F439132

General Info

Members Datasets Scaffolds Average Seq Length
417 291 834 268

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0156128|Ga0495651_0156128_512_1438
Length 308
Sequence MSVPRLPGCPRFPNQMSRTRLAWRGDGGWHSDTGNFMPSEHDSMRALSDAQIRQFIQGGFVRIDRAFPRRLADEGRTILWRDTGCDPGDPATWTKPVIRLGYYDQEPFKKAANTALLHAAFDQLVGRGRWRPRPNLGSFPVRFPNPRDPGDAGWHVDVSFPGDSGDPNEQQDFSAWRVNVTSRGRALLMLFLFSDVGELDAPTRIRVGSHLDMARYLAPAGEDGRSHLVLDRMGADRPEALATGEAGTVYLCHPFLVHAAQIHRGATPRFMAQPPLHPAEPFQLDRADGEYSPVEIAIRQALLEGRAQ

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
126 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
127 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
128 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
129 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
147 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
148 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
154 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
155 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
156 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
157 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
158 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
159 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
240 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
241 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
242 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
243 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
244 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
247 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
250 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
251 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
252 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
253 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
254 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
255 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
256 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
259 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
260 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
261 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
262 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
263 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
264 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
265 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
266 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
267 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
268 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
269 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
270 2791355199
271 2791355261 Rhizobium sp. J15 Isolate Nodule
272 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
273 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
274 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
275 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
276 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
277 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
278 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
279 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
280 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
281 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
282 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
283 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
284 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
285 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
286 8005382845 Rhizobium sp. R634 Isolate Nodule
287 8005395548 Rhizobium sp. R339 Isolate Nodule
288 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
289 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
290 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
291 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.31
Metatranscriptomes 0
Isolates 7.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.51
Nodule 6.47
Rhizoplane 4.32
Rhizosphere 64.03
Stem 0
Stem Tuber 0
Unclassified 3.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0156128 3300046462 Bacteria 1640
2 JGI24739J22299_10000327 3300001989 Bacteria 16282
3 JGI25151J46595_10000179 3300003187 Bacteria 80108
4 JGI25151J46595_10000468 3300003187 Bacteria 38636
5 JGI25153J46596_10000549 3300003215 Bacteria 23413
