F439134

General Info

Members Datasets Scaffolds Average Seq Length
417 321 834 161

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0020908|Ga0495605_0020908_828_1400
Length 190
Sequence VPGWKIPPLGSPCPLKYRQSEFCKIKETTMPSFDVVCEADMVEVKNAVEQSNKEITTRFDFKGSSANVEQKERELTLFADSDFQLSQVRDVLVNKMTKRKVDVRFLDEGKIEKIGGDKVKQVIKVRNGIETDDAKKITKLIKESKMKVQASIQGESVRVTGAKRDDLQAAMAMLRKDVQELPLAFNNFRD

Samples

Sample ID Description Type Environment
1 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
2 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
4 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
126 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
130 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
131 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
132 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
133 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
149 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
150 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
151 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
152 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
213 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
214 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
223 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
224 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
225 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
237 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
238 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
239 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
240 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
241 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
242 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
243 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
244 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
245 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
246 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
247 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
248 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
249 2519103095 Burkholderia sp. KJ006 Isolate Nodule
250 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
251 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
252 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
253 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
254 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
255 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
256 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
257 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
258 2643221596 Acidovorax sp. Root70 Isolate Unclassified
259 2643221645 Massilia sp. Root351 Isolate Unclassified
260 2643221652 Acidovorax sp. Root402 Isolate Unclassified
261 2643221664 Massilia sp. Root418 Isolate Unclassified
262 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
263 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
264 2721755523 Delftia sp. HK171 Isolate Unclassified
265 2738541280 Massilia sp. GV090 Isolate Unclassified
266 2738541300 Massilia sp. GV016 Isolate Unclassified
267 2738543012 Acidovorax sp. CF301 Isolate Unclassified
268 2738543018 Massilia sp. GV045 Isolate Unclassified
269 2738543030 Massilia sp. GV097 Isolate Unclassified
270 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
271 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
272 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
273 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
274 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
275 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
276 2816332133 Acidovorax radicis 2721A Isolate Unclassified
277 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
278 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
279 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
280 2818991452 Burkholderia cepacia 561 Isolate Unclassified
281 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
282 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
283 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
284 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
285 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
286 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
287 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
288 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
289 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
290 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
