | 3300032005 | Ga0307411_10071451 | Ga0307411_100714511 | 154 |
| 21 | 3300006051 | Ga0075364_10027407 | Ga0075364_100274075 | 155 |
| 22 | 3300009553 | Ga0105249_11142214 | Ga0105249_111422142 | 155 |
| 23 | 3300013104 | Ga0157370_10044577 | Ga0157370_100445775 | 155 |
| 24 | 3300013307 | Ga0157372_10468782 | Ga0157372_104687821 | 155 |
| 25 | 3300034819 | Ga0373958_0124533 | Ga0373958_0124533_88_579 | 155 |
| 26 | 3300035084 | Ga0373928_0069403 | Ga0373928_0069403_161_652 | 155 |
| 27 | 3300035092 | Ga0373952_0109613 | Ga0373952_0109613_166_657 | 155 |
| 28 | 3300035115 | Ga0373941_0046970 | Ga0373941_0046970_718_1209 | 155 |
| 29 | 3300035121 | Ga0373960_0015553 | Ga0373960_0015553_51_542 | 155 |
| 30 | 3300035691 | Ga0373931_0019572 | Ga0373931_0019572_808_1299 | 155 |
| 31 | 3300037853 | Ga0436364_0336095 | Ga0436364_0336095_539_1006 | 155 |
| 32 | 3300038443 | Ga0395901_0869094 | Ga0395901_0869094_271_747 | 155 |
| 33 | 3300039437 | Ga0436365_1204574 | Ga0436365_1204574_82_549 | 155 |
| 34 | 3300049570 | Ga0501033_0002213 | Ga0501033_0002213_10191_10658 | 155 |
| 35 | 3300049578 | Ga0501042_0571648 | Ga0501042_0571648_198_665 | 155 |
| 36 | 3300009148 | Ga0105243_11029928 | Ga0105243_110299282 | 156 |
| 37 | 3300053139 | Ga0500568_0022542 | Ga0500568_0022542_666_1148 | 156 |
| 38 | 3300060353 | Ga0501082_0430835 | Ga0501082_0430835_463_942 | 156 |
| 39 | 3300005718 | Ga0068866_10656311 | Ga0068866_106563111 | 158 |
| 40 | 3300009551 | Ga0105238_10938642 | Ga0105238_109386421 | 159 |
| 41 | 3300025924 | Ga0207694_10548850 | Ga0207694_105488502 | 159 |
| 42 | 3300049823 | Ga0501044_0026653 | Ga0501044_0026653_1519_2019 | 159 |
| 43 | 3300035695 | Ga0373927_0916013 | Ga0373927_0916013_45_539 | 160 |
| 44 | 3300003215 | JGI25153J46596_10010148 | JGI25153J46596_100101483 | 161 |
| 45 | 3300003320 | rootH2_10020055 | rootH2_100200552 | 161 |
| 46 | 3300005338 | Ga0068868_100809646 | Ga0068868_1008096461 | 161 |
| 47 | 3300005535 | Ga0070684_100240995 | Ga0070684_1002409953 | 161 |
| 48 | 3300005539 | Ga0068853_101044146 | Ga0068853_1010441461 | 161 |
| 49 | 3300005563 | Ga0068855_100699765 | Ga0068855_1006997651 | 161 |
| 50 | 3300005577 | Ga0068857_100392232 | Ga0068857_1003922322 | 161 |
| 51 | 3300005841 | Ga0068863_101049648 | Ga0068863_1010496482 | 161 |
| 52 | 3300006358 | Ga0068871_101221697 | Ga0068871_1012216971 | 161 |
| 53 | 3300009177 | Ga0105248_10620037 | Ga0105248_106200371 | 161 |
| 54 | 3300009545 | Ga0105237_10536076 | Ga0105237_105360761 | 161 |
| 55 | 3300014325 | Ga0163163_10053802 | Ga0163163_100538023 | 161 |
| 56 | 3300025258 | Ga0209129_1000440 | Ga0209129_100044022 | 161 |
| 57 | 3300025294 | Ga0209025_1001496 | Ga0209025_100149620 | 161 |
| 58 | 3300025297 | Ga0209758_1001700 | Ga0209758_100170015 | 161 |
| 59 | 3300025931 | Ga0207644_10534139 | Ga0207644_105341392 | 161 |
| 60 | 3300025941 | Ga0207711_10579511 | Ga0207711_105795112 | 161 |
| 61 | 3300025949 | Ga0207667_10284309 | Ga0207667_102843092 | 161 |
| 62 | 3300026078 | Ga0207702_10690765 | Ga0207702_106907652 | 161 |
| 63 | 3300026088 | Ga0207641_10273371 | Ga0207641_102733713 | 161 |
| 64 | 3300026095 | Ga0207676_10202064 | Ga0207676_102020642 | 161 |
| 65 | 3300026116 | Ga0207674_10140909 | Ga0207674_101409093 | 161 |
| 66 | 3300026142 | Ga0207698_10971590 | Ga0207698_109715902 | 161 |
| 67 | 3300048907 | Ga0496104_0718333 | Ga0496104_0718333_246_788 | 161 |
| 68 | 3300048909 | Ga0496106_1031130 | Ga0496106_1031130_89_631 | 161 |
| 69 | 3300048912 | Ga0496109_0781980 | Ga0496109_0781980_287_829 | 161 |
| 70 | 3300048915 | Ga0496112_0328866 | Ga0496112_0328866_569_1111 | 161 |
| 71 | 3300048916 | Ga0496113_0597122 | Ga0496113_0597122_297_839 | 161 |
| 72 | iso_pu_bacteria | 2593339239 | 2595452364 | 161 |