6 JGI25153J46596_10010264 3300003215 Bacteria 4253
7 rootL2_10022367 3300003322 Bacteria 2372
8 rootL2_10067914 3300003322 Bacteria 3818
9 JGI25404J52841_10015329 3300003659 Bacteria 1663
10 Ga0055539_1012092 3300003752 Bacteria 1061
11 Ga0065714_10076769 3300005288 Bacteria 2756
12 Ga0065712_10001904 3300005290 Bacteria 5128
13 Ga0065715_10000271 3300005293 Bacteria 31385
14 Ga0070670_100004988 3300005331 Bacteria 11168
15 Ga0068868_100218143 3300005338 Bacteria 1596
16 Ga0070689_100378191 3300005340 Bacteria 1193
17 Ga0070691_10274306 3300005341 Bacteria 913
18 Ga0070668_100018984 3300005347 Bacteria 5167
19 Ga0070668_100364621 3300005347 Bacteria 1226
20 Ga0070668_100370690 3300005347 Bacteria 1216
21 Ga0070675_100020462 3300005354 Bacteria 5279
22 Ga0070673_100073748 3300005364 Bacteria 2748
23 Ga0070688_100206397 3300005365 Bacteria 1377
24 Ga0070667_100070719 3300005367 Bacteria 2970
25 Ga0070667_100135108 3300005367 Bacteria 2156
26 Ga0070700_100063407 3300005441 Bacteria 2338
27 Ga0070708_100507881 3300005445 Bacteria 1137
28 Ga0070708_100593044 3300005445 Bacteria 1045
29 Ga0070678_100016703 3300005456 Bacteria 4703
30 Ga0070678_100516636 3300005456 Bacteria 1056
31 Ga0070662_100291960 3300005457 Bacteria 1322
32 Ga0068867_100166506 3300005459 Bacteria 1742
33 Ga0068867_100177132 3300005459 Bacteria 1693
34 Ga0070685_10006856 3300005466 Bacteria 5816
35 Ga0070685_10145866 3300005466 Bacteria 1495
36 Ga0070706_100051930 3300005467 Bacteria 3785
37 Ga0070706_100356781 3300005467 Bacteria 1363
38 Ga0070707_100220610 3300005468 Bacteria 1847
39 Ga0070707_100480758 3300005468 Bacteria 1203
40 Ga0070698_100098048 3300005471 Bacteria 2906
41 Ga0070698_100319050 3300005471 Bacteria 1484
42 Ga0070697_100000192 3300005536 Bacteria 49825
43 Ga0070697_100325115 3300005536 Bacteria 1325
44 Ga0068853_100081814 3300005539 Bacteria 2828
45 Ga0070672_100006836 3300005543 Bacteria 7702
46 Ga0070693_100218392 3300005547 Bacteria 1248
47 Ga0070665_100018935 3300005548 Bacteria 6907
48 Ga0070665_100294556 3300005548 Bacteria 1625
49 Ga0070665_100341577 3300005548 Bacteria 1502
50 Ga0070665_100678731 3300005548 Bacteria 1043
51 Ga0068855_100197923 3300005563 Bacteria 2263
52 Ga0070664_100189886 3300005564 Bacteria 1830
53 Ga0070664_100192978 3300005564 Bacteria 1815
54 Ga0070664_100667313 3300005564 Bacteria 967
55 Ga0068857_100009025 3300005577 Bacteria 8646
56 Ga0068857_100378465 3300005577 Bacteria 1314
57 Ga0068856_100135589 3300005614 Bacteria 2467
58 Ga0068856_100265329 3300005614 Bacteria 1733
59 Ga0068852_100315516 3300005616 Bacteria 1517
60 Ga0068859_100200506 3300005617 Bacteria 2080
61 Ga0068859_100358317 3300005617 Bacteria 1554
62 Ga0068864_100087346 3300005618 Bacteria 2745
63 Ga0068864_100672154 3300005618 Bacteria 1010
64 Ga0068866_10206259 3300005718 Bacteria 1177
65 Ga0068861_100381753 3300005719 Bacteria 1245
66 Ga0068863_100009463 3300005841 Bacteria 9506
67 Ga0068863_100047168 3300005841 Bacteria 4088
68 Ga0068860_100321852 3300005843 Bacteria 1518
69 Ga0068862_100113862 3300005844 Bacteria 2377
70 Ga0068862_100148616 3300005844 Bacteria 2084
71 Ga0081540_1002786 3300005983 Bacteria 14181
72 Ga0081540_1011867 3300005983 Bacteria 5787
73 Ga0081540_1013615 3300005983 Bacteria 5276
74 Ga0081540_1018968 3300005983 Bacteria 4200
75 Ga0081540_1040970 3300005983 Bacteria 2407
76 Ga0081539_10013983 3300005985 Bacteria 5986
77 Ga0075365_10160518 3300006038 Bacteria 1566
78 Ga0075368_10065791 3300006042 Bacteria 1456
79 Ga0075364_10033328 3300006051 Bacteria 3316
80 Ga0075367_10056318 3300006178 Unclassified 2335
81 Ga0075367_10226030 3300006178 Bacteria 1172
82 Ga0075369_10018295 3300006186 Bacteria 2851
83 Ga0075366_10040607 3300006195 Bacteria 2752
84 Ga0097621_100034017 3300006237 Bacteria 4063
85 Ga0075370_10164327 3300006353 Bacteria 1303
86 Ga0068871_100060490 3300006358 Bacteria 3091
87 Ga0068871_100415331 3300006358 Bacteria 1201
88 Ga0075428_100002867 3300006844 Bacteria 18802
89 Ga0075428_100112021 3300006844 Unclassified 2972
90 Ga0075430_100024618 3300006846 Bacteria 5121
91 Ga0075430_100026484 3300006846 Bacteria 4933
92 Ga0075430_100138191 3300006846 Unclassified 2029
93 Ga0075431_100294794 3300006847 Bacteria 1640
94 Ga0075433_10001040 3300006852 Bacteria 19830
95 Ga0075434_100000736 3300006871 Bacteria 25713
96 Ga0075434_100056684 3300006871 Bacteria 3894
