F439235

General Info

Members Datasets Scaffolds Average Seq Length
418 262 408 166

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10594148|Ga0070710_105941482
Length 177
Sequence MDTRKNSETNPTKNNTTVERKSDRELVVTRTFNGPAHVVFNAWTKPELFQRWWAPKDFGVLLLSCELDARTGGKYRLVFRHPSTGEPMPFFGRYVEVIPSKRIVWTNDEGEEPGAVTTVTFEENAGETVVVLHDLYPSKEALDEGIASGSTNGYPMQFEQLDELLVDLGASVGGSPA

Samples

Sample ID Description Type Environment
1 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
2 2643221559 Lysobacter sp. Root559 Isolate Unclassified
3 2643221573 Lysobacter sp. Root604 Isolate Unclassified
4 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221612 Lysobacter sp. Root76 Isolate Unclassified
7 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
8 2643221720 Lysobacter sp. Root916 Isolate Unclassified
9 2643221727 Lysobacter sp. Root96 Isolate Unclassified
10 2643221728 Lysobacter sp. Root983 Isolate Unclassified
11 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
112 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
116 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
174 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
175 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
176 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
177 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
190 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
191 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
257 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
260 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.89
Metatranscriptomes 0.72
Isolates 2.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.81
Nodule 0
Rhizoplane 1.44
Rhizosphere 82.54
Stem 0
Stem Tuber 0
Unclassified 6.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1004396 3300001915 Bacteria 3138
2 JGI24740J21852_10004914 3300001979 Bacteria 5689
3 JGI24740J21852_10038287 3300001979 Bacteria 1472
4 JGI25156J39149_1031792 3300002705 Bacteria 783
5 JGI25162J39368_1000938 3300002737 Bacteria 18755
6 JGI25164J39214_1000109 3300002772 Bacteria 78254
7 JGI25165J46597_1000347 3300003214 Bacteria 52707
8 JGI25153J46596_10010148 3300003215 Bacteria 4287
9 rootH1_10065909 3300003316 Bacteria 7222
10 rootH1_10092899 3300003316 Bacteria 1650
11 rootH2_10020055 3300003320 Bacteria 1709
12 rootL2_10188422 3300003322 Bacteria 2193
13 Ga0055539_1002038 3300003752 Bacteria 3314
14 Ga0055527_1000109 3300003760 Bacteria 58566
15 Ga0055527_1001940 3300003760 Bacteria 3823
16 Ga0055535_1000344 3300003761 Bacteria 46295
17 Ga0055535_1000538 3300003761 Bacteria 32551
18 Ga0055535_1000871 3300003761 Bacteria 21152
19 Ga0055542_1000101 3300003762 Bacteria 116277
20 Ga0055542_1000166 3300003762 Bacteria 83233
21 Ga0055542_1000265 3300003762 Bacteria 58566
22 Ga0055529_1000105 3300003763 Bacteria 123670
23 Ga0055529_1000347 3300003763 Bacteria 51358
24 Ga0058861_11707922 3300004800 Bacteria 897
25 Ga0065707_10155161 3300005295 Bacteria 1611
26 Ga0070658_10542787 3300005327 Bacteria 1006
27 Ga0070676_10809538 3300005328 Bacteria 692
28 Ga0070683_100028598 3300005329 Bacteria 5039
29 Ga0070670_100004148 3300005331 Bacteria 12116
30 Ga0070666_10055804 3300005335 Bacteria 2667
31 Ga0070680_100195024 3300005336 Bacteria 1707
32 Ga0070680_100371762 3300005336 Bacteria 1216
33 Ga0070680_100550617 3300005336 Bacteria 989
34 Ga0070682_100008613 3300005337 Bacteria 5760
35 Ga0070682_100201240 3300005337 Bacteria 1405
36 Ga0070682_100420305 3300005337 Bacteria 1016
37 Ga0068868_100041144 3300005338 Bacteria 3600
38 Ga0068868_100809646 3300005338 Bacteria 846
39 Ga0070660_100279254 3300005339 Bacteria 1366
40 Ga0070689_100000006 3300005340 Bacteria 332562
41 Ga0070691_10190104 3300005341 Bacteria 1073
42 Ga0070661_100242842 3300005344 Bacteria 1387
43 Ga0070692_10110011 3300005345 Bacteria 1522
44 Ga0070659_100176035 3300005366 Bacteria 1754
45 Ga0070703_10017054 3300005406 Bacteria 2091
46 Ga0070709_10043762 3300005434 Bacteria 2770
47 Ga0070710_10594148 3300005437 Bacteria 770
48 Ga0070711_100294618 3300005439 Bacteria 1288
49 Ga0070708_100084847 3300005445 Bacteria 2873
50 Ga0070681_10027506 3300005458 Bacteria 5717
51 Ga0070681_10035481 3300005458 Bacteria 5010
52 Ga0070681_10412233 3300005458 Bacteria 1263
53 Ga0068867_100031699 3300005459 Bacteria 3819
54 Ga0070706_100570396 3300005467 Bacteria 1052
55 Ga0070699_100004500 3300005518 Bacteria 12333
56 Ga0070679_100030738 3300005530 Bacteria 5304
57 Ga0070679_100039549 3300005530 Bacteria 4687
58 Ga0070679_100043119 3300005530 Bacteria 4494
59 Ga0070684_100008688 3300005535 Bacteria 7962
60 Ga0070684_100014007 3300005535 Bacteria 6484
61 Ga0070684_100240995 3300005535 Bacteria 1652
62 Ga0070684_100812199 3300005535 Bacteria 874
63 Ga0070697_100333711 3300005536 Bacteria 1307
64 Ga0068853_100446225 3300005539 Bacteria 1216
65 Ga0068853_100587000 3300005539 Bacteria 1057
66 Ga0068853_101044146 3300005539 Bacteria 787
67 Ga0070695_100018608 3300005545 Bacteria 4219
68 Ga0070695_100281640 3300005545 Bacteria 1222
69 Ga0070696_100143774 3300005546 Bacteria 1746
70 Ga0070696_100649611 3300005546 Bacteria 855
71 Ga0070693_100048142 3300005547 Bacteria 2427
72 Ga0070665_100010232 3300005548 Bacteria 9489
73 Ga0070704_100035905 3300005549 Bacteria 3372
74 Ga0068855_100320706 3300005563 Bacteria 1713
75 Ga0068855_100454738 3300005563 Bacteria 1397
76 Ga0068855_100575928 3300005563 Bacteria 1216
77 Ga0068855_100699765 3300005563 Bacteria 1084
78 Ga0070664_100000498 3300005564 Bacteria 29740
79 Ga0070664_100046208 3300005564 Bacteria 3678
80 Ga0070664_100939654 3300005564 Bacteria 811
81 Ga0068857_100000091 3300005577 Bacteria 52422
82 Ga0068857_100392232 3300005577 Bacteria 1291
83 Ga0068857_100566341 3300005577 Bacteria 1071
84 Ga0068854_100007548 3300005578 Bacteria 6950
85 Ga0068854_100560489 3300005578 Bacteria 970
86 Ga0068854_100783900 3300005578 Bacteria 830
87 Ga0068856_100003014 3300005614 Bacteria 17243
88 Ga0068856_100603160 3300005614 Bacteria 1119