| 73 | 3300026078 | Ga0207702_10126996 | Ga0207702_101269962 | 162 |
| 74 | 3300048924 | Ga0496121_0198141 | Ga0496121_0198141_839_1333 | 162 |
| 75 | 3300049824 | Ga0501045_0216710 | Ga0501045_0216710_722_1210 | 162 |
| 76 | iso_pu_bacteria | 2643221559 | 2643818298 | 162 |
| 77 | iso_pu_bacteria | 2643221573 | 2643880492 | 162 |
| 78 | iso_pu_bacteria | 2643221577 | 2643896565 | 162 |
| 79 | iso_pu_bacteria | 2643221586 | 2643937959 | 162 |
| 80 | iso_pu_bacteria | 2643221612 | 2644078877 | 162 |
| 81 | iso_pu_bacteria | 2643221685 | 2644478682 | 162 |
| 82 | iso_pu_bacteria | 2643221720 | 2644661062 | 162 |
| 83 | iso_pu_bacteria | 2643221727 | 2644693654 | 162 |
| 84 | iso_pu_bacteria | 2643221728 | 2644699143 | 162 |
| 85 | 3300005335 | Ga0070666_10055804 | Ga0070666_100558041 | 163 |
| 86 | 3300005834 | Ga0068851_10752305 | Ga0068851_107523051 | 163 |
| 87 | 3300014325 | Ga0163163_11585409 | Ga0163163_115854092 | 163 |
| 88 | 3300025903 | Ga0207680_10039433 | Ga0207680_100394332 | 163 |
| 89 | 3300005340 | Ga0070689_100000006 | Ga0070689_100000006254 | 164 |
| 90 | 3300006844 | Ga0075428_100115428 | Ga0075428_1001154282 | 164 |
| 91 | 3300009551 | Ga0105238_10189017 | Ga0105238_101890173 | 164 |
| 92 | 3300013104 | Ga0157370_10000504 | Ga0157370_1000050424 | 164 |
| 93 | 3300025936 | Ga0207670_10000003 | Ga0207670_10000003191 | 164 |
| 94 | 3300049574 | Ga0501038_0047231 | Ga0501038_0047231_934_1428 | 164 |
| 95 | 3300049579 | Ga0501043_0077717 | Ga0501043_0077717_728_1222 | 164 |
| 96 | 3300049580 | Ga0501046_0158841 | Ga0501046_0158841_98_592 | 164 |
| 97 | 3300049581 | Ga0501047_0028609 | Ga0501047_0028609_1630_2124 | 164 |
| 98 | 3300049823 | Ga0501044_0081258 | Ga0501044_0081258_2347_2841 | 164 |
| 99 | 3300049823 | Ga0501044_0367900 | Ga0501044_0367900_466_978 | 164 |
| 100 | 3300053105 | Ga0500557_220487 | Ga0500557_220487_59_562 | 164 |
| 101 | 3300053730 | Ga0500645_029934 | Ga0500645_029934_361_867 | 164 |
| 102 | 3300002737 | JGI25162J39368_1000938 | JGI25162J39368_100093822 | 165 |
| 103 | 3300003214 | JGI25165J46597_1000347 | JGI25165J46597_100034742 | 165 |
| 104 | 3300005535 | Ga0070684_100812199 | Ga0070684_1008121992 | 165 |
| 105 | 3300005564 | Ga0070664_100939654 | Ga0070664_1009396542 | 165 |
| 106 | 3300020610 | Ga0154015_1684742 | Ga0154015_16847423 | 165 |
| 107 | 3300025231 | Ga0207427_100153 | Ga0207427_10015350 | 165 |
| 108 | 3300025233 | Ga0209437_100247 | Ga0209437_10024750 | 165 |
| 109 | 3300025250 | Ga0209026_1001537 | Ga0209026_10015375 | 165 |
| 110 | 3300025256 | Ga0209759_1000785 | Ga0209759_10007857 | 165 |
| 111 | 3300025261 | Ga0209233_1000023 | Ga0209233_100002350 | 165 |
| 112 | 3300025299 | Ga0209256_1015633 | Ga0209256_10156333 | 165 |
| 113 | 3300025921 | Ga0207652_10011326 | Ga0207652_100113263 | 165 |
| 114 | 3300026041 | Ga0207639_10556085 | Ga0207639_105560852 | 165 |
| 115 | 3300001979 | JGI24740J21852_10004914 | JGI24740J21852_100049144 | 166 |
| 116 | 3300002705 | JGI25156J39149_1031792 | JGI25156J39149_10317921 | 166 |
| 117 | 3300002772 | JGI25164J39214_1000109 | JGI25164J39214_10001096 | 166 |
| 118 | 3300003316 | rootH1_10065909 | rootH1_100659094 | 166 |
| 119 | 3300003316 | rootH1_10092899 | rootH1_100928992 | 166 |
| 120 | 3300003322 | rootL2_10188422 | rootL2_101884221 | 166 |
| 121 | 3300003752 | Ga0055539_1002038 | Ga0055539_10020383 | 166 |
| 122 | 3300003760 | Ga0055527_1000109 | Ga0055527_100010914 | 166 |
| 123 | 3300003760 | Ga0055527_1001940 | Ga0055527_10019403 | 166 |
| 124 | 3300003761 | Ga0055535_1000344 | Ga0055535_10003442 | 166 |
| 125 | 3300003761 | Ga0055535_1000538 | Ga0055535_10005387 | 166 |
| 126 | 3300003761 | Ga0055535_1000871 | Ga0055535_10008715 | 166 |
| 127 | 3300003762 | Ga0055542_1000101 | Ga0055542_100010174 | 166 |