97 Ga0075429_100027083 3300006880 Bacteria 4976
98 Ga0075429_100157244 3300006880 Unclassified 1990
99 Ga0068865_100097947 3300006881 Bacteria 2142
100 Ga0097620_100200487 3300006931 Bacteria 2080
101 Ga0097620_100358305 3300006931 Bacteria 1554
102 Ga0099823_1067035 3300006944 Bacteria 1691
103 Ga0075435_100015047 3300007076 Bacteria 5807
104 Ga0099794_10016483 3300007265 Bacteria 3276
105 Ga0099794_10094429 3300007265 Bacteria 1487
106 Ga0099795_10002735 3300007788 Bacteria 4226
107 Ga0105240_10206148 3300009093 Bacteria 2301
108 Ga0105240_10667388 3300009093 Bacteria 1138
109 Ga0111539_10000249 3300009094 Bacteria 64681
110 Ga0111539_10066279 3300009094 Bacteria 4265
111 Ga0111539_10302811 3300009094 Bacteria 1860
112 Ga0111539_10303968 3300009094 Bacteria 1856
113 Ga0114129_10004104 3300009147 Bacteria 20581
114 Ga0114129_10272931 3300009147 Unclassified 2262
115 Ga0105241_10363898 3300009174 Bacteria 1259
116 Ga0105241_10424385 3300009174 Bacteria 1171
117 Ga0105242_10025484 3300009176 Bacteria 4681
118 Ga0105242_10081275 3300009176 Bacteria 2710
119 Ga0105248_10033290 3300009177 Bacteria 5757
120 Ga0105248_10149894 3300009177 Bacteria 2631
121 Ga0105237_10111232 3300009545 Bacteria 2731
122 Ga0105237_10133933 3300009545 Bacteria 2473
123 Ga0105237_10719348 3300009545 Bacteria 1005
124 Ga0105238_10120947 3300009551 Bacteria 2598
125 Ga0105238_10607779 3300009551 Bacteria 1102
126 Ga0105249_10004466 3300009553 Bacteria 12093
127 Ga0105249_10018162 3300009553 Bacteria 6252
128 Ga0105249_10412521 3300009553 Bacteria 1383
129 Ga0105239_10167977 3300010375 Bacteria 2453
130 Ga0105239_10251830 3300010375 Bacteria 1984
131 Ga0105239_10325641 3300010375 Bacteria 1733
132 Ga0105239_10355539 3300010375 Bacteria 1654
133 Ga0105239_11139417 3300010375 Bacteria 898
134 Ga0105246_10066505 3300011119 Bacteria 2523
135 Ga0105246_10449337 3300011119 Bacteria 1083
136 Ga0157370_10379421 3300013104 Bacteria 1302
137 Ga0157369_10051781 3300013105 Bacteria 4443
138 Ga0157369_10218897 3300013105 Bacteria 1993
139 Ga0157374_10016506 3300013296 Bacteria 6493
140 Ga0157374_10124985 3300013296 Bacteria 2486
141 Ga0163162_10077740 3300013306 Bacteria 3383
142 Ga0157372_10454816 3300013307 Bacteria 1492
143 Ga0157375_10000221 3300013308 Bacteria 53553
144 Ga0157375_10037781 3300013308 Bacteria 4629
145 Ga0157375_10065813 3300013308 Bacteria 3614
146 Ga0163163_10495308 3300014325 Bacteria 1284
147 Ga0163163_10568883 3300014325 Bacteria 1196
148 Ga0157376_10011199 3300014969 Bacteria 6600
149 Ga0157376_10430153 3300014969 Bacteria 1283
150 Ga0163161_10014900 3300017792 Bacteria 5416
151 Ga0213876_10004322 3300021384 Bacteria 7962
152 Ga0213875_10000054 3300021388 Bacteria 141035
153 Ga0209677_101679 3300025253 Bacteria 9253
154 Ga0209025_1000251 3300025294 Bacteria 126418
155 Ga0209758_1014007 3300025297 Bacteria 4311
156 Ga0209758_1048746 3300025297 Bacteria 1502
157 Ga0207697_10047356 3300025315 Bacteria 1773
158 Ga0207688_10012373 3300025901 Bacteria 4642
159 Ga0207680_10223827 3300025903 Bacteria 1291
160 Ga0207671_10119656 3300025914 Bacteria 2012
161 Ga0207671_10206572 3300025914 Bacteria 1535
162 Ga0207671_10281536 3300025914 Bacteria 1311
163 Ga0207681_10047733 3300025923 Bacteria 2887
164 Ga0207694_10551745 3300025924 Bacteria 967
165 Ga0207650_10003609 3300025925 Bacteria 10612
166 Ga0207659_10038647 3300025926 Bacteria 3321
167 Ga0207706_10043626 3300025933 Bacteria 3974
168 Ga0207686_10502355 3300025934 Bacteria 941
169 Ga0207709_10127194 3300025935 Bacteria 1730
170 Ga0207670_10250026 3300025936 Bacteria 1370
171 Ga0207669_10082795 3300025937 Bacteria 2061
172 Ga0207704_10035960 3300025938 Bacteria 2844
173 Ga0207691_10019080 3300025940 Bacteria 6494
174 Ga0207691_10387328 3300025940 Bacteria 1193
175 Ga0207711_10034952 3300025941 Bacteria 4257
176 Ga0207711_10086786 3300025941 Bacteria 2745
177 Ga0207711_10396207 3300025941 Bacteria 1282
178 Ga0207689_10189589 3300025942 Bacteria 1696
179 Ga0207679_10103880 3300025945 Bacteria 2228
180 Ga0207651_10125523 3300025960 Bacteria 1955
181 Ga0207668_10012338 3300025972 Bacteria 5228
182 Ga0207668_10344966 3300025972 Bacteria 1243
183 Ga0207668_10358566 3300025972 Bacteria 1221
184 Ga0207658_10180928 3300025986 Bacteria 1745
185 Ga0207658_10316304 3300025986 Bacteria 1350
186 Ga0207677_10086658 3300026023 Bacteria 2264