89 Ga0068852_100061068 3300005616 Bacteria 3274
90 Ga0068852_100210954 3300005616 Bacteria 1842
91 Ga0068859_100134848 3300005617 Bacteria 2541
92 Ga0068864_100001844 3300005618 Bacteria 17428
93 Ga0068866_10002628 3300005718 Bacteria 7426
94 Ga0068866_10656311 3300005718 Bacteria 715
95 Ga0068861_100230311 3300005719 Bacteria 1571
96 Ga0068851_10092273 3300005834 Bacteria 1595
97 Ga0068851_10752305 3300005834 Bacteria 603
98 Ga0068870_11008459 3300005840 Bacteria 594
99 Ga0068863_100021473 3300005841 Bacteria 6161
100 Ga0068863_100122092 3300005841 Bacteria 2485
101 Ga0068863_101049648 3300005841 Bacteria 819
102 Ga0081455_10340971 3300005937 Bacteria 1061
103 Ga0081538_10014827 3300005981 Bacteria 6076
104 Ga0081539_10131904 3300005985 Bacteria 1226
105 Ga0070717_10058759 3300006028 Bacteria 3180
106 Ga0075364_10027407 3300006051 Bacteria 3639
107 Ga0070715_10184048 3300006163 Bacteria 1049
108 Ga0070716_100021410 3300006173 Bacteria 3407
109 Ga0070712_100634753 3300006175 Bacteria 906
110 Ga0097621_100315975 3300006237 Bacteria 1383
111 Ga0068871_100068412 3300006358 Bacteria 2916
112 Ga0068871_101221697 3300006358 Bacteria 705
113 Ga0075428_100115428 3300006844 Bacteria 2925
114 Ga0075433_10518666 3300006852 Bacteria 1048
115 Ga0075434_100022953 3300006871 Bacteria 6073
116 Ga0075436_100528549 3300006914 Bacteria 865
117 Ga0097620_100134837 3300006931 Bacteria 2541
118 Ga0075435_100106206 3300007076 Bacteria 2331
119 Ga0105240_10000405 3300009093 Bacteria 80014
120 Ga0105240_10083188 3300009093 Bacteria 3928
121 Ga0105240_10466822 3300009093 Bacteria 1409
122 Ga0111539_10985082 3300009094 Bacteria 980
123 Ga0105243_11029928 3300009148 Bacteria 828
124 Ga0105241_11154094 3300009174 Bacteria 732
125 Ga0105248_10620037 3300009177 Bacteria 1220
126 Ga0105237_10052067 3300009545 Bacteria 4111
127 Ga0105237_10168382 3300009545 Bacteria 2190
128 Ga0105237_10352671 3300009545 Bacteria 1476
129 Ga0105237_10536076 3300009545 Bacteria 1177
130 Ga0105237_10537069 3300009545 Bacteria 1176
131 Ga0105238_10058059 3300009551 Bacteria 3879
132 Ga0105238_10189017 3300009551 Bacteria 2036
133 Ga0105238_10938642 3300009551 Bacteria 884
134 Ga0105249_10114047 3300009553 Bacteria 2558
135 Ga0105249_11142214 3300009553 Bacteria 849
136 Ga0157373_10050007 3300013100 Bacteria 2978
137 Ga0157371_10206251 3300013102 Bacteria 1410
138 Ga0157370_10000504 3300013104 Bacteria 48796
139 Ga0157370_10034591 3300013104 Bacteria 4917
140 Ga0157370_10044577 3300013104 Bacteria 4261
141 Ga0157369_10027237 3300013105 Bacteria 6337
142 Ga0157369_10288224 3300013105 Bacteria 1709
143 Ga0157372_10049251 3300013307 Bacteria 4684
144 Ga0157372_10096818 3300013307 Bacteria 3364
145 Ga0157372_10468782 3300013307 Bacteria 1468
146 Ga0157372_10504613 3300013307 Bacteria 1410
147 Ga0163163_10050457 3300014325 Bacteria 4098
148 Ga0163163_10053802 3300014325 Bacteria 3975
149 Ga0163163_11585409 3300014325 Bacteria 716
150 Ga0157379_10113089 3300014968 Bacteria 2440
151 Ga0182005_1007244 3300015265 Bacteria 3337
152 Ga0183369_1003 3300015685 Bacteria 726443
153 Ga0206353_11119431 3300020082 Bacteria 1259
154 Ga0154015_1684742 3300020610 Bacteria 2762
155 Ga0209672_100048 3300025228 Bacteria 240458
156 Ga0209672_100183 3300025228 Bacteria 50722
157 Ga0209672_100803 3300025228 Bacteria 14847
158 Ga0209563_100065 3300025230 Bacteria 257430
159 Ga0207427_100153 3300025231 Bacteria 78306
160 Ga0209437_100247 3300025233 Bacteria 87403
161 Ga0209258_100086 3300025242 Bacteria 240458
162 Ga0209258_100198 3300025242 Bacteria 124013
163 Ga0209258_100286 3300025242 Bacteria 83264
164 Ga0209026_1001537 3300025250 Bacteria 10026
165 Ga0209148_1000024 3300025254 Bacteria 669890
166 Ga0209148_1000095 3300025254 Bacteria 240458
167 Ga0209148_1000135 3300025254 Bacteria 169939
168 Ga0209759_1000785 3300025256 Bacteria 26511
169 Ga0209129_1000440 3300025258 Bacteria 30999
170 Ga0209233_1000023 3300025261 Bacteria 738870
171 Ga0209455_1000025 3300025272 Bacteria 670673
172 Ga0209455_1000087 3300025272 Bacteria 240458
173 Ga0209455_1000920 3300025272 Bacteria 15191
174 Ga0209025_1001496 3300025294 Bacteria 30216
175 Ga0209758_1001700 3300025297 Bacteria 24739
176 Ga0209256_1015633 3300025299 Bacteria 2640
177 Ga0207653_10017487 3300025885 Bacteria 2257
178 Ga0207642_10009404 3300025899 Bacteria 3398
179 Ga0207642_10331474 3300025899 Bacteria 892
180 Ga0207680_10039433 3300025903 Bacteria 2741
181 Ga0207647_10002489 3300025904 Bacteria 13948
182 Ga0207647_10078430 3300025904 Bacteria 1984
183 Ga0207647_10189779 3300025904 Bacteria 1191
184 Ga0207699_10034559 3300025906 Bacteria 2869
185 Ga0207645_10058456 3300025907 Bacteria 2462
186 Ga0207705_10032086 3300025909 Bacteria 3752
187 Ga0207705_10266030 3300025909 Bacteria 1310
188 Ga0207684_10059142 3300025910 Bacteria 3253
189 Ga0207654_10249973 3300025911 Bacteria 1188
190 Ga0207654_10453923 3300025911 Bacteria 899
191 Ga0207707_10001178 3300025912 Bacteria 24639
192 Ga0207707_10012437 3300025912 Bacteria 7399
193 Ga0207707_10022952 3300025912 Bacteria 5458
194 Ga0207695_10015925 3300025913 Bacteria 8830
195 Ga0207695_10059806 3300025913 Bacteria 3948
196 Ga0207695_10741429 3300025913 Bacteria 863
197 Ga0207671_10820688 3300025914 Bacteria 737
198 Ga0207660_10006902 3300025917 Bacteria 7350
199 Ga0207660_10012864 3300025917 Bacteria 5480
200 Ga0207660_10015650 3300025917 Bacteria 5010
201 Ga0207660_10162255 3300025917 Bacteria 1725
202 Ga0207660_10186084 3300025917 Bacteria 1615
203 Ga0207660_11432716 3300025917 Bacteria 559
204 Ga0207662_10078773 3300025918 Bacteria 2006
205 Ga0207657_10014092 3300025919 Bacteria 7823
206 Ga0207657_10081446 3300025919 Bacteria 2719
207 Ga0207649_10006172 3300025920 Bacteria 6503
208 Ga0207649_10258119 3300025920 Bacteria 1258
209 Ga0207652_10003182 3300025921 Bacteria 13654
210 Ga0207652_10011326 3300025921 Bacteria 7186
211 Ga0207652_10061250 3300025921 Bacteria 3249
212 Ga0207652_10304457 3300025921 Bacteria 1439