291 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
292 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
293 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
294 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
295 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
296 2904564687 Burkholderia sp. 571 Isolate Unclassified
297 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
298 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
299 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
300 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
301 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
302 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
303 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
304 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
305 2928170801 Burkholderia sp. 572 Isolate Unclassified
306 2928536128 Burkholderia sola 565 Isolate Unclassified
307 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
308 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
309 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
310 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
311 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
312 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
313 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
314 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
315 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
316 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
317 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
318 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
319 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
320 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
321 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.02
Metatranscriptomes 3.36
Isolates 20.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.99
Nodule 3.84
Rhizoplane 4.08
Rhizosphere 65.47
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495605_0020908 3300046474 Bacteria 3472
2 Ga0007416J51690_1068484 3300003577 Bacteria 597
3 Ga0055539_1000018 3300003752 Bacteria 348596
4 Ga0055533_1000022 3300003756 Bacteria 348596
5 Ga0055533_1013801 3300003756 Bacteria 823
6 Ga0055525_1000024 3300003759 Bacteria 348596
7 Ga0055542_1000912 3300003762 Bacteria 19971
8 Ga0055529_1000736 3300003763 Bacteria 21244
9 Ga0055526_1008392 3300003771 Bacteria 5165
10 Ga0055537_1020697 3300003773 Bacteria 993
11 Ga0055524_1003056 3300003775 Bacteria 8282
12 Ga0055536_1021026 3300003781 Bacteria 1995
13 Ga0055534_1000791 3300003784 Bacteria 14727
14 Ga0055534_1001318 3300003784 Bacteria 9988
15 Ga0055528_1011129 3300003790 Bacteria 3601
16 Ga0055540_1019027 3300003792 Bacteria 1863
17 Ga0055541_1000013 3300003841 Bacteria 348596
18 Ga0058692_1001169 3300003856 Bacteria 10109
19 Ga0070683_100692916 3300005329 Bacteria 976
20 Ga0070670_100019097 3300005331 Bacteria 5877
21 Ga0070666_10083892 3300005335 Bacteria 2180
22 Ga0070687_100138030 3300005343 Bacteria 1416
23 Ga0070675_100060595 3300005354 Bacteria 3124
24 Ga0070673_100232812 3300005364 Bacteria 1599
25 Ga0070659_100651796 3300005366 Bacteria 908
26 Ga0070667_100029610 3300005367 Bacteria 4564
27 Ga0070667_100128635 3300005367 Bacteria 2209
28 Ga0070667_100365176 3300005367 Bacteria 1309
29 Ga0070663_100068153 3300005455 Bacteria 2583
30 Ga0070678_100183447 3300005456 Bacteria 1715
31 Ga0070662_101272412 3300005457 Bacteria 633
32 Ga0070706_101545929 3300005467 Bacteria 606
33 Ga0070707_100423141 3300005468 Bacteria 1292
34 Ga0070707_100948890 3300005468 Bacteria 825
35 Ga0070697_100001459 3300005536 Bacteria 18011
36 Ga0068853_100840930 3300005539 Bacteria 880
37 Ga0070672_100117176 3300005543 Bacteria 2177
38 Ga0070665_100001298 3300005548 Bacteria 29902
39 Ga0070665_100268336 3300005548 Bacteria 1708
40 Ga0068855_100003098 3300005563 Bacteria 20357
41 Ga0068856_100167018 3300005614 Bacteria 2212
42 Ga0070702_100022888 3300005615 Bacteria 3312
43 Ga0068852_100880917 3300005616 Bacteria 912
44 Ga0068859_100087555 3300005617 Bacteria 3163
45 Ga0068864_100038547 3300005618 Bacteria 4082
46 Ga0068861_100139213 3300005719 Bacteria 1979
47 Ga0068851_10097907 3300005834 Bacteria 1553
48 Ga0068863_100053357 3300005841 Bacteria 3832
49 Ga0068858_100011298 3300005842 Bacteria 8438
50 Ga0068862_100479537 3300005844 Bacteria 1177
51 Ga0075433_11032783 3300006852 Bacteria 716
52 Ga0075434_100028870 3300006871 Bacteria 5454
53 Ga0097620_100087554 3300006931 Bacteria 3163