187 Ga0207677_10321515 3300026023 Bacteria 1286
188 Ga0207703_10390023 3300026035 Bacteria 1290
189 Ga0207703_10405828 3300026035 Bacteria 1265
190 Ga0207708_10099440 3300026075 Bacteria 2250
191 Ga0207702_10207043 3300026078 Bacteria 1822
192 Ga0207702_10219247 3300026078 Bacteria 1772
193 Ga0207641_10036752 3300026088 Bacteria 4088
194 Ga0207648_10112798 3300026089 Bacteria 2387
195 Ga0207648_10160286 3300026089 Bacteria 1987
196 Ga0207648_10203915 3300026089 Bacteria 1755
197 Ga0207676_10777304 3300026095 Bacteria 933
198 Ga0207674_10002688 3300026116 Bacteria 22181
199 Ga0207675_100197275 3300026118 Bacteria 1932
200 Ga0207683_10062033 3300026121 Bacteria 3292
201 Ga0209389_1071282 3300027296 Bacteria 1896
202 Ga0209589_1000018 3300027357 Bacteria 192614
203 Ga0209489_100026 3300027361 Bacteria 192614
204 Ga0209489_120466 3300027361 Bacteria 1896
205 Ga0209700_100030 3300027363 Bacteria 212982
206 Ga0209700_100035 3300027363 Bacteria 192614
207 Ga0209179_1013713 3300027512 Bacteria 1476
208 Ga0209588_1010134 3300027671 Bacteria 2828
209 Ga0207428_10001487 3300027907 Bacteria 24514
210 Ga0207428_10008196 3300027907 Bacteria 9451
211 Ga0268265_10117189 3300028380 Bacteria 2187
212 Ga0268265_10187766 3300028380 Unclassified 1782
213 Ga0268264_10080109 3300028381 Bacteria 2788
214 Ga0307515_10012760 3300028794 Bacteria 15775
215 Ga0307511_10091054 3300030521 Bacteria 2067
216 Ga0307513_10107957 3300031456 Bacteria 2786
217 Ga0307513_10423265 3300031456 Bacteria 1061
218 Ga0307408_100003483 3300031548 Bacteria 10741
219 Ga0307408_100031352 3300031548 Bacteria 3701
220 Ga0307508_10082464 3300031616 Bacteria 2797
221 Ga0307516_10004439 3300031730 Bacteria 17302
222 Ga0307516_10057504 3300031730 Bacteria 3788
223 Ga0307516_10094985 3300031730 Bacteria 2805
224 Ga0307516_10131995 3300031730 Bacteria 2276
225 Ga0307516_10190221 3300031730 Bacteria 1779
226 Ga0307413_10653746 3300031824 Bacteria 867
227 Ga0307410_10055223 3300031852 Bacteria 2696
228 Ga0307410_10203096 3300031852 Bacteria 1514
229 Ga0307406_10028689 3300031901 Bacteria 3364
230 Ga0307409_100212626 3300031995 Bacteria 1739
231 Ga0307414_10028502 3300032004 Bacteria 3624
232 Ga0307411_10060654 3300032005 Bacteria 2513
233 Ga0307411_10079623 3300032005 Bacteria 2250
234 Ga0307507_10024819 3300033179 Bacteria 6519
235 Ga0315911_1000011 3300033442 Bacteria 264678
236 Ga0316215_1004029 3300033544 Bacteria 1406
237 Ga0373937_0139824 3300036401 Unclassified 2265
238 Ga0395900_0077127 3300037418 Bacteria 3424
239 Ga0436364_0410246 3300037853 Bacteria 147258
240 Ga0436365_0273120 3300039437 Bacteria 6795
241 Ga0436365_1898441 3300039437 Bacteria 2363
242 Ga0451833_0777264 3300041491 Unclassified 2269
243 Ga0451839_0960151 3300041496 Unclassified 2162
244 Ga0451841_0821064 3300041498 Bacteria 1983
245 Ga0439443_023890 3300042003 Bacteria 978
246 Ga0439450_000835 3300042008 Bacteria 4238
247 Ga0439458_0018467 3300042157 Bacteria 1599
248 Ga0439464_0008951 3300042439 Bacteria 2626
249 Ga0451577_0142365 3300042876 Bacteria 2155
250 Ga0466966_0020284 3300044684 Bacteria 4374
251 Ga0466961_0001529 3300044693 Bacteria 14321
252 Ga0466963_0339404 3300044694 Bacteria 1058
253 Ga0453684_0040531 3300044712 Bacteria 6322
254 Ga0466971_0065789 3300044719 Bacteria 1642
255 Ga0466957_0103318 3300044842 Bacteria 1799
256 Ga0466959_0003764 3300045049 Bacteria 10044
257 Ga0466959_0007544 3300045049 Bacteria 7643
258 Ga0466958_0022991 3300045836 Bacteria 3656
259 Ga0495603_0014808 3300046455 Bacteria 4717
260 Ga0495583_0068307 3300046506 Bacteria 1568
261 Ga0495606_0090449 3300046507 Bacteria 1884
262 Ga0495610_0012701 3300046512 Bacteria 5047
263 Ga0495616_0059230 3300046513 Bacteria 1884
264 Ga0495620_0060482 3300046515 Bacteria 1579
265 Ga0495630_0165803 3300046517 Bacteria 1682
266 Ga0495643_0036748 3300046522 Bacteria 2689
267 Ga0495643_0065845 3300046522 Bacteria 1912
268 Ga0495666_0111909 3300046526 Bacteria 1282
269 Ga0495587_0007518 3300046536 Bacteria 7057
270 Ga0495667_0025127 3300046559 Bacteria 4016
271 Ga0495668_0023386 3300046616 Bacteria 3525
272 Ga0495634_0272791 3300046642 Bacteria 1029
273 Ga0495588_0077102 3300046674 Bacteria 1738
274 Ga0495669_0113992 3300046684 Bacteria 1264
275 Ga0495604_0213019 3300047317 Bacteria 1334
276 Ga0495674_0265419 3300047319 Bacteria 1409