213 Ga0207646_10009423 3300025922 Bacteria 9653
214 Ga0207694_10215529 3300025924 Bacteria 1565
215 Ga0207694_10548850 3300025924 Bacteria 970
216 Ga0207650_10041976 3300025925 Bacteria 3355
217 Ga0207659_10326357 3300025926 Bacteria 1267
218 Ga0207700_10111699 3300025928 Bacteria 2200
219 Ga0207644_10534139 3300025931 Bacteria 970
220 Ga0207644_10717368 3300025931 Bacteria 834
221 Ga0207690_10049579 3300025932 Bacteria 2800
222 Ga0207690_10155158 3300025932 Bacteria 1701
223 Ga0207706_10005342 3300025933 Bacteria 11973
224 Ga0207670_10000003 3300025936 Bacteria 760449
225 Ga0207665_10439877 3300025939 Bacteria 999
226 Ga0207711_10579511 3300025941 Bacteria 1047
227 Ga0207689_10199563 3300025942 Bacteria 1651
228 Ga0207661_10017862 3300025944 Bacteria 5258
229 Ga0207661_10027649 3300025944 Bacteria 4334
230 Ga0207661_10100365 3300025944 Bacteria 2429
231 Ga0207679_10003746 3300025945 Bacteria 9428
232 Ga0207679_10498545 3300025945 Bacteria 1086
233 Ga0207667_10002617 3300025949 Bacteria 22307
234 Ga0207667_10014185 3300025949 Bacteria 9094
235 Ga0207667_10063415 3300025949 Bacteria 3861
236 Ga0207667_10284309 3300025949 Bacteria 1690
237 Ga0207667_10334209 3300025949 Bacteria 1547
238 Ga0207640_10013036 3300025981 Bacteria 4754
239 Ga0207640_10225293 3300025981 Bacteria 1438
240 Ga0207640_11197625 3300025981 Bacteria 675
241 Ga0207640_11411684 3300025981 Bacteria 624
242 Ga0207677_10017768 3300026023 Bacteria 4251
243 Ga0207639_10017805 3300026041 Bacteria 5038
244 Ga0207639_10049588 3300026041 Bacteria 3184
245 Ga0207639_10110867 3300026041 Bacteria 2236
246 Ga0207639_10556085 3300026041 Bacteria 1054
247 Ga0207678_10081928 3300026067 Bacteria 2761
248 Ga0207678_10205678 3300026067 Bacteria 1684
249 Ga0207702_10052748 3300026078 Bacteria 3442
250 Ga0207702_10126996 3300026078 Bacteria 2291
251 Ga0207702_10690765 3300026078 Bacteria 1005
252 Ga0207702_10896489 3300026078 Bacteria 879
253 Ga0207702_11172923 3300026078 Bacteria 762
254 Ga0207641_10007542 3300026088 Bacteria 9050
255 Ga0207641_10273371 3300026088 Bacteria 1586
256 Ga0207641_10397160 3300026088 Bacteria 1323
257 Ga0207648_10014095 3300026089 Bacteria 7396
258 Ga0207676_10004120 3300026095 Bacteria 10263
259 Ga0207676_10202064 3300026095 Bacteria 1757
260 Ga0207674_10000126 3300026116 Bacteria 88965
261 Ga0207674_10009779 3300026116 Bacteria 10923
262 Ga0207674_10104006 3300026116 Bacteria 2818
263 Ga0207674_10140909 3300026116 Bacteria 2370
264 Ga0207675_100280499 3300026118 Bacteria 1619
265 Ga0207683_10924261 3300026121 Bacteria 810
266 Ga0207698_10003097 3300026142 Bacteria 9981
267 Ga0207698_10050027 3300026142 Bacteria 3185
268 Ga0207698_10971590 3300026142 Bacteria 859
269 Ga0268266_10055239 3300028379 Bacteria 3413
270 Ga0268264_10377415 3300028381 Bacteria 1357
271 Ga0307413_10173349 3300031824 Bacteria 1529
272 Ga0307410_10001157 3300031852 Bacteria 11609
273 Ga0307410_10439531 3300031852 Unclassified 1062
274 Ga0307407_10107321 3300031903 Bacteria 1746
275 Ga0307414_10022314 3300032004 Bacteria 3990
276 Ga0307414_11878678 3300032004 Bacteria 559
277 Ga0307411_10071451 3300032005 Bacteria 2352
278 Ga0373958_0124533 3300034819 Bacteria 625
279 Ga0373928_0069403 3300035084 Bacteria 868
280 Ga0373929_0027345 3300035085 Bacteria 1198
281 Ga0373952_0109613 3300035092 Bacteria 737
282 Ga0373941_0046970 3300035115 Bacteria 1358
283 Ga0373960_0015553 3300035121 Bacteria 1944
284 Ga0373931_0019572 3300035691 Bacteria 3381
285 Ga0373931_0808299 3300035691 Bacteria 625
286 Ga0373927_0916013 3300035695 Unclassified 578
287 Ga0373937_1657017 3300036401 Bacteria 587
288 Ga0395899_0024742 3300037312 Bacteria 4538
289 Ga0395900_0200943 3300037418 Bacteria 2017
290 Ga0395900_1096574 3300037418 Bacteria 713
291 Ga0395905_1476504 3300037471 Bacteria 584
292 Ga0436364_0336095 3300037853 Bacteria 1962
293 Ga0436364_0829546 3300037853 Bacteria 716
294 Ga0395901_0027426 3300038443 Bacteria 5851
295 Ga0395901_0170702 3300038443 Bacteria 2282
296 Ga0395901_0869094 3300038443 Bacteria 886
297 Ga0436365_1204574 3300039437 Bacteria 616
298 Ga0436362_0231279 3300039453 Bacteria 564
299 Ga0439436_0011145 3300041404 Bacteria 2732
300 Ga0439439_0003978 3300041406 Bacteria 3295
301 Ga0439445_0024361 3300042004 Bacteria 1538
302 Ga0439449_0106817 3300042007 Bacteria 1036
303 Ga0439434_0152430 3300042435 Bacteria 766
304 Ga0466969_0006538 3300044656 Bacteria 6200
305 Ga0466969_0123669 3300044656 Bacteria 1203
306 Ga0466989_0230362 3300044663 Bacteria 1075
307 Ga0466965_0146003 3300044683 Bacteria 1234
308 Ga0466966_0035928 3300044684 Bacteria 3200
309 Ga0466961_0010597 3300044693 Bacteria 5882
310 Ga0466961_0011336 3300044693 Bacteria 5700
311 Ga0466961_0025716 3300044693 Bacteria 3784
312 Ga0466961_0084887 3300044693 Bacteria 2002
313 Ga0466964_0010085 3300044706 Bacteria 3560
314 Ga0453684_0076459 3300044712 Bacteria 4203
315 Ga0466971_0023105 3300044719 Bacteria 2771
316 Ga0466971_0094494 3300044719 Bacteria 1370
317 Ga0466968_0007475 3300044735 Bacteria 4156
318 Ga0466968_0204548 3300044735 Bacteria 926
319 Ga0466968_0542791 3300044735 Bacteria 583
320 Ga0466970_0012844 3300044765 Bacteria 4287
321 Ga0466970_0164948 3300044765 Bacteria 1226
322 Ga0466957_0024604 3300044842 Bacteria 3564
323 Ga0466957_0058949 3300044842 Bacteria 2352
324 Ga0466959_0124236 3300045049 Bacteria 1832
325 Ga0466959_0147684 3300045049 Bacteria 1658
326 Ga0466958_0139519 3300045836 Bacteria 1525
327 Ga0466958_0168564 3300045836 Bacteria 1386
328 Ga0466967_0016206 3300045976 Bacteria 5868
329 Ga0495603_0067059 3300046455 Bacteria 2113
330 Ga0495580_0008307 3300046472 Bacteria 8262
331 Ga0495580_0133154 3300046472 Bacteria 1724
332 Ga0495582_0000961 3300046473 Bacteria 16088
333 Ga0495639_0263166 3300046475 Bacteria 855
334 Ga0495607_0000038 3300046501 Bacteria 134124
335 Ga0495645_0104890 3300046543 Bacteria 2006
336 Ga0495645_0341680 3300046543 Bacteria 967
337 Ga0495622_0081557 3300046557 Bacteria 1488