54 Ga0079104_1000025 3300006946 Bacteria 218785
55 Ga0105251_10088349 3300009011 Bacteria 1426
56 Ga0105244_10174512 3300009036 Bacteria 1022
57 Ga0105245_10055452 3300009098 Bacteria 3560
58 Ga0105242_10010605 3300009176 Bacteria 7074
59 Ga0105248_10029285 3300009177 Bacteria 6142
60 Ga0105238_10451968 3300009551 Bacteria 1282
61 Ga0105249_11331277 3300009553 Bacteria 790
62 Ga0105249_12807613 3300009553 Bacteria 559
63 Ga0105239_12244232 3300010375 Bacteria 635
64 Ga0157373_10290845 3300013100 Bacteria 1159
65 Ga0157373_10854759 3300013100 Bacteria 673
66 Ga0157371_10000013 3300013102 Bacteria 352631
67 Ga0157371_10216036 3300013102 Bacteria 1377
68 Ga0157369_10355192 3300013105 Bacteria 1522
69 Ga0157369_11087400 3300013105 Bacteria 817
70 Ga0163162_10015514 3300013306 Bacteria 7446
71 Ga0163162_10915929 3300013306 Bacteria 989
72 Ga0157372_10199703 3300013307 Bacteria 2316
73 Ga0157375_10124536 3300013308 Bacteria 2691
74 Ga0157375_10137309 3300013308 Bacteria 2570
75 Ga0182008_10028331 3300014497 Bacteria 2832
76 Ga0157379_10210090 3300014968 Bacteria 1762
77 Ga0182006_1015321 3300015261 Bacteria 3288
78 Ga0182007_10014458 3300015262 Bacteria 2975
79 Ga0182007_10023971 3300015262 Bacteria 2140
80 Ga0213876_10057183 3300021384 Bacteria 2059
81 Ga0209784_100005 3300025224 Bacteria 1040422
82 Ga0209566_100005 3300025225 Bacteria 1040422
83 Ga0209566_100810 3300025225 Bacteria 16264
84 Ga0209674_100009 3300025226 Bacteria 1040422
85 Ga0209674_104787 3300025226 Bacteria 2132
86 Ga0209672_100034 3300025228 Bacteria 304973
87 Ga0209147_100137 3300025229 Bacteria 117316
88 Ga0209563_100012 3300025230 Bacteria 1040422
89 Ga0209258_100023 3300025242 Bacteria 547286
90 Ga0209677_100006 3300025253 Bacteria 1040422
91 Ga0209148_1000029 3300025254 Bacteria 579199
92 Ga0209565_1000093 3300025263 Bacteria 138690
93 Ga0209455_1000167 3300025272 Bacteria 112131
94 Ga0209673_1000443 3300025273 Bacteria 71250
95 Ga0209673_1017624 3300025273 Bacteria 2627
96 Ga0209673_1019032 3300025273 Bacteria 2477
97 Ga0209130_1002151 3300025284 Bacteria 10410
98 Ga0209130_1028145 3300025284 Bacteria 1185
99 Ga0209675_1000714 3300025291 Bacteria 22673
100 Ga0209675_1008891 3300025291 Bacteria 3616
101 Ga0209676_1002715 3300025292 Bacteria 11930
102 Ga0209025_1000625 3300025294 Bacteria 62737
103 Ga0209025_1018345 3300025294 Bacteria 3973
104 Ga0209564_1001276 3300025295 Bacteria 27713
105 Ga0209564_1011949 3300025295 Bacteria 3833
106 Ga0209758_1014768 3300025297 Bacteria 4118
107 Ga0209758_1044351 3300025297 Bacteria 1626
108 Ga0209050_1023300 3300025298 Bacteria 2183
109 Ga0209256_1000044 3300025299 Bacteria 337264
110 Ga0209256_1004854 3300025299 Bacteria 8123
111 Ga0209051_1003871 3300025303 Bacteria 9560
112 Ga0209257_1059785 3300025304 Bacteria 1039
113 Ga0207656_10274130 3300025321 Bacteria 831
114 Ga0207696_1066454 3300025711 Bacteria 1007
115 Ga0207713_1151678 3300025735 Bacteria 747
116 Ga0207688_10035229 3300025901 Bacteria 2773
117 Ga0207680_10403537 3300025903 Bacteria 966
118 Ga0207647_10519068 3300025904 Bacteria 663
119 Ga0207705_10144456 3300025909 Bacteria 1779
120 Ga0207705_10327160 3300025909 Bacteria 1178
121 Ga0207684_11459333 3300025910 Bacteria 558
122 Ga0207662_10303176 3300025918 Unclassified 1062
123 Ga0207657_11171726 3300025919 Bacteria 585
124 Ga0207652_10404129 3300025921 Bacteria 1232
125 Ga0207652_11280565 3300025921 Bacteria 636
126 Ga0207646_10058970 3300025922 Bacteria 3428
127 Ga0207681_10176475 3300025923 Bacteria 1624
128 Ga0207694_10917152 3300025924 Bacteria 741
129 Ga0207650_10011620 3300025925 Bacteria 6065
130 Ga0207687_10105592 3300025927 Bacteria 2081
131 Ga0207690_10537622 3300025932 Bacteria 949
132 Ga0207706_10467031 3300025933 Bacteria 1091
133 Ga0207709_10000459 3300025935 Bacteria 37691
134 Ga0207670_11420249 3300025936 Bacteria 589
135 Ga0207691_10045831 3300025940 Bacteria 4019
136 Ga0207711_10101342 3300025941 Bacteria 2548
137 Ga0207689_10345624 3300025942 Bacteria 1236
138 Ga0207667_10000078 3300025949 Bacteria 165061
139 Ga0207651_10557186 3300025960 Bacteria 997
140 Ga0207712_10490559 3300025961 Bacteria 1048
141 Ga0207668_10278696 3300025972 Bacteria 1370
142 Ga0207668_10727207 3300025972 Unclassified 874
143 Ga0207658_10197884 3300025986 Bacteria 1675
144 Ga0207658_10304963 3300025986 Bacteria 1373
145 Ga0207703_10039449 3300026035 Bacteria 3775
146 Ga0207678_10075065 3300026067 Bacteria 2897
147 Ga0207702_10461285 3300026078 Bacteria 1234
148 Ga0207641_10094529 3300026088 Bacteria 2622