277 Ga0495680_0033724 3300047322 Bacteria 4142
278 Ga0495687_006953 3300047443 Bacteria 6803
279 Ga0495675_0284707 3300047444 Bacteria 985
280 Ga0495673_0037212 3300047469 Bacteria 2225
281 Ga0495602_0069620 3300048088 Bacteria 3015
282 Ga0496101_0288501 3300048904 Bacteria 1284
283 Ga0496104_0015632 3300048907 Bacteria 6881
284 Ga0496105_0342003 3300048908 Bacteria 1196
285 Ga0496106_0031241 3300048909 Bacteria 3967
286 Ga0496106_0389877 3300048909 Bacteria 1119
287 Ga0496106_0457901 3300048909 Bacteria 1025
288 Ga0496109_0000817 3300048912 Bacteria 25948
289 Ga0496109_0386735 3300048912 Bacteria 1322
290 Ga0496110_0004525 3300048913 Bacteria 10787
291 Ga0496110_0206732 3300048913 Bacteria 1784
292 Ga0496111_0083210 3300048914 Bacteria 2338
293 Ga0496112_0001125 3300048915 Bacteria 19892
294 Ga0496113_0019509 3300048916 Bacteria 4745
295 Ga0496113_0324574 3300048916 Bacteria 1234
296 Ga0496114_0130255 3300048917 Bacteria 2172
297 Ga0496114_0132611 3300048917 Bacteria 2152
298 Ga0496115_0176984 3300048918 Bacteria 1764
299 Ga0496117_0013398 3300048920 Bacteria 7157
300 Ga0496117_0087536 3300048920 Bacteria 2019
301 Ga0496118_0023319 3300048921 Bacteria 5379
302 Ga0496118_0033450 3300048921 Bacteria 4217
303 Ga0496119_0039877 3300048922 Bacteria 3013
304 Ga0496119_0064886 3300048922 Bacteria 2166
305 Ga0496120_0056567 3300048923 Bacteria 2213
306 Ga0496121_0000398 3300048924 Bacteria 87272
307 Ga0496121_0037414 3300048924 Bacteria 4310
308 Ga0496121_0161299 3300048924 Bacteria 1639
309 Ga0496121_0161810 3300048924 Bacteria 1636
310 Ga0496121_0226872 3300048924 Bacteria 1311
311 Ga0496121_0278822 3300048924 Bacteria 1145
312 Ga0496122_0054773 3300048925 Bacteria 2992
313 Ga0496124_0000524 3300048927 Bacteria 65208
314 Ga0496124_0011097 3300048927 Bacteria 9039
315 Ga0496124_0265801 3300048927 Bacteria 1259
316 Ga0496125_0000203 3300048928 Bacteria 125569
317 Ga0496125_0019604 3300048928 Bacteria 6373
318 Ga0496125_0104759 3300048928 Bacteria 2070
319 Ga0496126_0018081 3300048929 Bacteria 7001
320 Ga0496126_0164608 3300048929 Bacteria 1893
321 Ga0495682_0016484 3300049460 Bacteria 2797
322 Ga0501031_0321645 3300049568 Bacteria 1002
323 Ga0501032_0053469 3300049569 Bacteria 2719
324 Ga0501033_0333218 3300049570 Unclassified 1065
325 Ga0501034_0118553 3300049571 Bacteria 2634
326 Ga0501039_0047816 3300049575 Bacteria 3307
327 Ga0501041_0010680 3300049577 Bacteria 5418
328 Ga0501043_0136114 3300049579 Bacteria 1924
329 Ga0501073_0280431 3300049589 Bacteria 1150
330 Ga0501079_0162362 3300049741 Bacteria 1742
331 Ga0501081_0103770 3300049743 Bacteria 2012
332 Ga0501283_011932 3300049779 Bacteria 1299
333 Ga0501035_0338686 3300049822 Bacteria 1261
334 nmdc:mga00v17_13980_c1 3300050491 Bacteria 3625
335 nmdc:mga0yw44_129422_c1 3300050492 Bacteria 1633
336 nmdc:mga06z11_31364_c1 3300050494 Bacteria 2581
337 nmdc:mga06z11_52051_c1 3300050494 Bacteria 2099
338 nmdc:mga05p37_5436_c1 3300050507 Bacteria 14967
339 nmdc:mga09592_21234_c1 3300050508 Bacteria 5350
340 nmdc:mga09592_58373_c1 3300050508 Unclassified 1962
341 nmdc:mga0qj67_37719_c1 3300050509 Bacteria 3788
342 nmdc:mga0qj67_39939_c1 3300050509 Bacteria 3687
343 nmdc:mga0qj67_65225_c1 3300050509 Unclassified 2899
344 nmdc:mga06r32_364927_c1 3300050510 Bacteria 1428
345 nmdc:mga08y16_147961_c1 3300050511 Bacteria 2441
346 nmdc:mga08y16_231972_c1 3300050511 Bacteria 1909
347 nmdc:mga08y16_465609_c1 3300050511 Bacteria 1288
348 nmdc:mga08y16_756_c1 3300050511 Bacteria 30771
349 nmdc:mga08y16_783856_c1 3300050511 Bacteria 947
350 nmdc:mga0n895_36705_c1 3300050512 Bacteria 4734
351 nmdc:mga0n895_751_c1 3300050512 Bacteria 22919
352 nmdc:mga0a205_4135_c1 3300050515 Bacteria 12991
353 nmdc:mga0sz30_119148_c1 3300050516 Bacteria 1160
354 nmdc:mga0sz30_46224_c1 3300050516 Bacteria 1837
355 Ga0495601_0003439 3300053077 Bacteria 9073
356 Ga0500635_0038332 3300053080 Bacteria 1589
357 Ga0495595_0041791 3300053084 Bacteria 2099
358 Ga0495619_0002819 3300053085 Bacteria 11325
359 Ga0500643_001141 3300053087 Bacteria 15856
360 Ga0500643_029561 3300053087 Bacteria 1685
361 Ga0500647_0039690 3300053091 Bacteria 2257
362 Ga0500566_0000010 3300053094 Bacteria 119976
363 Ga0500641_0071219 3300053096 Unclassified 1463
364 Ga0500572_000490 3300053111 Bacteria 13614
365 Ga0500614_001848 3300053123 Bacteria 4890
366 Ga0500559_0003077 3300053136 Bacteria 8325