338 Ga0495667_0188590 3300046559 Bacteria 1322
339 Ga0495635_0684026 3300046663 Bacteria 666
340 Ga0495588_0072271 3300046674 Bacteria 1795
341 Ga0495657_0217436 3300046675 Bacteria 1160
342 Ga0495623_0144849 3300046679 Bacteria 1410
343 Ga0495623_0320743 3300046679 Bacteria 851
344 Ga0495669_0190081 3300046684 Bacteria 980
345 Ga0495581_0278255 3300047315 Bacteria 978
346 Ga0495604_0079769 3300047317 Bacteria 2454
347 Ga0495604_0258601 3300047317 Bacteria 1184
348 Ga0495675_0045325 3300047444 Bacteria 2800
349 Ga0495675_0113986 3300047444 Bacteria 1686
350 Ga0496104_0718333 3300048907 Bacteria 907
351 Ga0496106_1031130 3300048909 Bacteria 646
352 Ga0496109_0781980 3300048912 Bacteria 892
353 Ga0496112_0328866 3300048915 Bacteria 1472
354 Ga0496113_0597122 3300048916 Bacteria 884
355 Ga0496115_0117634 3300048918 Bacteria 2186
356 Ga0496121_0085815 3300048924 Bacteria 2476
357 Ga0496121_0198141 3300048924 Bacteria 1434
358 Ga0496126_0001142 3300048929 Bacteria 44140
359 Ga0496126_0080874 3300048929 Bacteria 2874
360 Ga0501031_0124483 3300049568 Bacteria 1684
361 Ga0501031_0234200 3300049568 Bacteria 1194
362 Ga0501032_0052055 3300049569 Bacteria 2759
363 Ga0501033_0002213 3300049570 Bacteria 16756
364 Ga0501033_0758883 3300049570 Bacteria 657
365 Ga0501034_0566438 3300049571 Bacteria 1044
366 Ga0501036_0275230 3300049572 Bacteria 1409
367 Ga0501036_0537985 3300049572 Bacteria 971
368 Ga0501037_0124984 3300049573 Bacteria 1847
369 Ga0501038_0047231 3300049574 Bacteria 3730
370 Ga0501038_0049475 3300049574 Bacteria 3634
371 Ga0501039_0094906 3300049575 Bacteria 2325
372 Ga0501042_0571648 3300049578 Bacteria 822
373 Ga0501043_0077717 3300049579 Bacteria 2607
374 Ga0501043_0088716 3300049579 Bacteria 2430
375 Ga0501046_0158841 3300049580 Bacteria 1701
376 Ga0501046_0368162 3300049580 Bacteria 1041
377 Ga0501047_0028609 3300049581 Bacteria 5374
378 Ga0501047_0031592 3300049581 Bacteria 5108
379 Ga0501047_0754836 3300049581 Bacteria 789
380 Ga0501048_0152087 3300049582 Bacteria 1637
381 Ga0501069_0200679 3300049585 Bacteria 1156
382 Ga0501073_0080642 3300049589 Bacteria 2264
383 Ga0501074_0367404 3300049590 Bacteria 1021
384 Ga0501079_0637942 3300049741 Bacteria 839
385 Ga0501035_0001136 3300049822 Bacteria 27827
386 Ga0501035_0193750 3300049822 Bacteria 1746
387 Ga0501035_0373406 3300049822 Bacteria 1190
388 Ga0501044_0022782 3300049823 Bacteria 6671
389 Ga0501044_0026653 3300049823 Bacteria 6117
390 Ga0501044_0081258 3300049823 Bacteria 3281
391 Ga0501044_0361045 3300049823 Bacteria 1370
392 Ga0501044_0362365 3300049823 Bacteria 1367
393 Ga0501044_0367900 3300049823 Bacteria 1355
394 Ga0501044_0369385 3300049823 Bacteria 1351
395 Ga0501044_0480880 3300049823 Bacteria 1145
396 Ga0501045_0216710 3300049824 Bacteria 1426
397 nmdc:mga0n895_102638_c1 3300050512 Bacteria 2871
398 nmdc:mga0rr50_132874_c2 3300050513 Bacteria 1444
399 nmdc:mga08x19_306437_c1 3300050514 Bacteria 1104
400 nmdc:mga0a205_75222_c1 3300050515 Bacteria 3263
401 Ga0500557_220487 3300053105 Bacteria 603
402 Ga0500618_051357 3300053125 Bacteria 933
403 Ga0500568_0022542 3300053139 Bacteria 2692
404 Ga0500590_023725 3300053148 Bacteria 3183
405 Ga0500645_029934 3300053730 Bacteria 1641
406 Ga0501082_0430835 3300060353 Bacteria 1152
407 Ga0466962_0019559 3300061719 Bacteria 3255
408 Ga0466962_0044944 3300061719 Bacteria 2112

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_1476504 Ga0395905_1476504_18_533 149
2 3300009545 Ga0105237_10537069 Ga0105237_105370692 150
3 3300013104 Ga0157370_10034591 Ga0157370_100345912 150
4 3300013105 Ga0157369_10027237 Ga0157369_100272377 150
5 3300039453 Ga0436362_0231279 Ga0436362_0231279_97_549 150
6 3300048929 Ga0496126_0080874 Ga0496126_0080874_1863_2315 150
7 3300049568 Ga0501031_0124483 Ga0501031_0124483_1055_1507 150
8 3300049571 Ga0501034_0566438 Ga0501034_0566438_250_714 150
9 3300049823 Ga0501044_0480880 Ga0501044_0480880_649_1101 150
10 3300053125 Ga0500618_051357 Ga0500618_051357_303_764 150
11 3300053148 Ga0500590_023725 Ga0500590_023725_122_583 150
12 3300009094 Ga0111539_10985082 Ga0111539_109850822 153
13 3300005458 Ga0070681_10412233 Ga0070681_104122332 154
14 3300031824 Ga0307413_10173349 Ga0307413_101733494 154
15 3300031852 Ga0307410_10001157 Ga0307410_1000115713 154
16 3300031852 Ga0307410_10439531 Ga0307410_104395313 154
17 3300031903 Ga0307407_10107321 Ga0307407_101073213 154
18 3300032004 Ga0307414_10022314 Ga0307414_100223143 154
19 3300032004 Ga0307414_11878678 Ga0307414_118786781 154
20 3300032005 Ga0307411_10071451 Ga0307411_100714511 154
21 3300006051 Ga0075364_10027407 Ga0075364_100274075 155
22 3300009553 Ga0105249_11142214 Ga0105249_111422142 155
23 3300013104 Ga0157370_10044577 Ga0157370_100445775 155
24 3300013307 Ga0157372_10468782 Ga0157372_104687821 155
25 3300034819 Ga0373958_0124533 Ga0373958_0124533_88_579 155
26 3300035084 Ga0373928_0069403 Ga0373928_0069403_161_652 155
27 3300035092 Ga0373952_0109613 Ga0373952_0109613_166_657 155
28 3300035115 Ga0373941_0046970 Ga0373941_0046970_718_1209 155
29 3300035121 Ga0373960_0015553 Ga0373960_0015553_51_542 155
30 3300035691 Ga0373931_0019572 Ga0373931_0019572_808_1299 155
31 3300037853 Ga0436364_0336095 Ga0436364_0336095_539_1006 155
32 3300038443 Ga0395901_0869094 Ga0395901_0869094_271_747 155
33 3300039437 Ga0436365_1204574 Ga0436365_1204574_82_549 155
34 3300049570 Ga0501033_0002213 Ga0501033_0002213_10191_10658 155
35 3300049578 Ga0501042_0571648 Ga0501042_0571648_198_665 155
36 3300009148 Ga0105243_11029928 Ga0105243_110299282 156
37 3300053139 Ga0500568_0022542 Ga0500568_0022542_666_1148 156
38 3300060353 Ga0501082_0430835 Ga0501082_0430835_463_942 156
39 3300005718 Ga0068866_10656311 Ga0068866_106563111 158
40 3300009551 Ga0105238_10938642 Ga0105238_109386421 159
41 3300025924 Ga0207694_10548850 Ga0207694_105488502 159
42 3300049823 Ga0501044_0026653 Ga0501044_0026653_1519_2019 159
43 3300035695 Ga0373927_0916013 Ga0373927_0916013_45_539 160