149 Ga0207641_10178916 3300026088 Bacteria 1941
150 Ga0207641_11138602 3300026088 Bacteria 779
151 Ga0207676_10077758 3300026095 Bacteria 2685
152 Ga0207675_100137906 3300026118 Bacteria 2315
153 Ga0207683_10210367 3300026121 Bacteria 1770
154 Ga0209281_1000007 3300027111 Bacteria 938265
155 Ga0209371_1000531 3300027312 Bacteria 36216
156 Ga0268266_10000623 3300028379 Bacteria 48194
157 Ga0268266_10161271 3300028379 Bacteria 2029
158 Ga0265338_10005002 3300028800 Bacteria 17529
159 Ga0265338_10116396 3300028800 Bacteria 2141
160 Ga0268256_1000454 3300030500 Bacteria 36030
161 Ga0316177_1066173 3300030731 Bacteria 918
162 Ga0316183_1165787 3300030742 Bacteria 1108
163 Ga0316182_1324657 3300030745 Bacteria 2373
164 Ga0265328_10026822 3300031239 Bacteria 2164
165 Ga0265327_10000210 3300031251 Bacteria 122385
166 Ga0307513_10000004 3300031456 Bacteria 558931
167 Ga0307513_10510833 3300031456 Bacteria 918
168 Ga0307405_10098179 3300031731 Bacteria 1957
169 Ga0307416_100041360 3300032002 Bacteria 3589
170 Ga0307414_10745333 3300032004 Bacteria 890
171 Ga0307415_100290792 3300032126 Bacteria 1349
172 Ga0373937_0012321 3300036401 Bacteria 7518
173 Ga0316584_0570137 3300036712 Unclassified 788
174 Ga0395899_0000128 3300037312 Bacteria 119014
175 Ga0395905_0001002 3300037471 Bacteria 36131
176 Ga0395905_0162691 3300037471 Bacteria 2097
177 Ga0395901_0216599 3300038443 Bacteria 2003
178 Ga0436365_0250047 3300039437 Bacteria 3038
179 Ga0436361_0023797 3300039447 Bacteria 885
180 Ga0436361_0385943 3300039447 Bacteria 5185
181 Ga0436362_0550928 3300039453 Bacteria 681
182 Ga0451791_0811718 3300041451 Bacteria 706
183 Ga0451795_0501340 3300041456 Bacteria 2176
184 Ga0450904_000049 3300042139 Bacteria 27407
185 Ga0439446_0071589 3300042156 Bacteria 1062
186 Ga0439458_0132985 3300042157 Bacteria 660
187 Ga0451577_0170156 3300042876 Bacteria 1963
188 Ga0466972_0000111 3300044658 Bacteria 70764
189 Ga0453683_0318600 3300044673 Bacteria 996
190 Ga0453683_0896582 3300044673 Bacteria 586
191 Ga0466964_0082809 3300044706 Bacteria 1380
192 Ga0453684_0133652 3300044712 Bacteria 2974
193 Ga0453684_0247482 3300044712 Bacteria 2049
194 Ga0495617_000308 3300046452 Bacteria 27563
195 Ga0495590_0394511 3300046457 Bacteria 530
196 Ga0495584_0000007 3300046491 Bacteria 294820
197 Ga0495584_0004754 3300046491 Bacteria 7267
198 Ga0495584_0045745 3300046491 Bacteria 2207
199 Ga0495584_0055156 3300046491 Bacteria 2000
200 Ga0495584_0071147 3300046491 Bacteria 1748
201 Ga0495584_0130095 3300046491 Bacteria 1277
202 Ga0495584_0462900 3300046491 Bacteria 645
203 Ga0495585_0000421 3300046492 Bacteria 40862
204 Ga0495585_0000737 3300046492 Bacteria 29182
205 Ga0495585_0001804 3300046492 Bacteria 16256
206 Ga0495585_0090678 3300046492 Bacteria 1646
207 Ga0495596_0000474 3300046500 Bacteria 25448
208 Ga0495596_0005306 3300046500 Bacteria 6108
209 Ga0495583_0000337 3300046506 Bacteria 73928
210 Ga0495583_0000569 3300046506 Bacteria 50860
211 Ga0495583_0023788 3300046506 Bacteria 3090
212 Ga0495583_0028822 3300046506 Bacteria 2724
213 Ga0495606_0007593 3300046507 Bacteria 9651
214 Ga0495606_0014495 3300046507 Bacteria 6146
215 Ga0495606_0244187 3300046507 Bacteria 999
216 Ga0495616_0000380 3300046513 Bacteria 34689
217 Ga0495620_0002173 3300046515 Bacteria 11391
218 Ga0495631_0088572 3300046518 Bacteria 1332
219 Ga0495637_0064669 3300046520 Bacteria 1491
220 Ga0495643_0000200 3300046522 Bacteria 93353
221 Ga0495643_0011335 3300046522 Bacteria 5434
222 Ga0495643_0025795 3300046522 Bacteria 3323
223 Ga0495644_0008885 3300046523 Bacteria 3864
224 Ga0495648_0000112 3300046524 Bacteria 99859
225 Ga0495648_0003765 3300046524 Bacteria 13196
226 Ga0495648_0061619 3300046524 Bacteria 2227
227 Ga0495642_0009816 3300046528 Bacteria 3667
228 Ga0495642_0057102 3300046528 Bacteria 1613
229 Ga0495642_0059026 3300046528 Bacteria 1589
230 Ga0495642_0062719 3300046528 Bacteria 1544
231 Ga0495642_0132639 3300046528 Bacteria 1073
232 Ga0495642_0467076 3300046528 Bacteria 558
233 Ga0495609_0001355 3300046538 Bacteria 16522
234 Ga0495609_0077106 3300046538 Bacteria 1460
235 Ga0495597_0052600 3300046542 Bacteria 1793
236 Ga0495597_0103491 3300046542 Bacteria 1198
237 Ga0495597_0135684 3300046542 Bacteria 1018
238 Ga0495622_0000525 3300046557 Bacteria 23159
239 Ga0495633_0015752 3300046558 Bacteria 3917
240 Ga0495656_0031907 3300046615 Bacteria 2140
241 Ga0495668_0039423 3300046616 Bacteria 2637
242 Ga0495668_0257950 3300046616 Bacteria 954
243 Ga0495611_0010326 3300046648 Bacteria 3950