367 Ga0500559_0048908 3300053136 Bacteria 1861
368 Ga0500590_060192 3300053148 Bacteria 1910
369 Ga0500590_094250 3300053148 Bacteria 1449
370 Ga0500590_148640 3300053148 Bacteria 1060
371 Ga0500603_000066 3300053150 Bacteria 24548
372 Ga0500616_0034614 3300053153 Bacteria 2751
373 Ga0500627_0073157 3300053158 Unclassified 1520
374 Ga0500630_000641 3300053159 Bacteria 15897
375 Ga0500638_134606 3300053162 Bacteria 1116
376 Ga0500639_000001 3300053163 Bacteria 244795
377 Ga0500639_086598 3300053163 Bacteria 1568
378 Ga0500639_138596 3300053163 Bacteria 1141
379 Ga0500636_0110763 3300053177 Bacteria 1551
380 Ga0500637_0042742 3300053178 Bacteria 2563
381 Ga0500596_000706 3300053735 Bacteria 6526
382 Ga0500601_004796 3300053737 Bacteria 1479
383 Ga0501082_0199900 3300060353 Bacteria 1739
384 Ga0466962_0018272 3300061719 Bacteria 3373
385 2509151844 2508501128 Bacteria 8613869
386 2513661177 2513237096 Bacteria 8722461
387 2513721729 2513237104 Bacteria 10034502
388 2513860416 2513237137 Bacteria 9558895
389 2513922851 2513237145 Bacteria 8979722
390 2517894112 2517572143 Bacteria 9484767
391 2524536162 2524023228 Bacteria 10118060
392 2616295492 2615840624 Bacteria 6557588
393 2643756696 2643221547 Bacteria 4740017
394 2671123429 2667528175 Bacteria 7532676
395 2728749517 2728368998 Bacteria 8720350
396 2793078440
397 2793328209 2791355261 Bacteria 6661293
398 2821446250 2821443989 Bacteria 7658172
399 2824619311 2824617872 Bacteria 8814715
400 2824628040 2824626560 Bacteria 8813858
401 2824637534 2824635225 Bacteria 8785348
402 2824645437 2824644064 Bacteria 8743947
403 2824715585 2824714736 Bacteria 8717648
404 2824725075 2824723954 Bacteria 8758240
405 2844533180 2844533157 Bacteria 7517899
406 2847937043 2847930680 Bacteria 9342022
407 2879087454 2879083081 Bacteria 8587928
408 2885412314 2885409591 Bacteria 9235467
409 2904697466 2904690495 Bacteria 9412302
410 2932795724 2932794094 Bacteria 7915132
411 8005306742 8005301065 Bacteria 6614431
412 8005383908 8005382845 Bacteria 6732062
413 8005401234 8005395548 Bacteria 6806915
414 8005693563 8005688590 Bacteria 6610080
415 8006982561 8006973647 Bacteria 10679141
416 8018133680 8018127388 Bacteria 7351159
417 8056691729 8056689827 Bacteria 6712655
418 Ga0495651_0156128
419 JGI24739J22299_10000327
420 JGI25151J46595_10000179
421 JGI25151J46595_10000468
422 JGI25153J46596_10000549
423 JGI25153J46596_10010264
424 rootL2_10022367
425 rootL2_10067914
426 JGI25404J52841_10015329
427 Ga0055539_1012092
428 Ga0065714_10076769
429 Ga0065712_10001904
430 Ga0065715_10000271
431 Ga0070670_100004988
432 Ga0068868_100218143
433 Ga0070689_100378191
434 Ga0070691_10274306
435 Ga0070668_100018984
436 Ga0070668_100364621
437 Ga0070668_100370690
438 Ga0070675_100020462
439 Ga0070673_100073748
440 Ga0070688_100206397
441 Ga0070667_100070719
442 Ga0070667_100135108
443 Ga0070700_100063407
444 Ga0070708_100507881
445 Ga0070708_100593044
446 Ga0070678_100016703
447 Ga0070678_100516636
448 Ga0070662_100291960
449 Ga0068867_100166506
450 Ga0068867_100177132
451 Ga0070685_10006856
452 Ga0070685_10145866
453 Ga0070706_100051930
454 Ga0070706_100356781
455 Ga0070707_100220610
456 Ga0070707_100480758
457 Ga0070698_100098048
458 Ga0070698_100319050
459 Ga0070697_100000192
460 Ga0070697_100325115
461 Ga0068853_100081814
462 Ga0070672_100006836
463 Ga0070693_100218392
464 Ga0070665_100018935
465 Ga0070665_100294556
466 Ga0070665_100341577
467 Ga0070665_100678731
468 Ga0068855_100197923
469 Ga0070664_100189886
470 Ga0070664_100192978
471 Ga0070664_100667313
472 Ga0068857_100009025
473 Ga0068857_100378465
474 Ga0068856_100135589
475 Ga0068856_100265329
476 Ga0068852_100315516
477 Ga0068859_100200506
478 Ga0068859_100358317
479 Ga0068864_100087346
480 Ga0068864_100672154
481 Ga0068866_10206259
482 Ga0068861_100381753
483 Ga0068863_100009463
484 Ga0068863_100047168
485 Ga0068860_100321852
486 Ga0068862_100113862
487 Ga0068862_100148616
488 Ga0081540_1002786
489 Ga0081540_1011867
490 Ga0081540_1013615
491 Ga0081540_1018968
492 Ga0081540_1040970
493 Ga0081539_10013983
494 Ga0075365_10160518
495 Ga0075368_10065791
496 Ga0075364_10033328
497 Ga0075367_10056318
498 Ga0075367_10226030
499 Ga0075369_10018295
500 Ga0075366_10040607
501 Ga0097621_100034017
502 Ga0075370_10164327
503 Ga0068871_100060490
504 Ga0068871_100415331