44 3300003215 JGI25153J46596_10010148 JGI25153J46596_100101483 161
45 3300003320 rootH2_10020055 rootH2_100200552 161
46 3300005338 Ga0068868_100809646 Ga0068868_1008096461 161
47 3300005535 Ga0070684_100240995 Ga0070684_1002409953 161
48 3300005539 Ga0068853_101044146 Ga0068853_1010441461 161
49 3300005563 Ga0068855_100699765 Ga0068855_1006997651 161
50 3300005577 Ga0068857_100392232 Ga0068857_1003922322 161
51 3300005841 Ga0068863_101049648 Ga0068863_1010496482 161
52 3300006358 Ga0068871_101221697 Ga0068871_1012216971 161
53 3300009177 Ga0105248_10620037 Ga0105248_106200371 161
54 3300009545 Ga0105237_10536076 Ga0105237_105360761 161
55 3300014325 Ga0163163_10053802 Ga0163163_100538023 161
56 3300025258 Ga0209129_1000440 Ga0209129_100044022 161
57 3300025294 Ga0209025_1001496 Ga0209025_100149620 161
58 3300025297 Ga0209758_1001700 Ga0209758_100170015 161
59 3300025931 Ga0207644_10534139 Ga0207644_105341392 161
60 3300025941 Ga0207711_10579511 Ga0207711_105795112 161
61 3300025949 Ga0207667_10284309 Ga0207667_102843092 161
62 3300026078 Ga0207702_10690765 Ga0207702_106907652 161
63 3300026088 Ga0207641_10273371 Ga0207641_102733713 161
64 3300026095 Ga0207676_10202064 Ga0207676_102020642 161
65 3300026116 Ga0207674_10140909 Ga0207674_101409093 161
66 3300026142 Ga0207698_10971590 Ga0207698_109715902 161
67 3300048907 Ga0496104_0718333 Ga0496104_0718333_246_788 161
68 3300048909 Ga0496106_1031130 Ga0496106_1031130_89_631 161
69 3300048912 Ga0496109_0781980 Ga0496109_0781980_287_829 161
70 3300048915 Ga0496112_0328866 Ga0496112_0328866_569_1111 161
71 3300048916 Ga0496113_0597122 Ga0496113_0597122_297_839 161
72 iso_pu_bacteria 2593339239 2595452364 161
73 3300026078 Ga0207702_10126996 Ga0207702_101269962 162
74 3300048924 Ga0496121_0198141 Ga0496121_0198141_839_1333 162
75 3300049824 Ga0501045_0216710 Ga0501045_0216710_722_1210 162
76 iso_pu_bacteria 2643221559 2643818298 162
77 iso_pu_bacteria 2643221573 2643880492 162
78 iso_pu_bacteria 2643221577 2643896565 162
79 iso_pu_bacteria 2643221586 2643937959 162
80 iso_pu_bacteria 2643221612 2644078877 162
81 iso_pu_bacteria 2643221685 2644478682 162
82 iso_pu_bacteria 2643221720 2644661062 162
83 iso_pu_bacteria 2643221727 2644693654 162
84 iso_pu_bacteria 2643221728 2644699143 162
85 3300005335 Ga0070666_10055804 Ga0070666_100558041 163
86 3300005834 Ga0068851_10752305 Ga0068851_107523051 163
87 3300014325 Ga0163163_11585409 Ga0163163_115854092 163
88 3300025903 Ga0207680_10039433 Ga0207680_100394332 163
89 3300005340 Ga0070689_100000006 Ga0070689_100000006254 164
90 3300006844 Ga0075428_100115428 Ga0075428_1001154282 164
91 3300009551 Ga0105238_10189017 Ga0105238_101890173 164
92 3300013104 Ga0157370_10000504 Ga0157370_1000050424 164
93 3300025936 Ga0207670_10000003 Ga0207670_10000003191 164
94 3300049574 Ga0501038_0047231 Ga0501038_0047231_934_1428 164
95 3300049579 Ga0501043_0077717 Ga0501043_0077717_728_1222 164
96 3300049580 Ga0501046_0158841 Ga0501046_0158841_98_592 164
97 3300049581 Ga0501047_0028609 Ga0501047_0028609_1630_2124 164
98 3300049823 Ga0501044_0081258 Ga0501044_0081258_2347_2841 164
99 3300049823 Ga0501044_0367900 Ga0501044_0367900_466_978 164
100 3300053105 Ga0500557_220487 Ga0500557_220487_59_562 164
101 3300053730 Ga0500645_029934 Ga0500645_029934_361_867 164
102 3300002737 JGI25162J39368_1000938 JGI25162J39368_100093822 165
103 3300003214 JGI25165J46597_1000347 JGI25165J46597_100034742 165
104 3300005535 Ga0070684_100812199 Ga0070684_1008121992 165
105 3300005564 Ga0070664_100939654 Ga0070664_1009396542 165
106 3300020610 Ga0154015_1684742 Ga0154015_16847423 165
107 3300025231 Ga0207427_100153 Ga0207427_10015350 165
108 3300025233 Ga0209437_100247 Ga0209437_10024750 165
109 3300025250 Ga0209026_1001537 Ga0209026_10015375 165
110 3300025256 Ga0209759_1000785 Ga0209759_10007857 165
111 3300025261 Ga0209233_1000023 Ga0209233_100002350 165
112 3300025299 Ga0209256_1015633 Ga0209256_10156333 165
113 3300025921 Ga0207652_10011326 Ga0207652_100113263 165
114 3300026041 Ga0207639_10556085 Ga0207639_105560852 165
115 3300001979 JGI24740J21852_10004914 JGI24740J21852_100049144 166
116 3300002705 JGI25156J39149_1031792 JGI25156J39149_10317921 166
117 3300002772 JGI25164J39214_1000109 JGI25164J39214_10001096 166
118 3300003316 rootH1_10065909 rootH1_100659094 166
119 3300003316 rootH1_10092899 rootH1_100928992 166
120 3300003322 rootL2_10188422 rootL2_101884221 166
121 3300003752 Ga0055539_1002038 Ga0055539_10020383 166
122 3300003760 Ga0055527_1000109 Ga0055527_100010914 166
123 3300003760 Ga0055527_1001940 Ga0055527_10019403 166
124 3300003761 Ga0055535_1000344 Ga0055535_10003442 166
125 3300003761 Ga0055535_1000538 Ga0055535_10005387 166
126 3300003761 Ga0055535_1000871 Ga0055535_10008715 166
127 3300003762 Ga0055542_1000101 Ga0055542_100010174 166
128 3300003762 Ga0055542_1000166 Ga0055542_100016688 166
129 3300003762 Ga0055542_1000265 Ga0055542_100026518 166
130 3300003763 Ga0055529_1000105 Ga0055529_100010580 166
131 3300003763 Ga0055529_1000347 Ga0055529_10003475 166
132 3300004800 Ga0058861_11707922 Ga0058861_117079222 166
133 3300005295 Ga0065707_10155161 Ga0065707_101551612 166
134 3300005327 Ga0070658_10542787 Ga0070658_105427872 166
135 3300005328 Ga0070676_10809538 Ga0070676_108095381 166
136 3300005329 Ga0070683_100028598 Ga0070683_1000285983 166
137 3300005331 Ga0070670_100004148 Ga0070670_10000414818 166
138 3300005336 Ga0070680_100195024 Ga0070680_1001950243 166
139 3300005336 Ga0070680_100550617 Ga0070680_1005506172 166
140 3300005337 Ga0070682_100008613 Ga0070682_1000086138 166
141 3300005337 Ga0070682_100420305 Ga0070682_1004203052 166
142 3300005338 Ga0068868_100041144 Ga0068868_1000411442 166
143 3300005406 Ga0070703_10017054 Ga0070703_100170542 166
144 3300005434 Ga0070709_10043762 Ga0070709_100437623 166
145 3300005445 Ga0070708_100084847 Ga0070708_1000848472 166
146 3300005458 Ga0070681_10027506 Ga0070681_100275062 166
147 3300005459 Ga0068867_100031699 Ga0068867_1000316993 166