| 128 | 3300003762 | Ga0055542_1000166 | Ga0055542_100016688 | 166 |
| 129 | 3300003762 | Ga0055542_1000265 | Ga0055542_100026518 | 166 |
| 130 | 3300003763 | Ga0055529_1000105 | Ga0055529_100010580 | 166 |
| 131 | 3300003763 | Ga0055529_1000347 | Ga0055529_10003475 | 166 |
| 132 | 3300004800 | Ga0058861_11707922 | Ga0058861_117079222 | 166 |
| 133 | 3300005295 | Ga0065707_10155161 | Ga0065707_101551612 | 166 |
| 134 | 3300005327 | Ga0070658_10542787 | Ga0070658_105427872 | 166 |
| 135 | 3300005328 | Ga0070676_10809538 | Ga0070676_108095381 | 166 |
| 136 | 3300005329 | Ga0070683_100028598 | Ga0070683_1000285983 | 166 |
| 137 | 3300005331 | Ga0070670_100004148 | Ga0070670_10000414818 | 166 |
| 138 | 3300005336 | Ga0070680_100195024 | Ga0070680_1001950243 | 166 |
| 139 | 3300005336 | Ga0070680_100550617 | Ga0070680_1005506172 | 166 |
| 140 | 3300005337 | Ga0070682_100008613 | Ga0070682_1000086138 | 166 |
| 141 | 3300005337 | Ga0070682_100420305 | Ga0070682_1004203052 | 166 |
| 142 | 3300005338 | Ga0068868_100041144 | Ga0068868_1000411442 | 166 |
| 143 | 3300005406 | Ga0070703_10017054 | Ga0070703_100170542 | 166 |
| 144 | 3300005434 | Ga0070709_10043762 | Ga0070709_100437623 | 166 |
| 145 | 3300005445 | Ga0070708_100084847 | Ga0070708_1000848472 | 166 |
| 146 | 3300005458 | Ga0070681_10027506 | Ga0070681_100275062 | 166 |
| 147 | 3300005459 | Ga0068867_100031699 | Ga0068867_1000316993 | 166 |
| 148 | 3300005467 | Ga0070706_100570396 | Ga0070706_1005703962 | 166 |
| 149 | 3300005518 | Ga0070699_100004500 | Ga0070699_1000045001 | 166 |
| 150 | 3300005530 | Ga0070679_100030738 | Ga0070679_1000307382 | 166 |
| 151 | 3300005530 | Ga0070679_100039549 | Ga0070679_1000395499 | 166 |
| 152 | 3300005535 | Ga0070684_100014007 | Ga0070684_1000140075 | 166 |
| 153 | 3300005536 | Ga0070697_100333711 | Ga0070697_1003337112 | 166 |
| 154 | 3300005539 | Ga0068853_100587000 | Ga0068853_1005870002 | 166 |
| 155 | 3300005545 | Ga0070695_100018608 | Ga0070695_1000186085 | 166 |
| 156 | 3300005545 | Ga0070695_100281640 | Ga0070695_1002816402 | 166 |
| 157 | 3300005546 | Ga0070696_100143774 | Ga0070696_1001437742 | 166 |
| 158 | 3300005547 | Ga0070693_100048142 | Ga0070693_1000481423 | 166 |
| 159 | 3300005548 | Ga0070665_100010232 | Ga0070665_1000102323 | 166 |
| 160 | 3300005549 | Ga0070704_100035905 | Ga0070704_1000359055 | 166 |
| 161 | 3300005563 | Ga0068855_100320706 | Ga0068855_1003207061 | 166 |
| 162 | 3300005563 | Ga0068855_100454738 | Ga0068855_1004547382 | 166 |
| 163 | 3300005564 | Ga0070664_100000498 | Ga0070664_10000049827 | 166 |
| 164 | 3300005577 | Ga0068857_100000091 | Ga0068857_10000009113 | 166 |
| 165 | 3300005578 | Ga0068854_100007548 | Ga0068854_1000075484 | 166 |
| 166 | 3300005578 | Ga0068854_100783900 | Ga0068854_1007839002 | 166 |
| 167 | 3300005614 | Ga0068856_100003014 | Ga0068856_1000030149 | 166 |
| 168 | 3300005614 | Ga0068856_100603160 | Ga0068856_1006031602 | 166 |
| 169 | 3300005616 | Ga0068852_100210954 | Ga0068852_1002109542 | 166 |
| 170 | 3300005617 | Ga0068859_100134848 | Ga0068859_1001348482 | 166 |
| 171 | 3300005618 | Ga0068864_100001844 | Ga0068864_10000184419 | 166 |
| 172 | 3300005718 | Ga0068866_10002628 | Ga0068866_100026287 | 166 |
| 173 | 3300005719 | Ga0068861_100230311 | Ga0068861_1002303111 | 166 |
| 174 | 3300005834 | Ga0068851_10092273 | Ga0068851_100922732 | 166 |
| 175 | 3300005841 | Ga0068863_100021473 | Ga0068863_1000214732 | 166 |
| 176 | 3300005937 | Ga0081455_10340971 | Ga0081455_103409711 | 166 |
| 177 | 3300005981 | Ga0081538_10014827 | Ga0081538_100148274 | 166 |
| 178 | 3300005985 | Ga0081539_10131904 | Ga0081539_101319042 | 166 |
| 179 | 3300006028 | Ga0070717_10058759 | Ga0070717_100587592 | 166 |
| 180 | 3300006163 | Ga0070715_10184048 | Ga0070715_101840482 | 166 |