244 Ga0495625_0039101 3300046660 Bacteria 3466
245 Ga0495625_0049831 3300046660 Bacteria 3008
246 Ga0495659_0000961 3300046664 Bacteria 10158
247 Ga0495659_0018422 3300046664 Bacteria 2326
248 Ga0495661_0004612 3300046665 Bacteria 9919
249 Ga0495661_0021657 3300046665 Bacteria 4187
250 Ga0495588_0102358 3300046674 Bacteria 1505
251 Ga0495588_0109607 3300046674 Bacteria 1454
252 Ga0495588_0135547 3300046674 Bacteria 1299
253 Ga0495669_0154725 3300046684 Bacteria 1086
254 Ga0495669_0155331 3300046684 Bacteria 1084
255 Ga0495670_0001222 3300046691 Bacteria 12500
256 Ga0495670_0015711 3300046691 Bacteria 3721
257 Ga0495671_0000864 3300046692 Bacteria 21688
258 Ga0495649_0114837 3300046694 Bacteria 1426
259 Ga0495589_0004740 3300046794 Bacteria 7219
260 Ga0495589_0101314 3300046794 Bacteria 1394
261 Ga0495660_0004574 3300046810 Bacteria 8354
262 Ga0495660_0225036 3300046810 Bacteria 882
263 Ga0495636_0011073 3300047318 Bacteria 3568
264 Ga0495672_0000343 3300047320 Bacteria 59629
265 Ga0495672_0017115 3300047320 Bacteria 4855
266 Ga0495676_0126231 3300047321 Bacteria 1854
267 Ga0495676_0184831 3300047321 Bacteria 1458
268 Ga0495683_0000083 3300047323 Bacteria 93743
269 Ga0495687_013147 3300047443 Bacteria 4333
270 Ga0495677_0042261 3300047445 Bacteria 1669
271 Ga0495685_012552 3300047447 Bacteria 2869
272 Ga0495685_062675 3300047447 Bacteria 1252
273 Ga0495681_0030306 3300047470 Bacteria 2756
274 Ga0495686_0023283 3300047472 Bacteria 4087
275 Ga0495626_0001738 3300048091 Bacteria 16614
276 Ga0495626_0013020 3300048091 Bacteria 4337
277 Ga0495626_0037454 3300048091 Bacteria 2305
278 Ga0495626_0139006 3300048091 Bacteria 1031
279 Ga0496102_0000711 3300048905 Bacteria 32978
280 Ga0496102_0045528 3300048905 Bacteria 3984
281 Ga0496102_0067963 3300048905 Bacteria 3269
282 Ga0496102_0069707 3300048905 Bacteria 3227
283 Ga0496103_0011421 3300048906 Bacteria 5263
284 Ga0496103_0040985 3300048906 Bacteria 2846
285 Ga0496106_0293497 3300048909 Bacteria 1303
286 Ga0496107_0014432 3300048910 Bacteria 5532
287 Ga0496107_0214345 3300048910 Bacteria 1432
288 Ga0496110_1305300 3300048913 Bacteria 635
289 Ga0496110_1388169 3300048913 Bacteria 612
290 Ga0496117_0085491 3300048920 Bacteria 2053
291 Ga0496118_0016229 3300048921 Bacteria 6841
292 Ga0496121_0002132 3300048924 Bacteria 31087
293 Ga0496123_0011773 3300048926 Bacteria 7535
294 Ga0496124_0011992 3300048927 Bacteria 8616
295 Ga0496124_0111148 3300048927 Bacteria 2205
296 Ga0496125_0002204 3300048928 Bacteria 25990
297 Ga0496125_0004737 3300048928 Bacteria 15506
298 Ga0496125_0007301 3300048928 Bacteria 11768
299 Ga0496125_0039631 3300048928 Bacteria 4053
300 Ga0496126_0001170 3300048929 Bacteria 43233
301 Ga0496126_0036500 3300048929 Bacteria 4595
302 Ga0496126_0039790 3300048929 Bacteria 4360
303 Ga0496126_0040514 3300048929 Bacteria 4318
304 Ga0496126_0060485 3300048929 Bacteria 3406
305 Ga0495678_015900 3300049459 Bacteria 3453
306 Ga0495678_076790 3300049459 Bacteria 1209
307 Ga0495678_122422 3300049459 Bacteria 872
308 Ga0501292_077392 3300049515 Bacteria 628
309 Ga0501321_065189 3300049537 Bacteria 557
310 Ga0501068_0516132 3300049584 Bacteria 776
311 Ga0501073_0262856 3300049589 Bacteria 1191
312 Ga0501240_013544 3300049673 Bacteria 1133
313 nmdc:mga0n895_18603_c1 3300050512 Bacteria 6433
314 nmdc:mga0rr50_224135_c1 3300050513 Bacteria 1553
315 nmdc:mga0a205_613007_c1 3300050515 Bacteria 941
316 Ga0495612_0144870 3300053078 Bacteria 1032
317 Ga0500641_0062633 3300053096 Bacteria 1552
318 Ga0500624_050634 3300053157 Bacteria 772
319 Ga0500634_0082627 3300053161 Bacteria 1651
320 Ga0587093_033674 3300059478 Bacteria 749
321 Ga0587066_029575 3300059490 Bacteria 967
322 Ga0587082_017741 3300059504 Bacteria 1125
323 Ga0587085_074868 3300059506 Bacteria 670
324 Ga0587086_021393 3300059507 Bacteria 886
325 Ga0587091_003026 3300059511 Bacteria 2070
326 Ga0587092_065484 3300059512 Bacteria 689
327 Ga0587092_077017 3300059512 Bacteria 652
328 Ga0587101_021381 3300059623 Bacteria 935
329 Ga0587075_022341 3300059644 Bacteria 949
330 Ga0587076_005040 3300059645 Bacteria 1688
331 Ga0587111_0006465 3300060346 Bacteria 1860
332 2501071051 2501025501 Bacteria 7768574
333 2501078757 2501025502 Bacteria 9641094
334 2501413923 2501025504 Bacteria 8008976
335 2509130193 2508501125 Bacteria 7208311
336 2511089402 2510917013 Bacteria 9951648
337 2511094813 2510917014 Bacteria 8296963
338 2511104512 2510917015 Bacteria 7950052
339 2513551644 2513237082 Bacteria 8640282
340 2513563809 2513237083 Bacteria 8410967