148 3300005467 Ga0070706_100570396 Ga0070706_1005703962 166
149 3300005518 Ga0070699_100004500 Ga0070699_1000045001 166
150 3300005530 Ga0070679_100030738 Ga0070679_1000307382 166
151 3300005530 Ga0070679_100039549 Ga0070679_1000395499 166
152 3300005535 Ga0070684_100014007 Ga0070684_1000140075 166
153 3300005536 Ga0070697_100333711 Ga0070697_1003337112 166
154 3300005539 Ga0068853_100587000 Ga0068853_1005870002 166
155 3300005545 Ga0070695_100018608 Ga0070695_1000186085 166
156 3300005545 Ga0070695_100281640 Ga0070695_1002816402 166
157 3300005546 Ga0070696_100143774 Ga0070696_1001437742 166
158 3300005547 Ga0070693_100048142 Ga0070693_1000481423 166
159 3300005548 Ga0070665_100010232 Ga0070665_1000102323 166
160 3300005549 Ga0070704_100035905 Ga0070704_1000359055 166
161 3300005563 Ga0068855_100320706 Ga0068855_1003207061 166
162 3300005563 Ga0068855_100454738 Ga0068855_1004547382 166
163 3300005564 Ga0070664_100000498 Ga0070664_10000049827 166
164 3300005577 Ga0068857_100000091 Ga0068857_10000009113 166
165 3300005578 Ga0068854_100007548 Ga0068854_1000075484 166
166 3300005578 Ga0068854_100783900 Ga0068854_1007839002 166
167 3300005614 Ga0068856_100003014 Ga0068856_1000030149 166
168 3300005614 Ga0068856_100603160 Ga0068856_1006031602 166
169 3300005616 Ga0068852_100210954 Ga0068852_1002109542 166
170 3300005617 Ga0068859_100134848 Ga0068859_1001348482 166
171 3300005618 Ga0068864_100001844 Ga0068864_10000184419 166
172 3300005718 Ga0068866_10002628 Ga0068866_100026287 166
173 3300005719 Ga0068861_100230311 Ga0068861_1002303111 166
174 3300005834 Ga0068851_10092273 Ga0068851_100922732 166
175 3300005841 Ga0068863_100021473 Ga0068863_1000214732 166
176 3300005937 Ga0081455_10340971 Ga0081455_103409711 166
177 3300005981 Ga0081538_10014827 Ga0081538_100148274 166
178 3300005985 Ga0081539_10131904 Ga0081539_101319042 166
179 3300006028 Ga0070717_10058759 Ga0070717_100587592 166
180 3300006163 Ga0070715_10184048 Ga0070715_101840482 166
181 3300006173 Ga0070716_100021410 Ga0070716_1000214103 166
182 3300006175 Ga0070712_100634753 Ga0070712_1006347532 166
183 3300006237 Ga0097621_100315975 Ga0097621_1003159752 166
184 3300006358 Ga0068871_100068412 Ga0068871_1000684122 166
185 3300006852 Ga0075433_10518666 Ga0075433_105186662 166
186 3300006871 Ga0075434_100022953 Ga0075434_1000229533 166
187 3300006914 Ga0075436_100528549 Ga0075436_1005285492 166
188 3300006931 Ga0097620_100134837 Ga0097620_1001348372 166
189 3300007076 Ga0075435_100106206 Ga0075435_1001062063 166
190 3300009093 Ga0105240_10000405 Ga0105240_1000040532 166
191 3300009093 Ga0105240_10083188 Ga0105240_100831885 166
192 3300009545 Ga0105237_10052067 Ga0105237_100520675 166
193 3300009545 Ga0105237_10168382 Ga0105237_101683823 166
194 3300009551 Ga0105238_10058059 Ga0105238_100580592 166
195 3300009553 Ga0105249_10114047 Ga0105249_101140475 166
196 3300013100 Ga0157373_10050007 Ga0157373_100500071 166
197 3300013307 Ga0157372_10049251 Ga0157372_100492512 166
198 3300013307 Ga0157372_10096818 Ga0157372_100968183 166
199 3300014968 Ga0157379_10113089 Ga0157379_101130894 166
200 3300015265 Ga0182005_1007244 Ga0182005_10072443 166
201 3300015685 Ga0183369_1003 Ga0183369_1003252 166
202 3300020082 Ga0206353_11119431 Ga0206353_111194312 166
203 3300025228 Ga0209672_100048 Ga0209672_10004889 166
204 3300025228 Ga0209672_100183 Ga0209672_1001836 166
205 3300025228 Ga0209672_100803 Ga0209672_10080317 166
206 3300025230 Ga0209563_100065 Ga0209563_10006598 166
207 3300025242 Ga0209258_100086 Ga0209258_10008689 166
208 3300025242 Ga0209258_100198 Ga0209258_1001986 166
209 3300025242 Ga0209258_100286 Ga0209258_10028690 166
210 3300025254 Ga0209148_1000024 Ga0209148_1000024155 166
211 3300025254 Ga0209148_1000095 Ga0209148_100009589 166
212 3300025254 Ga0209148_1000135 Ga0209148_1000135149 166
213 3300025272 Ga0209455_1000025 Ga0209455_1000025155 166
214 3300025272 Ga0209455_1000087 Ga0209455_100008789 166
215 3300025272 Ga0209455_1000920 Ga0209455_100092014 166
216 3300025885 Ga0207653_10017487 Ga0207653_100174873 166
217 3300025899 Ga0207642_10009404 Ga0207642_100094042 166
218 3300025904 Ga0207647_10002489 Ga0207647_100024892 166
219 3300025904 Ga0207647_10078430 Ga0207647_100784302 166
220 3300025906 Ga0207699_10034559 Ga0207699_100345593 166
221 3300025907 Ga0207645_10058456 Ga0207645_100584562 166
222 3300025909 Ga0207705_10032086 Ga0207705_100320862 166
223 3300025910 Ga0207684_10059142 Ga0207684_100591422 166
224 3300025911 Ga0207654_10249973 Ga0207654_102499731 166
225 3300025912 Ga0207707_10022952 Ga0207707_100229523 166
226 3300025913 Ga0207695_10059806 Ga0207695_100598062 166
227 3300025913 Ga0207695_10741429 Ga0207695_107414292 166
228 3300025914 Ga0207671_10820688 Ga0207671_108206881 166
229 3300025917 Ga0207660_10006902 Ga0207660_100069022 166
230 3300025917 Ga0207660_10012864 Ga0207660_100128644 166
231 3300025917 Ga0207660_10162255 Ga0207660_101622551 166
232 3300025917 Ga0207660_11432716 Ga0207660_114327161 166
233 3300025918 Ga0207662_10078773 Ga0207662_100787732 166
234 3300025919 Ga0207657_10081446 Ga0207657_100814462 166
235 3300025920 Ga0207649_10258119 Ga0207649_102581192 166
236 3300025921 Ga0207652_10003182 Ga0207652_100031829 166
237 3300025921 Ga0207652_10304457 Ga0207652_103044572 166
238 3300025922 Ga0207646_10009423 Ga0207646_100094235 166
239 3300025924 Ga0207694_10215529 Ga0207694_102155292 166
240 3300025925 Ga0207650_10041976 Ga0207650_100419763 166
241 3300025926 Ga0207659_10326357 Ga0207659_103263571 166
242 3300025928 Ga0207700_10111699 Ga0207700_101116993 166
243 3300025932 Ga0207690_10049579 Ga0207690_100495794 166
244 3300025932 Ga0207690_10155158 Ga0207690_101551582 166
245 3300025933 Ga0207706_10005342 Ga0207706_100053422 166
246 3300025939 Ga0207665_10439877 Ga0207665_104398772 166
247 3300025942 Ga0207689_10199563 Ga0207689_101995633 166
248 3300025944 Ga0207661_10017862 Ga0207661_100178625 166
249 3300025944 Ga0207661_10100365 Ga0207661_101003652 166
250 3300025945 Ga0207679_10003746 Ga0207679_100037469 166
251 3300025945 Ga0207679_10498545 Ga0207679_104985451 166
252 3300025949 Ga0207667_10002617 Ga0207667_100026173 166
253 3300025949 Ga0207667_10063415 Ga0207667_100634154 166
254 3300025949 Ga0207667_10334209 Ga0207667_103342092 166
255 3300025981 Ga0207640_10013036 Ga0207640_100130362 166
256 3300025981 Ga0207640_11197625 Ga0207640_111976251 166
257 3300025981 Ga0207640_11411684 Ga0207640_114116841 166
258 3300026023 Ga0207677_10017768 Ga0207677_100177682 166
259 3300026041 Ga0207639_10017805 Ga0207639_100178052 166
260 3300026041 Ga0207639_10110867 Ga0207639_101108672 166
261 3300026067 Ga0207678_10081928 Ga0207678_100819283 166
262 3300026078 Ga0207702_10052748 Ga0207702_100527482 166
263 3300026078 Ga0207702_10896489 Ga0207702_108964892 166
264 3300026078 Ga0207702_11172923 Ga0207702_111729232 166
265 3300026088 Ga0207641_10007542 Ga0207641_100075428 166
266 3300026089 Ga0207648_10014095 Ga0207648_100140952 166
267 3300026095 Ga0207676_10004120 Ga0207676_100041207 166
268 3300026116 Ga0207674_10000126 Ga0207674_100001262 166
269 3300026116 Ga0207674_10104006 Ga0207674_101040063 166
270 3300026118 Ga0207675_100280499 Ga0207675_1002804992 166
271 3300026121 Ga0207683_10924261 Ga0207683_109242612 166
272 3300026142 Ga0207698_10003097 Ga0207698_100030976 166
273 3300028379 Ga0268266_10055239 Ga0268266_100552392 166
274 3300028381 Ga0268264_10377415 Ga0268264_103774152 166
275 3300035085 Ga0373929_0027345 Ga0373929_0027345_125_625 166
276 3300035691 Ga0373931_0808299 Ga0373931_0808299_10_510 166
277 3300037312 Ga0395899_0024742 Ga0395899_0024742_3761_4261 166
278 3300037418 Ga0395900_0200943 Ga0395900_0200943_821_1321 166
279 3300037418 Ga0395900_1096574 Ga0395900_1096574_74_574 166
280 3300037853 Ga0436364_0829546 Ga0436364_0829546_159_659 166
281 3300038443 Ga0395901_0027426 Ga0395901_0027426_4350_4850 166
282 3300038443 Ga0395901_0170702 Ga0395901_0170702_283_783 166
283 3300041404 Ga0439436_0011145 Ga0439436_0011145_1987_2487 166
284 3300041406 Ga0439439_0003978 Ga0439439_0003978_515_1015 166
285 3300042004 Ga0439445_0024361 Ga0439445_0024361_737_1237 166
286 3300042007 Ga0439449_0106817 Ga0439449_0106817_200_700 166
287 3300042435 Ga0439434_0152430 Ga0439434_0152430_79_579 166
288 3300044656 Ga0466969_0006538 Ga0466969_0006538_652_1152 166
289 3300044656 Ga0466969_0123669 Ga0466969_0123669_682_1182 166
290 3300044663 Ga0466989_0230362 Ga0466989_0230362_128_628 166
291 3300044683 Ga0466965_0146003 Ga0466965_0146003_420_920 166
292 3300044684 Ga0466966_0035928 Ga0466966_0035928_386_886 166
293 3300044693 Ga0466961_0010597 Ga0466961_0010597_4119_4619 166
294 3300044693 Ga0466961_0011336 Ga0466961_0011336_157_657 166
295 3300044693 Ga0466961_0025716 Ga0466961_0025716_1237_1737 166
296 3300044693 Ga0466961_0084887 Ga0466961_0084887_1465_1965 166
297 3300044706 Ga0466964_0010085 Ga0466964_0010085_1665_2165 166
298 3300044712 Ga0453684_0076459 Ga0453684_0076459_1450_1959 166
299 3300044719 Ga0466971_0023105 Ga0466971_0023105_1191_1691 166
300 3300044719 Ga0466971_0094494 Ga0466971_0094494_680_1180 166
301 3300044735 Ga0466968_0007475 Ga0466968_0007475_1076_1576 166
302 3300044735 Ga0466968_0204548 Ga0466968_0204548_75_575 166
303 3300044735 Ga0466968_0542791 Ga0466968_0542791_69_569 166
304 3300044765 Ga0466970_0012844 Ga0466970_0012844_3155_3655 166
305 3300044765 Ga0466970_0164948 Ga0466970_0164948_94_594 166
306 3300044842 Ga0466957_0024604 Ga0466957_0024604_1775_2275 166
307 3300044842 Ga0466957_0058949 Ga0466957_0058949_1416_1916 166
308 3300045049 Ga0466959_0124236 Ga0466959_0124236_747_1247 166
309 3300045049 Ga0466959_0147684 Ga0466959_0147684_612_1112 166
310 3300045836 Ga0466958_0139519 Ga0466958_0139519_628_1128 166
311 3300045836 Ga0466958_0168564 Ga0466958_0168564_531_1031 166
312 3300046455 Ga0495603_0067059 Ga0495603_0067059_682_1182 166
313 3300046472 Ga0495580_0008307 Ga0495580_0008307_4467_4967 166
314 3300046473 Ga0495582_0000961 Ga0495582_0000961_4601_5101 166
315 3300046501 Ga0495607_0000038 Ga0495607_0000038_77423_77923 166
316 3300046557 Ga0495622_0081557 Ga0495622_0081557_563_1063 166
317 3300048918 Ga0496115_0117634 Ga0496115_0117634_1379_1879 166
318 3300048924 Ga0496121_0085815 Ga0496121_0085815_557_1057 166
319 3300048929 Ga0496126_0001142 Ga0496126_0001142_26330_26830 166
320 3300049568 Ga0501031_0234200 Ga0501031_0234200_257_757 166
321 3300049569 Ga0501032_0052055 Ga0501032_0052055_886_1386 166
322 3300049570 Ga0501033_0758883 Ga0501033_0758883_21_521 166
323 3300049572 Ga0501036_0275230 Ga0501036_0275230_442_942 166
324 3300049572 Ga0501036_0537985 Ga0501036_0537985_99_599 166
325 3300049573 Ga0501037_0124984 Ga0501037_0124984_312_812 166
326 3300049574 Ga0501038_0049475 Ga0501038_0049475_2774_3274 166
327 3300049575 Ga0501039_0094906 Ga0501039_0094906_1388_1888 166
328 3300049579 Ga0501043_0088716 Ga0501043_0088716_483_983 166
329 3300049580 Ga0501046_0368162 Ga0501046_0368162_241_741 166
330 3300049581 Ga0501047_0031592 Ga0501047_0031592_4285_4785 166
331 3300049581 Ga0501047_0754836 Ga0501047_0754836_208_708 166
332 3300049582 Ga0501048_0152087 Ga0501048_0152087_958_1458 166
333 3300049585 Ga0501069_0200679 Ga0501069_0200679_417_917 166
334 3300049589 Ga0501073_0080642 Ga0501073_0080642_532_1032 166
335 3300049590 Ga0501074_0367404 Ga0501074_0367404_44_544 166
336 3300049741 Ga0501079_0637942 Ga0501079_0637942_275_775 166
337 3300049822 Ga0501035_0001136 Ga0501035_0001136_433_933 166
338 3300049822 Ga0501035_0193750 Ga0501035_0193750_281_781 166
339 3300049822 Ga0501035_0373406 Ga0501035_0373406_296_796 166
340 3300049823 Ga0501044_0022782 Ga0501044_0022782_1925_2425 166
341 3300049823 Ga0501044_0361045 Ga0501044_0361045_622_1122 166
342 3300049823 Ga0501044_0362365 Ga0501044_0362365_281_781 166
343 3300049823 Ga0501044_0369385 Ga0501044_0369385_213_713 166
344 3300050512 nmdc:mga0n895_102638_c1 nmdc:mga0n895_102638_c1_2349_2849 166
345 3300050513 nmdc:mga0rr50_132874_c2 nmdc:mga0rr50_132874_c2_542_1042 166
346 3300050514 nmdc:mga08x19_306437_c1 nmdc:mga08x19_306437_c1_23_523 166
347 3300050515 nmdc:mga0a205_75222_c1 nmdc:mga0a205_75222_c1_2364_2864 166
348 3300061719 Ga0466962_0019559 Ga0466962_0019559_1665_2165 166
349 3300061719 Ga0466962_0044944 Ga0466962_0044944_1001_1501 166
350 3300001915 JGI24741J21665_1004396 JGI24741J21665_10043963 167
351 3300001979 JGI24740J21852_10038287 JGI24740J21852_100382871 167
352 3300005336 Ga0070680_100371762 Ga0070680_1003717622 167
353 3300005337 Ga0070682_100201240 Ga0070682_1002012403 167
354 3300005339 Ga0070660_100279254 Ga0070660_1002792541 167
355 3300005341 Ga0070691_10190104 Ga0070691_101901042 167
356 3300005344 Ga0070661_100242842 Ga0070661_1002428421 167
357 3300005345 Ga0070692_10110011 Ga0070692_101100112 167
358 3300005366 Ga0070659_100176035 Ga0070659_1001760352 167
359 3300005437 Ga0070710_10594148 Ga0070710_105941482 167
360 3300005439 Ga0070711_100294618 Ga0070711_1002946181 167
361 3300005458 Ga0070681_10035481 Ga0070681_100354813 167
362 3300005530 Ga0070679_100043119 Ga0070679_1000431194 167
363 3300005535 Ga0070684_100008688 Ga0070684_1000086886 167
364 3300005539 Ga0068853_100446225 Ga0068853_1004462252 167
365 3300005546 Ga0070696_100649611 Ga0070696_1006496112 167
366 3300005563 Ga0068855_100575928 Ga0068855_1005759282 167
367 3300005564 Ga0070664_100046208 Ga0070664_1000462083 167
368 3300005577 Ga0068857_100566341 Ga0068857_1005663412 167
369 3300005578 Ga0068854_100560489 Ga0068854_1005604891 167
370 3300005616 Ga0068852_100061068 Ga0068852_1000610683 167
371 3300005840 Ga0068870_11008459 Ga0068870_110084591 167
372 3300005841 Ga0068863_100122092 Ga0068863_1001220923 167
373 3300009093 Ga0105240_10466822 Ga0105240_104668222 167
374 3300009174 Ga0105241_11154094 Ga0105241_111540941 167
375 3300009545 Ga0105237_10352671 Ga0105237_103526713 167
376 3300013102 Ga0157371_10206251 Ga0157371_102062511 167
377 3300013105 Ga0157369_10288224 Ga0157369_102882241 167
378 3300013307 Ga0157372_10504613 Ga0157372_105046131 167
379 3300014325 Ga0163163_10050457 Ga0163163_100504574 167
380 3300025899 Ga0207642_10331474 Ga0207642_103314741 167
381 3300025904 Ga0207647_10189779 Ga0207647_101897792 167
382 3300025909 Ga0207705_10266030 Ga0207705_102660302 167
383 3300025911 Ga0207654_10453923 Ga0207654_104539232 167
384 3300025912 Ga0207707_10001178 Ga0207707_1000117813 167
385 3300025912 Ga0207707_10012437 Ga0207707_100124375 167
386 3300025913 Ga0207695_10015925 Ga0207695_100159257 167
387 3300025917 Ga0207660_10015650 Ga0207660_100156505 167
388 3300025917 Ga0207660_10186084 Ga0207660_101860841 167
389 3300025919 Ga0207657_10014092 Ga0207657_100140922 167
390 3300025920 Ga0207649_10006172 Ga0207649_100061722 167
391 3300025921 Ga0207652_10061250 Ga0207652_100612501 167
392 3300025931 Ga0207644_10717368 Ga0207644_107173681 167
393 3300025944 Ga0207661_10027649 Ga0207661_100276495 167
394 3300025949 Ga0207667_10014185 Ga0207667_100141857 167
395 3300025981 Ga0207640_10225293 Ga0207640_102252931 167
396 3300026041 Ga0207639_10049588 Ga0207639_100495885 167
397 3300026067 Ga0207678_10205678 Ga0207678_102056782 167
398 3300026088 Ga0207641_10397160 Ga0207641_103971602 167
399 3300026116 Ga0207674_10009779 Ga0207674_100097796 167
400 3300026142 Ga0207698_10050027 Ga0207698_100500272 167
401 3300036401 Ga0373937_1657017 Ga0373937_1657017_33_566 167
402 3300045976 Ga0466967_0016206 Ga0466967_0016206_229_753 167
403 3300046472 Ga0495580_0133154 Ga0495580_0133154_647_1180 167
404 3300046475 Ga0495639_0263166 Ga0495639_0263166_22_555 167
405 3300046543 Ga0495645_0104890 Ga0495645_0104890_129_662 167
406 3300046543 Ga0495645_0341680 Ga0495645_0341680_305_838 167
407 3300046559 Ga0495667_0188590 Ga0495667_0188590_669_1202 167
408 3300046663 Ga0495635_0684026 Ga0495635_0684026_44_577 167
409 3300046674 Ga0495588_0072271 Ga0495588_0072271_997_1530 167
410 3300046675 Ga0495657_0217436 Ga0495657_0217436_86_598 167
411 3300046679 Ga0495623_0144849 Ga0495623_0144849_741_1274 167
412 3300046679 Ga0495623_0320743 Ga0495623_0320743_33_566 167
413 3300046684 Ga0495669_0190081 Ga0495669_0190081_33_566 167
414 3300047315 Ga0495581_0278255 Ga0495581_0278255_388_921 167
415 3300047317 Ga0495604_0079769 Ga0495604_0079769_1008_1541 167
416 3300047317 Ga0495604_0258601 Ga0495604_0258601_585_1118 167
417 3300047444 Ga0495675_0045325 Ga0495675_0045325_90_623 167
418 3300047444 Ga0495675_0113986 Ga0495675_0113986_583_1116 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

33

166

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pu2-assembly7.cif.gz_G crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9209 17 167
3pu2-assembly4.cif.gz_D crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9173 16 165
3pu2-assembly1.cif.gz_A crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9148 16 165
3pu2-assembly7.cif.gz_G crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9094 17 167
3pu2-assembly3.cif.gz_C crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9067 16 167
ID Description Score Start End Superfamily
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9084 16 164 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8846 16 164 3.30.530.20
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8578 17 165 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8518 17 163 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8494 14 166 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A841KF01-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 1.002 14 167
AF-A0A841KF01-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9891 14 167
AF-A0A2W4QX31-F1-model_v4 ATPase 0.9843 14 133
AF-A0A1G4TBI9-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9764 14 166
AF-A0A1W2DLK6-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9713 15 161

Feature Viewer

pLDDT pTM Quality
88.06 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map