| 181 | 3300006173 | Ga0070716_100021410 | Ga0070716_1000214103 | 166 |
| 182 | 3300006175 | Ga0070712_100634753 | Ga0070712_1006347532 | 166 |
| 183 | 3300006237 | Ga0097621_100315975 | Ga0097621_1003159752 | 166 |
| 184 | 3300006358 | Ga0068871_100068412 | Ga0068871_1000684122 | 166 |
| 185 | 3300006852 | Ga0075433_10518666 | Ga0075433_105186662 | 166 |
| 186 | 3300006871 | Ga0075434_100022953 | Ga0075434_1000229533 | 166 |
| 187 | 3300006914 | Ga0075436_100528549 | Ga0075436_1005285492 | 166 |
| 188 | 3300006931 | Ga0097620_100134837 | Ga0097620_1001348372 | 166 |
| 189 | 3300007076 | Ga0075435_100106206 | Ga0075435_1001062063 | 166 |
| 190 | 3300009093 | Ga0105240_10000405 | Ga0105240_1000040532 | 166 |
| 191 | 3300009093 | Ga0105240_10083188 | Ga0105240_100831885 | 166 |
| 192 | 3300009545 | Ga0105237_10052067 | Ga0105237_100520675 | 166 |
| 193 | 3300009545 | Ga0105237_10168382 | Ga0105237_101683823 | 166 |
| 194 | 3300009551 | Ga0105238_10058059 | Ga0105238_100580592 | 166 |
| 195 | 3300009553 | Ga0105249_10114047 | Ga0105249_101140475 | 166 |
| 196 | 3300013100 | Ga0157373_10050007 | Ga0157373_100500071 | 166 |
| 197 | 3300013307 | Ga0157372_10049251 | Ga0157372_100492512 | 166 |
| 198 | 3300013307 | Ga0157372_10096818 | Ga0157372_100968183 | 166 |
| 199 | 3300014968 | Ga0157379_10113089 | Ga0157379_101130894 | 166 |
| 200 | 3300015265 | Ga0182005_1007244 | Ga0182005_10072443 | 166 |
| 201 | 3300015685 | Ga0183369_1003 | Ga0183369_1003252 | 166 |
| 202 | 3300020082 | Ga0206353_11119431 | Ga0206353_111194312 | 166 |
| 203 | 3300025228 | Ga0209672_100048 | Ga0209672_10004889 | 166 |
| 204 | 3300025228 | Ga0209672_100183 | Ga0209672_1001836 | 166 |
| 205 | 3300025228 | Ga0209672_100803 | Ga0209672_10080317 | 166 |
| 206 | 3300025230 | Ga0209563_100065 | Ga0209563_10006598 | 166 |
| 207 | 3300025242 | Ga0209258_100086 | Ga0209258_10008689 | 166 |
| 208 | 3300025242 | Ga0209258_100198 | Ga0209258_1001986 | 166 |
| 209 | 3300025242 | Ga0209258_100286 | Ga0209258_10028690 | 166 |
| 210 | 3300025254 | Ga0209148_1000024 | Ga0209148_1000024155 | 166 |
| 211 | 3300025254 | Ga0209148_1000095 | Ga0209148_100009589 | 166 |
| 212 | 3300025254 | Ga0209148_1000135 | Ga0209148_1000135149 | 166 |
| 213 | 3300025272 | Ga0209455_1000025 | Ga0209455_1000025155 | 166 |
| 214 | 3300025272 | Ga0209455_1000087 | Ga0209455_100008789 | 166 |
| 215 | 3300025272 | Ga0209455_1000920 | Ga0209455_100092014 | 166 |
| 216 | 3300025885 | Ga0207653_10017487 | Ga0207653_100174873 | 166 |
| 217 | 3300025899 | Ga0207642_10009404 | Ga0207642_100094042 | 166 |
| 218 | 3300025904 | Ga0207647_10002489 | Ga0207647_100024892 | 166 |
| 219 | 3300025904 | Ga0207647_10078430 | Ga0207647_100784302 | 166 |
| 220 | 3300025906 | Ga0207699_10034559 | Ga0207699_100345593 | 166 |
| 221 | 3300025907 | Ga0207645_10058456 | Ga0207645_100584562 | 166 |
| 222 | 3300025909 | Ga0207705_10032086 | Ga0207705_100320862 | 166 |
| 223 | 3300025910 | Ga0207684_10059142 | Ga0207684_100591422 | 166 |
| 224 | 3300025911 | Ga0207654_10249973 | Ga0207654_102499731 | 166 |
| 225 | 3300025912 | Ga0207707_10022952 | Ga0207707_100229523 | 166 |
| 226 | 3300025913 | Ga0207695_10059806 | Ga0207695_100598062 | 166 |
| 227 | 3300025913 | Ga0207695_10741429 | Ga0207695_107414292 | 166 |
| 228 | 3300025914 | Ga0207671_10820688 | Ga0207671_108206881 | 166 |
| 229 | 3300025917 | Ga0207660_10006902 | Ga0207660_100069022 | 166 |
| 230 | 3300025917 | Ga0207660_10012864 | Ga0207660_100128644 | 166 |
| 231 | 3300025917 | Ga0207660_10162255 | Ga0207660_101622551 | 166 |
| 232 | 3300025917 | Ga0207660_11432716 | Ga0207660_114327161 | 166 |
| 233 | 3300025918 | Ga0207662_10078773 | Ga0207662_100787732 | 166 |
| 234 | 3300025919 | Ga0207657_10081446 | Ga0207657_100814462 | 166 |
| 235 | 3300025920 | Ga0207649_10258119 | Ga0207649_102581192 | 166 |