341 2513963080 2513237151 Bacteria 6309801
342 2514047537 2513237166 Bacteria 10373764
343 2515682700 2515154122 Bacteria 8609520
344 2516017033 2515154189 Bacteria 9629850
345 2519459599 2519103095 Bacteria 6629912
346 2527077774 2526164713 Bacteria 6780608
347 2553005294 2551306416 Bacteria 6152985
348 2563059553 2562617112 Bacteria 10918404
349 2585291185 2582581311 Bacteria 6763856
350 2599740793 2599185239 Bacteria 8686614
351 2599747142 2599185240 Bacteria 7968121
352 2600209650 2599185355 Bacteria 7968906
353 2600814587 2600255067 Bacteria 6795583
354 2643993542 2643221596 Bacteria 5006805
355 2644252538 2643221645 Bacteria 7207331
356 2644294676 2643221652 Bacteria 5140275
357 2644358266 2643221664 Bacteria 7272945
358 2676744900 2675903129 Bacteria 7964495
359 2713479502 2711768613 Bacteria 11048459
360 2722882732 2721755523 Bacteria 6430384
361 2738742405 2738541280 Bacteria 6630198
362 2738845354 2738541300 Bacteria 6675882
363 2739243468 2738543012 Bacteria 7115078
364 2739276407 2738543018 Bacteria 6718814
365 2739345451 2738543030 Bacteria 6719714
366 2753568444 2751185846 Bacteria 7242164
367 2765568478 2765235838 Bacteria 5445269
368 2792840263 2791355137 Bacteria 9654227
369 2808981219 2808606386 Bacteria 4471946
370 2809131727 2808606415 Bacteria 4576710
371 2809151461 2808606419 Bacteria 4576925
372 2816475740 2816332133 Bacteria 7249298
373 2817261878 2816332253 Bacteria 6764532
374 2817279582 2816332256 Bacteria 6891714
375 2817454334 2816332286 Bacteria 6853759
376 2819633208 2818991452 Bacteria 8442785
377 2834645538 2834641062 Bacteria 5559922
378 2839096657 2839094727 Bacteria 5534556
379 2839138315 2839138175 Bacteria 6549354
380 2852620945 2852618963 Bacteria 4577824
381 2856292247 2856287931 Bacteria 7223934
382 2857365761 2857357740 Bacteria 9937880
383 2858690237 2858688981 Bacteria 8184122
384 2863425881 2863421361 Bacteria 7300805
385 2870070374 2870068957 Bacteria 8925310
386 2883094789 2883087390 Bacteria 9532701
387 2885273960 2885270888 Bacteria 9831543
388 2901303595 2901300506 Bacteria 8463898
389 2902687259 2902682994 Bacteria 8951596
390 2904483117 2904479285 Bacteria 5073931
391 2904487684 2904483920 Bacteria 7545285
392 2904569249 2904564687 Bacteria 7609577
393 2904576443 2904571731 Bacteria 7608790
394 2904620614 2904615490 Bacteria 10047340
395 2919050231 2919046199 Bacteria 5567169
396 2919528988 2919527303 Bacteria 7718827
397 2921653189 2921643360 Bacteria 11448031
398 2923516020 2923510766 Bacteria 5926163
399 2928119432 2928115317 Bacteria 6477646
400 2928133226 2928130867 Bacteria 5467269
401 2928178535 2928170801 Bacteria 8785406
402 2928541621 2928536128 Bacteria 7657547
403 2932426209 2932422444 Bacteria 4678430
404 642592291 642555112 Bacteria 8676562
405 8003400750 8003400568 Bacteria 5535898
406 8003960501 8003955200 Bacteria 8601927
407 8018853429 8018845410 Bacteria 8933938
408 8020808257 8020807995 Bacteria 6801506
409 8020945338 8020938398 Bacteria 7472757
410 8020950518 8020945358 Bacteria 8467355
411 8020959259 8020953355 Bacteria 7439080
412 8021127245 8021120328 Bacteria 8782274
413 8039100873 8039098773 Bacteria 6602928
414 8040169013 8040167225 Bacteria 6542727
415 8040179294 8040173305 Bacteria 6827067
416 8055267263 8055266321 Bacteria 7999742
417 8055301449 8055301274 Bacteria 8587385
418 Ga0495605_0020908
419 Ga0007416J51690_1068484
420 Ga0055539_1000018
421 Ga0055533_1000022
422 Ga0055533_1013801
423 Ga0055525_1000024
424 Ga0055542_1000912
425 Ga0055529_1000736
426 Ga0055526_1008392
427 Ga0055537_1020697
428 Ga0055524_1003056
429 Ga0055536_1021026
430 Ga0055534_1000791
431 Ga0055534_1001318
432 Ga0055528_1011129
433 Ga0055540_1019027
434 Ga0055541_1000013
435 Ga0058692_1001169
436 Ga0070683_100692916
437 Ga0070670_100019097
438 Ga0070666_10083892
439 Ga0070687_100138030
440 Ga0070675_100060595
441 Ga0070673_100232812
442 Ga0070659_100651796
443 Ga0070667_100029610
444 Ga0070667_100128635
445 Ga0070667_100365176
446 Ga0070663_100068153
447 Ga0070678_100183447
448 Ga0070662_101272412
449 Ga0070706_101545929
450 Ga0070707_100423141
451 Ga0070707_100948890
452 Ga0070697_100001459
453 Ga0068853_100840930
454 Ga0070672_100117176
455 Ga0070665_100001298
456 Ga0070665_100268336
457 Ga0068855_100003098
458 Ga0068856_100167018
459 Ga0070702_100022888
460 Ga0068852_100880917
461 Ga0068859_100087555
462 Ga0068864_100038547
463 Ga0068861_100139213
464 Ga0068851_10097907
465 Ga0068863_100053357
466 Ga0068858_100011298
467 Ga0068862_100479537
468 Ga0075433_11032783
469 Ga0075434_100028870