505 Ga0075428_100002867
506 Ga0075428_100112021
507 Ga0075430_100024618
508 Ga0075430_100026484
509 Ga0075430_100138191
510 Ga0075431_100294794
511 Ga0075433_10001040
512 Ga0075434_100000736
513 Ga0075434_100056684
514 Ga0075429_100027083
515 Ga0075429_100157244
516 Ga0068865_100097947
517 Ga0097620_100200487
518 Ga0097620_100358305
519 Ga0099823_1067035
520 Ga0075435_100015047
521 Ga0099794_10016483
522 Ga0099794_10094429
523 Ga0099795_10002735
524 Ga0105240_10206148
525 Ga0105240_10667388
526 Ga0111539_10000249
527 Ga0111539_10066279
528 Ga0111539_10302811
529 Ga0111539_10303968
530 Ga0114129_10004104
531 Ga0114129_10272931
532 Ga0105241_10363898
533 Ga0105241_10424385
534 Ga0105242_10025484
535 Ga0105242_10081275
536 Ga0105248_10033290
537 Ga0105248_10149894
538 Ga0105237_10111232
539 Ga0105237_10133933
540 Ga0105237_10719348
541 Ga0105238_10120947
542 Ga0105238_10607779
543 Ga0105249_10004466
544 Ga0105249_10018162
545 Ga0105249_10412521
546 Ga0105239_10167977
547 Ga0105239_10251830
548 Ga0105239_10325641
549 Ga0105239_10355539
550 Ga0105239_11139417
551 Ga0105246_10066505
552 Ga0105246_10449337
553 Ga0157370_10379421
554 Ga0157369_10051781
555 Ga0157369_10218897
556 Ga0157374_10016506
557 Ga0157374_10124985
558 Ga0163162_10077740
559 Ga0157372_10454816
560 Ga0157375_10000221
561 Ga0157375_10037781
562 Ga0157375_10065813
563 Ga0163163_10495308
564 Ga0163163_10568883
565 Ga0157376_10011199
566 Ga0157376_10430153
567 Ga0163161_10014900
568 Ga0213876_10004322
569 Ga0213875_10000054
570 Ga0209677_101679
571 Ga0209025_1000251
572 Ga0209758_1014007
573 Ga0209758_1048746
574 Ga0207697_10047356
575 Ga0207688_10012373
576 Ga0207680_10223827
577 Ga0207671_10119656
578 Ga0207671_10206572
579 Ga0207671_10281536
580 Ga0207681_10047733
581 Ga0207694_10551745
582 Ga0207650_10003609
583 Ga0207659_10038647
584 Ga0207706_10043626
585 Ga0207686_10502355
586 Ga0207709_10127194
587 Ga0207670_10250026
588 Ga0207669_10082795
589 Ga0207704_10035960
590 Ga0207691_10019080
591 Ga0207691_10387328
592 Ga0207711_10034952
593 Ga0207711_10086786
594 Ga0207711_10396207
595 Ga0207689_10189589
596 Ga0207679_10103880
597 Ga0207651_10125523
598 Ga0207668_10012338
599 Ga0207668_10344966
600 Ga0207668_10358566
601 Ga0207658_10180928
602 Ga0207658_10316304
603 Ga0207677_10086658
604 Ga0207677_10321515
605 Ga0207703_10390023
606 Ga0207703_10405828
607 Ga0207708_10099440
608 Ga0207702_10207043
609 Ga0207702_10219247
610 Ga0207641_10036752
611 Ga0207648_10112798
612 Ga0207648_10160286
613 Ga0207648_10203915
614 Ga0207676_10777304
615 Ga0207674_10002688
616 Ga0207675_100197275
617 Ga0207683_10062033
618 Ga0209389_1071282
619 Ga0209589_1000018
620 Ga0209489_100026
621 Ga0209489_120466
622 Ga0209700_100030
623 Ga0209700_100035
624 Ga0209179_1013713
625 Ga0209588_1010134
626 Ga0207428_10001487
627 Ga0207428_10008196
628 Ga0268265_10117189
629 Ga0268265_10187766
630 Ga0268264_10080109
631 Ga0307515_10012760
632 Ga0307511_10091054
633 Ga0307513_10107957
634 Ga0307513_10423265
635 Ga0307408_100003483
636 Ga0307408_100031352
637 Ga0307508_10082464
638 Ga0307516_10004439
639 Ga0307516_10057504
640 Ga0307516_10094985
641 Ga0307516_10131995
642 Ga0307516_10190221
643 Ga0307413_10653746
644 Ga0307410_10055223
645 Ga0307410_10203096
646 Ga0307406_10028689
647 Ga0307409_100212626
648 Ga0307414_10028502
649 Ga0307411_10060654
650 Ga0307411_10079623
651 Ga0307507_10024819
652 Ga0315911_1000011
653 Ga0316215_1004029
654 Ga0373937_0139824
655 Ga0395900_0077127
656 Ga0436364_0410246
657 Ga0436365_0273120
658 Ga0436365_1898441
659 Ga0451833_0777264
660 Ga0451839_0960151
661 Ga0451841_0821064
662 Ga0439443_023890
663 Ga0439450_000835
664 Ga0439458_0018467
665 Ga0439464_0008951
666 Ga0451577_0142365
667 Ga0466966_0020284
668 Ga0466961_0001529
669 Ga0466963_0339404
670 Ga0453684_0040531
671 Ga0466971_0065789
672 Ga0466957_0103318
673 Ga0466959_0003764
674 Ga0466959_0007544
675 Ga0466958_0022991
676 Ga0495603_0014808
677 Ga0495583_0068307
678 Ga0495606_0090449
679 Ga0495610_0012701
680 Ga0495616_0059230
681 Ga0495620_0060482
682 Ga0495630_0165803
683 Ga0495643_0036748
684 Ga0495643_0065845
685 Ga0495666_0111909
686 Ga0495587_0007518
687 Ga0495667_0025127
688 Ga0495668_0023386
689 Ga0495634_0272791
690 Ga0495588_0077102
691 Ga0495669_0113992
692 Ga0495604_0213019
693 Ga0495674_0265419
694 Ga0495680_0033724
695 Ga0495687_006953
696 Ga0495675_0284707
697 Ga0495673_0037212
698 Ga0495602_0069620
699 Ga0496101_0288501
700 Ga0496104_0015632
701 Ga0496105_0342003
702 Ga0496106_0031241
703 Ga0496106_0389877
704 Ga0496106_0457901
705 Ga0496109_0000817
706 Ga0496109_0386735
707 Ga0496110_0004525
708 Ga0496110_0206732
709 Ga0496111_0083210
710 Ga0496112_0001125
711 Ga0496113_0019509
712 Ga0496113_0324574
713 Ga0496114_0130255
714 Ga0496114_0132611
715 Ga0496115_0176984
716 Ga0496117_0013398
717 Ga0496117_0087536
718 Ga0496118_0023319
719 Ga0496118_0033450
720 Ga0496119_0039877
721 Ga0496119_0064886
722 Ga0496120_0056567
723 Ga0496121_0000398
724 Ga0496121_0037414
725 Ga0496121_0161299
726 Ga0496121_0161810
727 Ga0496121_0226872
728 Ga0496121_0278822
729 Ga0496122_0054773
730 Ga0496124_0000524
731 Ga0496124_0011097
732 Ga0496124_0265801
733 Ga0496125_0000203
734 Ga0496125_0019604
735 Ga0496125_0104759
736 Ga0496126_0018081
737 Ga0496126_0164608
738 Ga0495682_0016484
739 Ga0501031_0321645
740 Ga0501032_0053469
741 Ga0501033_0333218
742 Ga0501034_0118553
743 Ga0501039_0047816
744 Ga0501041_0010680
745 Ga0501043_0136114
746 Ga0501073_0280431
747 Ga0501079_0162362
748 Ga0501081_0103770
749 Ga0501283_011932
750 Ga0501035_0338686
751 nmdc:mga00v17_13980_c1
752 nmdc:mga0yw44_129422_c1
753 nmdc:mga06z11_31364_c1
754 nmdc:mga06z11_52051_c1
755 nmdc:mga05p37_5436_c1
756 nmdc:mga09592_21234_c1
757 nmdc:mga09592_58373_c1
758 nmdc:mga0qj67_37719_c1
759 nmdc:mga0qj67_39939_c1
760 nmdc:mga0qj67_65225_c1
761 nmdc:mga06r32_364927_c1
762 nmdc:mga08y16_147961_c1
763 nmdc:mga08y16_231972_c1
764 nmdc:mga08y16_465609_c1
765 nmdc:mga08y16_756_c1
766 nmdc:mga08y16_783856_c1
767 nmdc:mga0n895_36705_c1
768 nmdc:mga0n895_751_c1
769 nmdc:mga0a205_4135_c1
770 nmdc:mga0sz30_119148_c1
771 nmdc:mga0sz30_46224_c1
772 Ga0495601_0003439
773 Ga0500635_0038332
774 Ga0495595_0041791
775 Ga0495619_0002819
776 Ga0500643_001141
777 Ga0500643_029561
778 Ga0500647_0039690
779 Ga0500566_0000010
780 Ga0500641_0071219
781 Ga0500572_000490
782 Ga0500614_001848
783 Ga0500559_0003077
784 Ga0500559_0048908
785 Ga0500590_060192
786 Ga0500590_094250
787 Ga0500590_148640
788 Ga0500603_000066
789 Ga0500616_0034614
790 Ga0500627_0073157
791 Ga0500630_000641
792 Ga0500638_134606
793 Ga0500639_000001
794 Ga0500639_086598
795 Ga0500639_138596
796 Ga0500636_0110763
797 Ga0500637_0042742
798 Ga0500596_000706
799 Ga0500601_004796
800 Ga0501082_0199900
801 Ga0466962_0018272
802 2509151844
803 2513661177
804 2513721729
805 2513860416
806 2513922851
807 2517894112
808 2524536162
809 2616295492
810 2643756696
811 2671123429
812 2728749517
813 2793078440
814 2793328209
815 2821446250
816 2824619311
817 2824628040
818 2824637534
819 2824645437
820 2824715585
821 2824725075
822 2844533180
823 2847937043
824 2879087454
825 2885412314
826 2904697466
827 2932795724
828 8005306742
829 8005383908
830 8005401234
831 8005693563
832 8006982561
833 8018133680
834 8056691729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dt0-assembly2.cif.gz_B proline hydroxylase h11-n101i mutant 0.7058 9 234
5ybl-assembly2.cif.gz_C fe(ii)/(alpha)ketoglutarate-dependent dioxygenase ause 0.7025 6 246
4nao-assembly1.cif.gz_A-2 crystal structure of eash 0.696 14 243
7wsb-assembly3.cif.gz_E the ternary complex structure of ftmox1 with a-ketoglutarate and 13-oxo-fumitremorgin b 0.6914 6 237
6akz-assembly1.cif.gz_A crystal structure of glcnac inducible gene 2, gig2 (duf1479) from candida albicans 0.6904 7 238
ID Description Score Start End Superfamily
4naoA00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.696 14 243 2.60.120.620
af_A0A1D8PEJ2_2_436_2.60.120.330 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.6878 7 238 2.60.120.330
4zonA00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6854 6 237 2.60.120.620
5ep9C00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6734 11 233 2.60.120.620
4xcaC00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6699 8 239 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A150ZFI3-F1-model_v4 deleted 0.9917 1 262
AF-A0A368K0A9-F1-model_v4 Phytanoyl-CoA dioxygenase 0.991 1 263 GO:0051213
AF-A0A150ZFI3-F1-model_v4 deleted 0.9879 1 262
AF-A0A135HWJ7-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9843 1 263 GO:0051213
AF-A0A135HWJ7-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9806 1 263 GO:0051213

Map