| 236 | 3300025921 | Ga0207652_10003182 | Ga0207652_100031829 | 166 |
| 237 | 3300025921 | Ga0207652_10304457 | Ga0207652_103044572 | 166 |
| 238 | 3300025922 | Ga0207646_10009423 | Ga0207646_100094235 | 166 |
| 239 | 3300025924 | Ga0207694_10215529 | Ga0207694_102155292 | 166 |
| 240 | 3300025925 | Ga0207650_10041976 | Ga0207650_100419763 | 166 |
| 241 | 3300025926 | Ga0207659_10326357 | Ga0207659_103263571 | 166 |
| 242 | 3300025928 | Ga0207700_10111699 | Ga0207700_101116993 | 166 |
| 243 | 3300025932 | Ga0207690_10049579 | Ga0207690_100495794 | 166 |
| 244 | 3300025932 | Ga0207690_10155158 | Ga0207690_101551582 | 166 |
| 245 | 3300025933 | Ga0207706_10005342 | Ga0207706_100053422 | 166 |
| 246 | 3300025939 | Ga0207665_10439877 | Ga0207665_104398772 | 166 |
| 247 | 3300025942 | Ga0207689_10199563 | Ga0207689_101995633 | 166 |
| 248 | 3300025944 | Ga0207661_10017862 | Ga0207661_100178625 | 166 |
| 249 | 3300025944 | Ga0207661_10100365 | Ga0207661_101003652 | 166 |
| 250 | 3300025945 | Ga0207679_10003746 | Ga0207679_100037469 | 166 |
| 251 | 3300025945 | Ga0207679_10498545 | Ga0207679_104985451 | 166 |
| 252 | 3300025949 | Ga0207667_10002617 | Ga0207667_100026173 | 166 |
| 253 | 3300025949 | Ga0207667_10063415 | Ga0207667_100634154 | 166 |
| 254 | 3300025949 | Ga0207667_10334209 | Ga0207667_103342092 | 166 |
| 255 | 3300025981 | Ga0207640_10013036 | Ga0207640_100130362 | 166 |
| 256 | 3300025981 | Ga0207640_11197625 | Ga0207640_111976251 | 166 |
| 257 | 3300025981 | Ga0207640_11411684 | Ga0207640_114116841 | 166 |
| 258 | 3300026023 | Ga0207677_10017768 | Ga0207677_100177682 | 166 |
| 259 | 3300026041 | Ga0207639_10017805 | Ga0207639_100178052 | 166 |
| 260 | 3300026041 | Ga0207639_10110867 | Ga0207639_101108672 | 166 |
| 261 | 3300026067 | Ga0207678_10081928 | Ga0207678_100819283 | 166 |
| 262 | 3300026078 | Ga0207702_10052748 | Ga0207702_100527482 | 166 |
| 263 | 3300026078 | Ga0207702_10896489 | Ga0207702_108964892 | 166 |
| 264 | 3300026078 | Ga0207702_11172923 | Ga0207702_111729232 | 166 |
| 265 | 3300026088 | Ga0207641_10007542 | Ga0207641_100075428 | 166 |
| 266 | 3300026089 | Ga0207648_10014095 | Ga0207648_100140952 | 166 |
| 267 | 3300026095 | Ga0207676_10004120 | Ga0207676_100041207 | 166 |
| 268 | 3300026116 | Ga0207674_10000126 | Ga0207674_100001262 | 166 |
| 269 | 3300026116 | Ga0207674_10104006 | Ga0207674_101040063 | 166 |
| 270 | 3300026118 | Ga0207675_100280499 | Ga0207675_1002804992 | 166 |
| 271 | 3300026121 | Ga0207683_10924261 | Ga0207683_109242612 | 166 |
| 272 | 3300026142 | Ga0207698_10003097 | Ga0207698_100030976 | 166 |
| 273 | 3300028379 | Ga0268266_10055239 | Ga0268266_100552392 | 166 |
| 274 | 3300028381 | Ga0268264_10377415 | Ga0268264_103774152 | 166 |
| 275 | 3300035085 | Ga0373929_0027345 | Ga0373929_0027345_125_625 | 166 |
| 276 | 3300035691 | Ga0373931_0808299 | Ga0373931_0808299_10_510 | 166 |
| 277 | 3300037312 | Ga0395899_0024742 | Ga0395899_0024742_3761_4261 | 166 |
| 278 | 3300037418 | Ga0395900_0200943 | Ga0395900_0200943_821_1321 | 166 |
| 279 | 3300037418 | Ga0395900_1096574 | Ga0395900_1096574_74_574 | 166 |
| 280 | 3300037853 | Ga0436364_0829546 | Ga0436364_0829546_159_659 | 166 |
| 281 | 3300038443 | Ga0395901_0027426 | Ga0395901_0027426_4350_4850 | 166 |
| 282 | 3300038443 | Ga0395901_0170702 | Ga0395901_0170702_283_783 | 166 |
| 283 | 3300041404 | Ga0439436_0011145 | Ga0439436_0011145_1987_2487 | 166 |
| 284 | 3300041406 | Ga0439439_0003978 | Ga0439439_0003978_515_1015 | 166 |
| 285 | 3300042004 | Ga0439445_0024361 | Ga0439445_0024361_737_1237 | 166 |
| 286 | 3300042007 | Ga0439449_0106817 | Ga0439449_0106817_200_700 | 166 |
| 287 | 3300042435 | Ga0439434_0152430 | Ga0439434_0152430_79_579 | 166 |
| 288 | 3300044656 | Ga0466969_0006538 | Ga0466969_0006538_652_1152 | 166 |