470 Ga0097620_100087554
471 Ga0079104_1000025
472 Ga0105251_10088349
473 Ga0105244_10174512
474 Ga0105245_10055452
475 Ga0105242_10010605
476 Ga0105248_10029285
477 Ga0105238_10451968
478 Ga0105249_11331277
479 Ga0105249_12807613
480 Ga0105239_12244232
481 Ga0157373_10290845
482 Ga0157373_10854759
483 Ga0157371_10000013
484 Ga0157371_10216036
485 Ga0157369_10355192
486 Ga0157369_11087400
487 Ga0163162_10015514
488 Ga0163162_10915929
489 Ga0157372_10199703
490 Ga0157375_10124536
491 Ga0157375_10137309
492 Ga0182008_10028331
493 Ga0157379_10210090
494 Ga0182006_1015321
495 Ga0182007_10014458
496 Ga0182007_10023971
497 Ga0213876_10057183
498 Ga0209784_100005
499 Ga0209566_100005
500 Ga0209566_100810
501 Ga0209674_100009
502 Ga0209674_104787
503 Ga0209672_100034
504 Ga0209147_100137
505 Ga0209563_100012
506 Ga0209258_100023
507 Ga0209677_100006
508 Ga0209148_1000029
509 Ga0209565_1000093
510 Ga0209455_1000167
511 Ga0209673_1000443
512 Ga0209673_1017624
513 Ga0209673_1019032
514 Ga0209130_1002151
515 Ga0209130_1028145
516 Ga0209675_1000714
517 Ga0209675_1008891
518 Ga0209676_1002715
519 Ga0209025_1000625
520 Ga0209025_1018345
521 Ga0209564_1001276
522 Ga0209564_1011949
523 Ga0209758_1014768
524 Ga0209758_1044351
525 Ga0209050_1023300
526 Ga0209256_1000044
527 Ga0209256_1004854
528 Ga0209051_1003871
529 Ga0209257_1059785
530 Ga0207656_10274130
531 Ga0207696_1066454
532 Ga0207713_1151678
533 Ga0207688_10035229
534 Ga0207680_10403537
535 Ga0207647_10519068
536 Ga0207705_10144456
537 Ga0207705_10327160
538 Ga0207684_11459333
539 Ga0207662_10303176
540 Ga0207657_11171726
541 Ga0207652_10404129
542 Ga0207652_11280565
543 Ga0207646_10058970
544 Ga0207681_10176475
545 Ga0207694_10917152
546 Ga0207650_10011620
547 Ga0207687_10105592
548 Ga0207690_10537622
549 Ga0207706_10467031
550 Ga0207709_10000459
551 Ga0207670_11420249
552 Ga0207691_10045831
553 Ga0207711_10101342
554 Ga0207689_10345624
555 Ga0207667_10000078
556 Ga0207651_10557186
557 Ga0207712_10490559
558 Ga0207668_10278696
559 Ga0207668_10727207
560 Ga0207658_10197884
561 Ga0207658_10304963
562 Ga0207703_10039449
563 Ga0207678_10075065
564 Ga0207702_10461285
565 Ga0207641_10094529
566 Ga0207641_10178916
567 Ga0207641_11138602
568 Ga0207676_10077758
569 Ga0207675_100137906
570 Ga0207683_10210367
571 Ga0209281_1000007
572 Ga0209371_1000531
573 Ga0268266_10000623
574 Ga0268266_10161271
575 Ga0265338_10005002
576 Ga0265338_10116396
577 Ga0268256_1000454
578 Ga0316177_1066173
579 Ga0316183_1165787
580 Ga0316182_1324657
581 Ga0265328_10026822
582 Ga0265327_10000210
583 Ga0307513_10000004
584 Ga0307513_10510833
585 Ga0307405_10098179
586 Ga0307416_100041360
587 Ga0307414_10745333
588 Ga0307415_100290792
589 Ga0373937_0012321
590 Ga0316584_0570137
591 Ga0395899_0000128
592 Ga0395905_0001002
593 Ga0395905_0162691
594 Ga0395901_0216599
595 Ga0436365_0250047
596 Ga0436361_0023797
597 Ga0436361_0385943
598 Ga0436362_0550928
599 Ga0451791_0811718
600 Ga0451795_0501340
601 Ga0450904_000049
602 Ga0439446_0071589
603 Ga0439458_0132985
604 Ga0451577_0170156
605 Ga0466972_0000111
606 Ga0453683_0318600
607 Ga0453683_0896582
608 Ga0466964_0082809
609 Ga0453684_0133652
610 Ga0453684_0247482
611 Ga0495617_000308
612 Ga0495590_0394511
613 Ga0495584_0000007
614 Ga0495584_0004754
615 Ga0495584_0045745
616 Ga0495584_0055156
617 Ga0495584_0071147
618 Ga0495584_0130095
619 Ga0495584_0462900
620 Ga0495585_0000421
621 Ga0495585_0000737
622 Ga0495585_0001804
623 Ga0495585_0090678
624 Ga0495596_0000474
625 Ga0495596_0005306
626 Ga0495583_0000337
627 Ga0495583_0000569
628 Ga0495583_0023788
629 Ga0495583_0028822
630 Ga0495606_0007593
631 Ga0495606_0014495
632 Ga0495606_0244187
633 Ga0495616_0000380
634 Ga0495620_0002173
635 Ga0495631_0088572
636 Ga0495637_0064669
637 Ga0495643_0000200
638 Ga0495643_0011335
639 Ga0495643_0025795
640 Ga0495644_0008885
641 Ga0495648_0000112
642 Ga0495648_0003765
643 Ga0495648_0061619
644 Ga0495642_0009816
645 Ga0495642_0057102
646 Ga0495642_0059026
647 Ga0495642_0062719
648 Ga0495642_0132639
649 Ga0495642_0467076
650 Ga0495609_0001355
651 Ga0495609_0077106
652 Ga0495597_0052600
653 Ga0495597_0103491
654 Ga0495597_0135684
655 Ga0495622_0000525
656 Ga0495633_0015752
657 Ga0495656_0031907
658 Ga0495668_0039423
659 Ga0495668_0257950
660 Ga0495611_0010326
661 Ga0495625_0039101
662 Ga0495625_0049831
663 Ga0495659_0000961
664 Ga0495659_0018422
665 Ga0495661_0004612
666 Ga0495661_0021657
667 Ga0495588_0102358
668 Ga0495588_0109607
669 Ga0495588_0135547
670 Ga0495669_0154725
671 Ga0495669_0155331
672 Ga0495670_0001222
673 Ga0495670_0015711
674 Ga0495671_0000864
675 Ga0495649_0114837
676 Ga0495589_0004740
677 Ga0495589_0101314
678 Ga0495660_0004574
679 Ga0495660_0225036
680 Ga0495636_0011073
681 Ga0495672_0000343
682 Ga0495672_0017115
683 Ga0495676_0126231
684 Ga0495676_0184831
685 Ga0495683_0000083
686 Ga0495687_013147
687 Ga0495677_0042261
688 Ga0495685_012552
689 Ga0495685_062675
690 Ga0495681_0030306
691 Ga0495686_0023283
692 Ga0495626_0001738
693 Ga0495626_0013020
694 Ga0495626_0037454
695 Ga0495626_0139006
696 Ga0496102_0000711
697 Ga0496102_0045528
698 Ga0496102_0067963
699 Ga0496102_0069707
700 Ga0496103_0011421
701 Ga0496103_0040985
702 Ga0496106_0293497
703 Ga0496107_0014432
704 Ga0496107_0214345
705 Ga0496110_1305300
706 Ga0496110_1388169
707 Ga0496117_0085491
708 Ga0496118_0016229
709 Ga0496121_0002132
710 Ga0496123_0011773
711 Ga0496124_0011992
712 Ga0496124_0111148
713 Ga0496125_0002204
714 Ga0496125_0004737
715 Ga0496125_0007301
716 Ga0496125_0039631
717 Ga0496126_0001170
718 Ga0496126_0036500
719 Ga0496126_0039790
720 Ga0496126_0040514
721 Ga0496126_0060485
722 Ga0495678_015900
723 Ga0495678_076790
724 Ga0495678_122422
725 Ga0501292_077392
726 Ga0501321_065189
727 Ga0501068_0516132
728 Ga0501073_0262856
729 Ga0501240_013544
730 nmdc:mga0n895_18603_c1
731 nmdc:mga0rr50_224135_c1
732 nmdc:mga0a205_613007_c1
733 Ga0495612_0144870
734 Ga0500641_0062633
735 Ga0500624_050634
736 Ga0500634_0082627
737 Ga0587093_033674
738 Ga0587066_029575
739 Ga0587082_017741
740 Ga0587085_074868
741 Ga0587086_021393
742 Ga0587091_003026
743 Ga0587092_065484
744 Ga0587092_077017
745 Ga0587101_021381
746 Ga0587075_022341
747 Ga0587076_005040
748 Ga0587111_0006465
749 2501071051
750 2501078757
751 2501413923
752 2509130193
753 2511089402
754 2511094813
755 2511104512
756 2513551644
757 2513563809
758 2513963080
759 2514047537
760 2515682700
761 2516017033
762 2519459599
763 2527077774
764 2553005294
765 2563059553
766 2585291185
767 2599740793
768 2599747142
769 2600209650
770 2600814587
771 2643993542
772 2644252538
773 2644294676
774 2644358266
775 2676744900
776 2713479502
777 2722882732
778 2738742405
779 2738845354
780 2739243468
781 2739276407
782 2739345451
783 2753568444
784 2765568478
785 2792840263
786 2808981219
787 2809131727
788 2809151461
789 2816475740
790 2817261878
791 2817279582
792 2817454334
793 2819633208
794 2834645538
795 2839096657
796 2839138315
797 2852620945
798 2856292247
799 2857365761
800 2858690237
801 2863425881
802 2870070374
803 2883094789
804 2885273960
805 2901303595
806 2902687259
807 2904483117
808 2904487684
809 2904569249
810 2904576443
811 2904620614
812 2919050231
813 2919528988
814 2921653189
815 2923516020
816 2928119432
817 2928133226
818 2928178535
819 2928541621
820 2932426209
821 642592291
822 8003400750
823 8003960501
824 8018853429
825 8020808257
826 8020945338
827 8020950518
828 8020959259
829 8021127245
830 8039100873
831 8040169013
832 8040179294
833 8055267263
834 8055301449

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04461

DUF520

Protein of unknown function (DUF520)

31

189

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.9195 1 161
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.7966 3 161
6wrx-assembly1.cif.gz_D crystal structure of computationally designed protein 2ds25.1 in complex with the human transferrin receptor ectodomain 0.7883 99 147
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.7839 3 161
4pwu-assembly2.cif.gz_C crystal structure of a modulator protein mzra (kpn_03524) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.45 a resolution 0.6997 99 161
ID Description Score Start End Superfamily
1in0B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9658 99 161 3.30.70.860
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9314 9 97 3.30.70.990
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9297 9 96 3.30.70.990
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9226 11 93 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9118 9 97 3.30.70.990
ID Description Score Start End GO Terms
AF-A0A0F2IX68-F1-model_v4 deleted 0.9957 101 161
AF-A0A259DGR8-F1-model_v4 YajQ family cyclic di-GMP-binding protein 0.9952 99 161 GO:0000166
GO:0005829
AF-A0A520FJA4-F1-model_v4 DUF520 family protein 0.9906 99 161 GO:0000166
GO:0005829
AF-A0A378NFZ2-F1-model_v4 Putative nucleotide-binding protein 0.9808 105 161 GO:0000166
GO:0005829
AF-A0A3C1L9T2-F1-model_v4 YajQ family cyclic di-GMP-binding protein 0.9806 11 74 GO:0000166
GO:0005829

Map