| 289 | 3300044656 | Ga0466969_0123669 | Ga0466969_0123669_682_1182 | 166 |
| 290 | 3300044663 | Ga0466989_0230362 | Ga0466989_0230362_128_628 | 166 |
| 291 | 3300044683 | Ga0466965_0146003 | Ga0466965_0146003_420_920 | 166 |
| 292 | 3300044684 | Ga0466966_0035928 | Ga0466966_0035928_386_886 | 166 |
| 293 | 3300044693 | Ga0466961_0010597 | Ga0466961_0010597_4119_4619 | 166 |
| 294 | 3300044693 | Ga0466961_0011336 | Ga0466961_0011336_157_657 | 166 |
| 295 | 3300044693 | Ga0466961_0025716 | Ga0466961_0025716_1237_1737 | 166 |
| 296 | 3300044693 | Ga0466961_0084887 | Ga0466961_0084887_1465_1965 | 166 |
| 297 | 3300044706 | Ga0466964_0010085 | Ga0466964_0010085_1665_2165 | 166 |
| 298 | 3300044712 | Ga0453684_0076459 | Ga0453684_0076459_1450_1959 | 166 |
| 299 | 3300044719 | Ga0466971_0023105 | Ga0466971_0023105_1191_1691 | 166 |
| 300 | 3300044719 | Ga0466971_0094494 | Ga0466971_0094494_680_1180 | 166 |
| 301 | 3300044735 | Ga0466968_0007475 | Ga0466968_0007475_1076_1576 | 166 |
| 302 | 3300044735 | Ga0466968_0204548 | Ga0466968_0204548_75_575 | 166 |
| 303 | 3300044735 | Ga0466968_0542791 | Ga0466968_0542791_69_569 | 166 |
| 304 | 3300044765 | Ga0466970_0012844 | Ga0466970_0012844_3155_3655 | 166 |
| 305 | 3300044765 | Ga0466970_0164948 | Ga0466970_0164948_94_594 | 166 |
| 306 | 3300044842 | Ga0466957_0024604 | Ga0466957_0024604_1775_2275 | 166 |
| 307 | 3300044842 | Ga0466957_0058949 | Ga0466957_0058949_1416_1916 | 166 |
| 308 | 3300045049 | Ga0466959_0124236 | Ga0466959_0124236_747_1247 | 166 |
| 309 | 3300045049 | Ga0466959_0147684 | Ga0466959_0147684_612_1112 | 166 |
| 310 | 3300045836 | Ga0466958_0139519 | Ga0466958_0139519_628_1128 | 166 |
| 311 | 3300045836 | Ga0466958_0168564 | Ga0466958_0168564_531_1031 | 166 |
| 312 | 3300046455 | Ga0495603_0067059 | Ga0495603_0067059_682_1182 | 166 |
| 313 | 3300046472 | Ga0495580_0008307 | Ga0495580_0008307_4467_4967 | 166 |
| 314 | 3300046473 | Ga0495582_0000961 | Ga0495582_0000961_4601_5101 | 166 |
| 315 | 3300046501 | Ga0495607_0000038 | Ga0495607_0000038_77423_77923 | 166 |
| 316 | 3300046557 | Ga0495622_0081557 | Ga0495622_0081557_563_1063 | 166 |
| 317 | 3300048918 | Ga0496115_0117634 | Ga0496115_0117634_1379_1879 | 166 |
| 318 | 3300048924 | Ga0496121_0085815 | Ga0496121_0085815_557_1057 | 166 |
| 319 | 3300048929 | Ga0496126_0001142 | Ga0496126_0001142_26330_26830 | 166 |
| 320 | 3300049568 | Ga0501031_0234200 | Ga0501031_0234200_257_757 | 166 |
| 321 | 3300049569 | Ga0501032_0052055 | Ga0501032_0052055_886_1386 | 166 |
| 322 | 3300049570 | Ga0501033_0758883 | Ga0501033_0758883_21_521 | 166 |
| 323 | 3300049572 | Ga0501036_0275230 | Ga0501036_0275230_442_942 | 166 |
| 324 | 3300049572 | Ga0501036_0537985 | Ga0501036_0537985_99_599 | 166 |
| 325 | 3300049573 | Ga0501037_0124984 | Ga0501037_0124984_312_812 | 166 |
| 326 | 3300049574 | Ga0501038_0049475 | Ga0501038_0049475_2774_3274 | 166 |
| 327 | 3300049575 | Ga0501039_0094906 | Ga0501039_0094906_1388_1888 | 166 |
| 328 | 3300049579 | Ga0501043_0088716 | Ga0501043_0088716_483_983 | 166 |
| 329 | 3300049580 | Ga0501046_0368162 | Ga0501046_0368162_241_741 | 166 |
| 330 | 3300049581 | Ga0501047_0031592 | Ga0501047_0031592_4285_4785 | 166 |
| 331 | 3300049581 | Ga0501047_0754836 | Ga0501047_0754836_208_708 | 166 |
| 332 | 3300049582 | Ga0501048_0152087 | Ga0501048_0152087_958_1458 | 166 |
| 333 | 3300049585 | Ga0501069_0200679 | Ga0501069_0200679_417_917 | 166 |
| 334 | 3300049589 | Ga0501073_0080642 | Ga0501073_0080642_532_1032 | 166 |
| 335 | 3300049590 | Ga0501074_0367404 | Ga0501074_0367404_44_544 | 166 |
| 336 | 3300049741 | Ga0501079_0637942 | Ga0501079_0637942_275_775 | 166 |
| 337 | 3300049822 | Ga0501035_0001136 | Ga0501035_0001136_433_933 | 166 |
| 338 | 3300049822 | Ga0501035_0193750 | Ga0501035_0193750_281_781 | 166 |
| 339 | 3300049822 | Ga0501035_0373406 | Ga0501035_0373406_296_796 | 166 |
| 340 | 3300049823 | Ga0501044_0022782 | Ga0501044_0022782_1925_2425 | 166 |
| 341 | 3300049823 | Ga0501044_0361045 | Ga0501044_0361045_622_1122 | 166 |
| 342 | 3300049823 | Ga0501044_0362365 | Ga0501044_0362365_281_781 | 166 |
| 343 | 3300049823 | Ga0501044_0369385 | Ga0501044_0369385_213_713 | 166 |
| 344 | 3300050512 | nmdc:mga0n895_102638_c1 | nmdc:mga0n895_102638_c1_2349_2849 | 166 |
| 345 | 3300050513 | nmdc:mga0rr50_132874_c2 | nmdc:mga0rr50_132874_c2_542_1042 | 166 |
| 346 | 3300050514 | nmdc:mga08x19_306437_c1 | nmdc:mga08x19_306437_c1_23_523 | 166 |
| 347 | 3300050515 | nmdc:mga0a205_75222_c1 | nmdc:mga0a205_75222_c1_2364_2864 | 166 |
| 348 | 3300061719 | Ga0466962_0019559 | Ga0466962_0019559_1665_2165 | 166 |
| 349 | 3300061719 | Ga0466962_0044944 | Ga0466962_0044944_1001_1501 | 166 |
| 350 | 3300001915 | JGI24741J21665_1004396 | JGI24741J21665_10043963 | 167 |
| 351 | 3300001979 | JGI24740J21852_10038287 | JGI24740J21852_100382871 | 167 |
| 352 | 3300005336 | Ga0070680_100371762 | Ga0070680_1003717622 | 167 |
| 353 | 3300005337 | Ga0070682_100201240 | Ga0070682_1002012403 | 167 |
| 354 | 3300005339 | Ga0070660_100279254 | Ga0070660_1002792541 | 167 |
| 355 | 3300005341 | Ga0070691_10190104 | Ga0070691_101901042 | 167 |
| 356 | 3300005344 | Ga0070661_100242842 | Ga0070661_1002428421 | 167 |
| 357 | 3300005345 | Ga0070692_10110011 | Ga0070692_101100112 | 167 |
| 358 | 3300005366 | Ga0070659_100176035 | Ga0070659_1001760352 | 167 |
| 359 | 3300005437 | Ga0070710_10594148 | Ga0070710_105941482 | 167 |
| 360 | 3300005439 | Ga0070711_100294618 | Ga0070711_1002946181 | 167 |
| 361 | 3300005458 | Ga0070681_10035481 | Ga0070681_100354813 | 167 |
| 362 | 3300005530 | Ga0070679_100043119 | Ga0070679_1000431194 | 167 |
| 363 | 3300005535 | Ga0070684_100008688 | Ga0070684_1000086886 | 167 |
| 364 | 3300005539 | Ga0068853_100446225 | Ga0068853_1004462252 | 167 |
| 365 | 3300005546 | Ga0070696_100649611 | Ga0070696_1006496112 | 167 |
| 366 | 3300005563 | Ga0068855_100575928 | Ga0068855_1005759282 | 167 |
| 367 | 3300005564 | Ga0070664_100046208 | Ga0070664_1000462083 | 167 |
| 368 | 3300005577 | Ga0068857_100566341 | Ga0068857_1005663412 | 167 |
| 369 | 3300005578 | Ga0068854_100560489 | Ga0068854_1005604891 | 167 |
| 370 | 3300005616 | Ga0068852_100061068 | Ga0068852_1000610683 | 167 |
| 371 | 3300005840 | Ga0068870_11008459 | Ga0068870_110084591 | 167 |
| 372 | 3300005841 | Ga0068863_100122092 | Ga0068863_1001220923 | 167 |
| 373 | 3300009093 | Ga0105240_10466822 | Ga0105240_104668222 | 167 |
| 374 | 3300009174 | Ga0105241_11154094 | Ga0105241_111540941 | 167 |
| 375 | 3300009545 | Ga0105237_10352671 | Ga0105237_103526713 | 167 |
| 376 | 3300013102 | Ga0157371_10206251 | Ga0157371_102062511 | 167 |
| 377 | 3300013105 | Ga0157369_10288224 | Ga0157369_102882241 | 167 |
| 378 | 3300013307 | Ga0157372_10504613 | Ga0157372_105046131 | 167 |
| 379 | 3300014325 | Ga0163163_10050457 | Ga0163163_100504574 | 167 |
| 380 | 3300025899 | Ga0207642_10331474 | Ga0207642_103314741 | 167 |
| 381 | 3300025904 | Ga0207647_10189779 | Ga0207647_101897792 | 167 |
| 382 | 3300025909 | Ga0207705_10266030 | Ga0207705_102660302 | 167 |
| 383 | 3300025911 | Ga0207654_10453923 | Ga0207654_104539232 | 167 |
| 384 | 3300025912 | Ga0207707_10001178 | Ga0207707_1000117813 | 167 |
| 385 | 3300025912 | Ga0207707_10012437 | Ga0207707_100124375 | 167 |
| 386 | 3300025913 | Ga0207695_10015925 | Ga0207695_100159257 | 167 |
| 387 | 3300025917 | Ga0207660_10015650 | Ga0207660_100156505 | 167 |
| 388 | 3300025917 | Ga0207660_10186084 | Ga0207660_101860841 | 167 |
| 389 | 3300025919 | Ga0207657_10014092 | Ga0207657_100140922 | 167 |
| 390 | 3300025920 | Ga0207649_10006172 | Ga0207649_100061722 | 167 |
| 391 | 3300025921 | Ga0207652_10061250 | Ga0207652_100612501 | 167 |
| 392 | 3300025931 | Ga0207644_10717368 | Ga0207644_107173681 | 167 |
| 393 | 3300025944 | Ga0207661_10027649 | Ga0207661_100276495 | 167 |
| 394 | 3300025949 | Ga0207667_10014185 | Ga0207667_100141857 | 167 |
| 395 | 3300025981 | Ga0207640_10225293 | Ga0207640_102252931 | 167 |
| 396 | 3300026041 | Ga0207639_10049588 | Ga0207639_100495885 | 167 |
| 397 | 3300026067 | Ga0207678_10205678 | Ga0207678_102056782 | 167 |
| 398 | 3300026088 | Ga0207641_10397160 | Ga0207641_103971602 | 167 |
| 399 | 3300026116 | Ga0207674_10009779 | Ga0207674_100097796 | 167 |
| 400 | 3300026142 | Ga0207698_10050027 | Ga0207698_100500272 | 167 |
| 401 | 3300036401 | Ga0373937_1657017 | Ga0373937_1657017_33_566 | 167 |
| 402 | 3300045976 | Ga0466967_0016206 | Ga0466967_0016206_229_753 | 167 |
| 403 | 3300046472 | Ga0495580_0133154 | Ga0495580_0133154_647_1180 | 167 |
| 404 | 3300046475 | Ga0495639_0263166 | Ga0495639_0263166_22_555 | 167 |
| 405 | 3300046543 | Ga0495645_0104890 | Ga0495645_0104890_129_662 | 167 |
| 406 | 3300046543 | Ga0495645_0341680 | Ga0495645_0341680_305_838 | 167 |
| 407 | 3300046559 | Ga0495667_0188590 | Ga0495667_0188590_669_1202 | 167 |
| 408 | 3300046663 | Ga0495635_0684026 | Ga0495635_0684026_44_577 | 167 |
| 409 | 3300046674 | Ga0495588_0072271 | Ga0495588_0072271_997_1530 | 167 |
| 410 | 3300046675 | Ga0495657_0217436 | Ga0495657_0217436_86_598 | 167 |
| 411 | 3300046679 | Ga0495623_0144849 | Ga0495623_0144849_741_1274 | 167 |
| 412 | 3300046679 | Ga0495623_0320743 | Ga0495623_0320743_33_566 | 167 |
| 413 | 3300046684 | Ga0495669_0190081 | Ga0495669_0190081_33_566 | 167 |
| 414 | 3300047315 | Ga0495581_0278255 | Ga0495581_0278255_388_921 | 167 |
| 415 | 3300047317 | Ga0495604_0079769 | Ga0495604_0079769_1008_1541 | 167 |
| 416 | 3300047317 | Ga0495604_0258601 | Ga0495604_0258601_585_1118 | 167 |
| 417 | 3300047444 | Ga0495675_0045325 | Ga0495675_0045325_90_623 | 167 |
| 418 | 3300047444 | Ga0495675_0113986 | Ga0495675_0113986_583_1116 | 167 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pu2-assembly7.cif.gz_G | crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. | 0.9209 | 17 | 167 |
| 3pu2-assembly4.cif.gz_D | crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. | 0.9173 | 16 | 165 |
| 3pu2-assembly1.cif.gz_A | crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. | 0.9148 | 16 | 165 |
| 3pu2-assembly7.cif.gz_G | crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. | 0.9094 | 17 | 167 |
| 3pu2-assembly3.cif.gz_C | crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. | 0.9067 | 16 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3pu2H00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9084 | 16 | 164 | 3.30.530.20 |
| 3pu2H00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8846 | 16 | 164 | 3.30.530.20 |
| 2ldkA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8578 | 17 | 165 | 3.30.530.20 |
| af_Q2G1U9_1_155_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8518 | 17 | 163 | 3.30.530.20 |
| 1xuvB00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8494 | 14 | 166 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A841KF01-F1-model_v4 | Uncharacterized protein YndB with AHSA1/START domain | 1.002 | 14 | 167 |
|
| AF-A0A841KF01-F1-model_v4 | Uncharacterized protein YndB with AHSA1/START domain | 0.9891 | 14 | 167 |
|
| AF-A0A2W4QX31-F1-model_v4 | ATPase | 0.9843 | 14 | 133 |
|
| AF-A0A1G4TBI9-F1-model_v4 | Uncharacterized conserved protein YndB, AHSA1/START domain | 0.9764 | 14 | 166 |
|
| AF-A0A1W2DLK6-F1-model_v4 | Uncharacterized conserved protein YndB, AHSA1/START domain | 0.9713 | 15 | 161 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar