F438702

General Info

Members Datasets Scaffolds Average Seq Length
416 264 413 164

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10010167|JGI25151J46595_100101673
Length 192
Sequence MPSDPQPPEFLKKIVSREEAPQRLAALPRPIVFTNGVFDVLHRGHASYLAQARSLGGSLVVALNTDASARRLGKGPDRPLNNEQDRAVMMAALESVSLVTWFDEDTPLELISELRPELLVKGGDYDMDKLAETAVVRAYGGDARAIPFVDGYSTTALVKKIRATQAGEPDDGTAGLSGSLGDQHGVGAAEGK

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
3 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
126 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
127 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
204 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
205 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
206 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
207 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
215 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
216 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
217 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
218 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
219 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
222 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
223 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
224 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
227 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
228 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
229 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
230 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
231 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
260 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
261 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
262 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
263 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
264 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.75
Nodule 0
Rhizoplane 2.88
Rhizosphere 74.52
Stem 0
Stem Tuber 0
Unclassified 3.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10045893 3300002075 Bacteria 889
2 JGI25156J39149_1000024 3300002705 Bacteria 141748
3 JGI25154J39366_1000043 3300002738 Bacteria 142417
4 JGI25157J39369_1000031 3300002741 Bacteria 141953
5 JGI25150J39212_1001566 3300002774 Bacteria 6255
6 JGI25150J39212_1006954 3300002774 Bacteria 2301
7 JGI25159J45721_1001109 3300002987 Bacteria 11496
8 JGI25159J45721_1001763 3300002987 Bacteria 8698
9 JGI25151J46595_10010167 3300003187 Bacteria 4392
10 JGI25151J46595_10010989 3300003187 Bacteria 4182
11 JGI25153J46596_10112642 3300003215 Bacteria 623
12 JGI25160J50197_1000136 3300003354 Bacteria 66161
13 JGI25161J50226_1000007 3300003374 Bacteria 256181
14 Ga0055526_1000974 3300003771 Bacteria 21093
15 Ga0055526_1007304 3300003771 Bacteria 5779
16 Ga0055537_1000328 3300003773 Bacteria 32405
17 Ga0055524_1000101 3300003775 Bacteria 106527
18 Ga0055534_1003209 3300003784 Bacteria 5268
19 Ga0055528_1001455 3300003790 Bacteria 14428
20 Ga0055530_10000251 3300003791 Bacteria 48732
21 Ga0055540_1000099 3300003792 Bacteria 96187
22 Ga0055540_1011074 3300003792 Bacteria 2944
23 Ga0055531_10000333 3300003794 Bacteria 46562
24 Ga0055531_10006848 3300003794 Bacteria 6356
25 Ga0055531_10060772 3300003794 Bacteria 924
26 Ga0055543_1000061 3300004625 Bacteria 98138
27 Ga0065165_1023154 3300005262 Bacteria 2112
28 Ga0065165_1023574 3300005262 Bacteria 2083
29 Ga0065165_1025675 3300005262 Bacteria 1954
30 Ga0065165_1038683 3300005262 Bacteria 1436
31 Ga0065715_10379789 3300005293 Bacteria 909
32 Ga0065707_10055231 3300005295 Bacteria 1011
33 Ga0070658_10026005 3300005327 Bacteria 4695
34 Ga0070683_100024175 3300005329 Bacteria 5438
35 Ga0070690_100002268 3300005330 Bacteria 10300
36 Ga0070677_10006728 3300005333 Bacteria 3825
37 Ga0068869_100002422 3300005334 Bacteria 11248
38 Ga0070682_100105278 3300005337 Bacteria 1870
39 Ga0068868_100000592 3300005338 Bacteria 24392
40 Ga0068868_100014332 3300005338 Bacteria 5842
41 Ga0068868_100030991 3300005338 Bacteria 4104
42 Ga0068868_100417363 3300005338 Bacteria 1161
43 Ga0070689_100000799 3300005340 Bacteria 19372
44 Ga0070689_100909367 3300005340 Bacteria 779
45 Ga0070691_10004864 3300005341 Bacteria 6119
46 Ga0070687_100006818 3300005343 Bacteria 4710
47 Ga0070687_100113138 3300005343 Bacteria 1540
48 Ga0070687_100259025 3300005343 Bacteria 1084
49 Ga0070661_100007365 3300005344 Bacteria 7588
50 Ga0070692_10028668 3300005345 Bacteria 2769
51 Ga0070692_10085666 3300005345 Bacteria 1705
52 Ga0070692_10730658 3300005345 Bacteria 669
53 Ga0070669_100635250 3300005353 Bacteria 897
54 Ga0070669_101180242 3300005353 Bacteria 661
55 Ga0070675_100002397 3300005354 Bacteria 13975
56 Ga0070675_100025065 3300005354 Bacteria 4780
57 Ga0070671_100301428 3300005355 Bacteria 1364
58 Ga0070674_100020398 3300005356 Bacteria 4234
59 Ga0070674_100031589 3300005356 Bacteria 3510
60 Ga0070674_100046202 3300005356 Bacteria 2978
61 Ga0070674_100161699 3300005356 Unclassified 1699
62 Ga0070674_100409626 3300005356 Bacteria 1110
63 Ga0070673_100002338 3300005364 Bacteria 11524
64 Ga0070688_100249092 3300005365 Bacteria 1264
65 Ga0070659_100016786 3300005366 Bacteria 5501
66 Ga0070667_100084682 3300005367 Bacteria 2718
67 Ga0070709_10079822 3300005434 Bacteria 2132
68 Ga0070714_100005268 3300005435 Bacteria 9853
69 Ga0070714_101646165 3300005435 Bacteria 627
70 Ga0070713_100006032 3300005436 Bacteria 8347
71 Ga0070710_10140827 3300005437 Bacteria 1479
72 Ga0070710_10556359 3300005437 Bacteria 793
73 Ga0070711_100361499 3300005439 Bacteria 1169
74 Ga0070700_100000404 3300005441 Bacteria 22272
75 Ga0070694_100039301 3300005444 Bacteria 3149
76 Ga0070663_100314147 3300005455 Bacteria 1258
77 Ga0070678_100006504 3300005456 Bacteria 6864
78 Ga0070662_100195849 3300005457 Bacteria 1600
79 Ga0068867_100009165 3300005459 Bacteria 6985
80 Ga0068867_100179367 3300005459 Bacteria 1683
81 Ga0068867_100731939 3300005459 Bacteria 876
82 Ga0070706_100652481 3300005467 Bacteria 977
83 Ga0070698_100806684 3300005471 Bacteria 883
84 Ga0070698_101216260 3300005471 Bacteria 703
85 Ga0070684_100011119 3300005535 Bacteria 7163
86 Ga0068853_100115691 3300005539 Unclassified 2387
87 Ga0068853_100765809 3300005539 Bacteria 923
88 Ga0070672_100000490 3300005543 Bacteria 23053
89 Ga0070672_100312086 3300005543 Bacteria 1335
90 Ga0070672_100990370 3300005543 Bacteria 745
91 Ga0070686_100000720 3300005544 Bacteria 19240
92 Ga0070686_100274182 3300005544 Bacteria 1241
93 Ga0070695_100022764 3300005545 Bacteria 3846
94 Ga0070696_100003412 3300005546 Bacteria 10598
95 Ga0070693_100086263 3300005547 Bacteria 1883
96 Ga0070693_100142524 3300005547 Bacteria 1510
97 Ga0070665_100615228 3300005548 Bacteria 1099
98 Ga0070704_100013326 3300005549 Bacteria 5099
99 Ga0070704_100043197 3300005549 Bacteria 3123
100 Ga0070704_100205481 3300005549 Bacteria 1593
101 Ga0068855_100072046 3300005563 Bacteria 4017
102 Ga0070664_100001675 3300005564 Bacteria 17748
103 Ga0070664_101364000 3300005564 Bacteria 670
104 Ga0068857_100585434 3300005577 Bacteria 1054
105 Ga0068854_100060150 3300005578 Bacteria 2747
106 Ga0068854_100505831 3300005578 Bacteria 1018
107 Ga0070702_100000509 3300005615 Bacteria 13986
108 Ga0070702_100130286 3300005615 Bacteria 1587
109 Ga0068852_100000601 3300005616 Bacteria 23588
110 Ga0068852_100023546 3300005616 Bacteria 4958
111 Ga0068859_100011018 3300005617 Bacteria 9098
112 Ga0068864_100001478 3300005618 Bacteria 19369
113 Ga0068866_10002328 3300005718 Bacteria 7876
114 Ga0068861_100002624 3300005719 Bacteria 11750
115 Ga0068851_10000354 3300005834 Bacteria 20710
116 Ga0068870_10035983 3300005840 Bacteria 2544
117 Ga0068870_10127774 3300005840 Bacteria 1472
118 Ga0068863_100106141 3300005841 Bacteria 2672
119 Ga0068858_100001525 3300005842 Bacteria 23790
120 Ga0068858_100002133 3300005842 Bacteria 20039
121 Ga0068860_100577734 3300005843 Bacteria 1128
122 Ga0068862_100025756 3300005844 Bacteria 4940
123 Ga0081539_10238078 3300005985 Bacteria 817
124 Ga0075364_10040327 3300006051 Bacteria 3028
125 Ga0070715_10241043 3300006163 Bacteria 940
126 Ga0075362_10017353 3300006177 Bacteria 2965
127 Ga0075362_10184548 3300006177 Bacteria 1012
128 Ga0075366_10186599 3300006195 Bacteria 1260
129 Ga0097621_100001954 3300006237 Bacteria 14069
130 Ga0097621_100285351 3300006237 Bacteria 1454
131 Ga0075370_10132588 3300006353 Bacteria 1454
132 Ga0068871_100005743 3300006358 Bacteria 8716
133 Ga0068871_100007697 3300006358 Bacteria 7708
134 Ga0068871_100863243 3300006358 Bacteria 837
135 Ga0075428_101330001 3300006844 Bacteria 755
136 Ga0075429_100064566 3300006880 Bacteria 3188
137 Ga0075429_100321718 3300006880 Bacteria 1354
138 Ga0068865_100000330 3300006881 Bacteria 26232
139 Ga0068865_100088477 3300006881 Bacteria 2241
140 Ga0075436_100004155 3300006914 Bacteria 9936
141 Ga0075436_100492333 3300006914 Bacteria 896
142 Ga0097620_100011018 3300006931 Bacteria 9098
143 Ga0097620_100395299 3300006931 Bacteria 1478
144 Ga0075435_100954252 3300007076 Bacteria 748
145 Ga0075435_101117612 3300007076 Bacteria 689
146 Ga0105240_10209517 3300009093 Bacteria 2279
147 Ga0105240_10276867 3300009093 Bacteria 1929
148 Ga0111539_10045965 3300009094 Bacteria 5225
149 Ga0111539_10845274 3300009094 Bacteria 1065
150 Ga0111539_11297666 3300009094 Bacteria 845
151 Ga0105245_10001144 3300009098 Bacteria 23972
152 Ga0105245_10101063 3300009098 Bacteria 2668
153 Ga0105245_11023073 3300009098 Bacteria 871
154 Ga0105243_10001169 3300009148 Bacteria 23782
155 Ga0105241_10290674 3300009174 Bacteria 1399
156 Ga0105242_10512902 3300009176 Bacteria 1142
157 Ga0105248_10029735 3300009177 Bacteria 6097
158 Ga0105237_10916448 3300009545 Bacteria 883
159 Ga0105238_10111911 3300009551 Bacteria 2710
160 Ga0105238_10536316 3300009551 Bacteria 1174
161 Ga0105238_10645688 3300009551 Bacteria 1068
162 Ga0105238_11656540 3300009551 Bacteria 670
163 Ga0105249_10448723 3300009553 Bacteria 1328
164 Ga0105246_10080809 3300011119 Bacteria 2315
165 Ga0157326_1001292 3300012513 Bacteria 2775
166 Ga0157371_10641884 3300013102 Bacteria 792
167 Ga0157370_10115252 3300013104 Bacteria 2510
168 Ga0157374_10001018 3300013296 Bacteria 24319
169 Ga0157374_10370875 3300013296 Bacteria 1425
170 Ga0157378_10000735 3300013297 Bacteria 30626
171 Ga0157378_10018149 3300013297 Bacteria 6178
172 Ga0163162_10008917 3300013306 Bacteria 9754
173 Ga0163162_10023130 3300013306 Bacteria 6130
174 Ga0163162_10195313 3300013306 Bacteria 2152
175 Ga0157372_11161394 3300013307 Bacteria 893
176 Ga0157375_10006920 3300013308 Bacteria 9897
177 Ga0157375_10068593 3300013308 Bacteria 3549
178 Ga0157375_13388240 3300013308 Bacteria 531
179 Ga0157380_10024183 3300014326 Bacteria 4594
180 Ga0157380_10840155 3300014326 Bacteria 939
181 Ga0157380_10874138 3300014326 Bacteria 923
182 Ga0157380_10983332 3300014326 Bacteria 876
183 Ga0157380_11751070 3300014326 Bacteria 680
184 Ga0157379_10018443 3300014968 Bacteria 6154
185 Ga0157379_10281726 3300014968 Bacteria 1513
186 Ga0157376_10003512 3300014969 Bacteria 10807
187 Ga0157376_10335975 3300014969 Bacteria 1441
188 Ga0163161_10095375 3300017792 Bacteria 2207
189 Ga0163161_11284130 3300017792 Bacteria 636
190 Ga0209435_100008 3300025206 Bacteria 503644
191 Ga0207425_1004229 3300025245 Bacteria 4358
192 Ga0207425_1042346 3300025245 Bacteria 862
193 Ga0209646_1000079 3300025246 Bacteria 207677
194 Ga0209026_1000067 3300025250 Bacteria 207677
195 Ga0209759_1000056 3300025256 Bacteria 207677
196 Ga0209129_1003959 3300025258 Bacteria 6111
197 Ga0209565_1000041 3300025263 Bacteria 251081
198 Ga0209565_1000538 3300025263 Bacteria 26449
199 Ga0209565_1037331 3300025263 Bacteria 919
200 Ga0209673_1000012 3300025273 Bacteria 579480
201 Ga0209130_1000184 3300025284 Bacteria 87817
202 Ga0209130_1000694 3300025284 Bacteria 30085
203 Ga0209675_1000483 3300025291 Bacteria 30258
204 Ga0209675_1007475 3300025291 Bacteria 4181
205 Ga0209676_1000013 3300025292 Bacteria 816080
206 Ga0209676_1008306 3300025292 Bacteria 4651
207 Ga0209025_1003216 3300025294 Bacteria 15826
208 Ga0209025_1005696 3300025294 Bacteria 10029
209 Ga0209025_1010418 3300025294 Bacteria 6298
210 Ga0209025_1042450 3300025294 Bacteria 1932
211 Ga0209564_1000363 3300025295 Bacteria 84210
212 Ga0209564_1002874 3300025295 Bacteria 12626
213 Ga0209564_1004933 3300025295 Bacteria 7887
214 Ga0209758_1018953 3300025297 Bacteria 3344
215 Ga0209758_1060326 3300025297 Bacteria 1256
216 Ga0209050_1000008 3300025298 Bacteria 1144179
217 Ga0209256_1000003 3300025299 Bacteria 1661127
218 Ga0207426_1000091 3300025302 Bacteria 280561
219 Ga0207426_1006716 3300025302 Bacteria 4932
220 Ga0209051_1000005 3300025303 Bacteria 1142353
221 Ga0209051_1000214 3300025303 Bacteria 98444
222 Ga0209257_1000015 3300025304 Bacteria 908141
223 Ga0209257_1000048 3300025304 Bacteria 455536
224 Ga0209257_1007059 3300025304 Bacteria 6942
225 Ga0207656_10001618 3300025321 Bacteria 7494
226 Ga0207692_10616427 3300025898 Bacteria 699
227 Ga0207642_10002085 3300025899 Bacteria 6180
228 Ga0207699_10075499 3300025906 Bacteria 2074
229 Ga0207699_10477518 3300025906 Bacteria 897
230 Ga0207645_10392272 3300025907 Bacteria 933
231 Ga0207643_10025203 3300025908 Bacteria 3286
232 Ga0207705_10512415 3300025909 Bacteria 932
233 Ga0207663_10219685 3300025916 Bacteria 1382
234 Ga0207660_10456157 3300025917 Bacteria 1034
235 Ga0207660_11017765 3300025917 Bacteria 675
236 Ga0207662_10019933 3300025918 Bacteria 3821
237 Ga0207662_10136189 3300025918 Bacteria 1552
238 Ga0207662_10265350 3300025918 Bacteria 1131
239 Ga0207657_10390324 3300025919 Bacteria 1095
240 Ga0207649_10011610 3300025920 Bacteria 4863
241 Ga0207646_10511355 3300025922 Bacteria 1082
242 Ga0207681_11093449 3300025923 Bacteria 669
243 Ga0207694_11159875 3300025924 Bacteria 654
244 Ga0207650_10010622 3300025925 Bacteria 6322
245 Ga0207659_10011275 3300025926 Bacteria 5642
246 Ga0207659_10102795 3300025926 Bacteria 2158
247 Ga0207687_10000379 3300025927 Bacteria 29896
248 Ga0207687_10836631 3300025927 Bacteria 786
249 Ga0207644_10003090 3300025931 Bacteria 10714
250 Ga0207690_10333098 3300025932 Bacteria 1196
251 Ga0207686_10000979 3300025934 Bacteria 16995
252 Ga0207686_10231908 3300025934 Bacteria 1339
253 Ga0207686_10662145 3300025934 Bacteria 827
254 Ga0207709_10005308 3300025935 Bacteria 7330
255 Ga0207670_10005740 3300025936 Bacteria 6846
256 Ga0207670_10558884 3300025936 Bacteria 936
257 Ga0207669_10114233 3300025937 Bacteria 1817
258 Ga0207704_10000270 3300025938 Bacteria 24928
259 Ga0207704_10159176 3300025938 Bacteria 1604
260 Ga0207691_10000634 3300025940 Bacteria 34768
261 Ga0207691_10706239 3300025940 Bacteria 850
262 Ga0207711_10080858 3300025941 Bacteria 2839
263 Ga0207711_10223186 3300025941 Bacteria 1724
264 Ga0207689_10000775 3300025942 Bacteria 30666
265 Ga0207661_10020839 3300025944 Bacteria 4906
266 Ga0207679_10000987 3300025945 Bacteria 18274
267 Ga0207679_11306854 3300025945 Bacteria 666
268 Ga0207667_10057212 3300025949 Bacteria 4094
269 Ga0207667_10193257 3300025949 Bacteria 2088
270 Ga0207667_10432765 3300025949 Bacteria 1338
271 Ga0207651_10005207 3300025960 Bacteria 6645
272 Ga0207712_10276591 3300025961 Bacteria 1368
273 Ga0207640_10005693 3300025981 Bacteria 6789
274 Ga0207658_10057921 3300025986 Bacteria 2881
275 Ga0207677_10000896 3300026023 Bacteria 16730
276 Ga0207677_10294905 3300026023 Bacteria 1337
277 Ga0207703_10012756 3300026035 Bacteria 6553
278 Ga0207703_10014007 3300026035 Bacteria 6251
279 Ga0207703_10199575 3300026035 Bacteria 1777
280 Ga0207639_10792700 3300026041 Bacteria 883
281 Ga0207678_10355725 3300026067 Bacteria 1263
282 Ga0207708_10000049 3300026075 Bacteria 114743
283 Ga0207641_10087372 3300026088 Bacteria 2720
284 Ga0207648_10000161 3300026089 Bacteria 69095
285 Ga0207648_10032289 3300026089 Bacteria 4622
286 Ga0207648_10050178 3300026089 Bacteria 3649
287 Ga0207648_10051845 3300026089 Bacteria 3587
288 Ga0207648_10052954 3300026089 Bacteria 3548
289 Ga0207648_10950650 3300026089 Bacteria 804
290 Ga0207676_10002832 3300026095 Bacteria 12344
291 Ga0207676_10561131 3300026095 Bacteria 1092
292 Ga0207674_11215909 3300026116 Bacteria 723
293 Ga0207675_100002263 3300026118 Bacteria 19137
294 Ga0207675_100975473 3300026118 Bacteria 865
295 Ga0207683_10000831 3300026121 Bacteria 28227
296 Ga0207683_10064985 3300026121 Bacteria 3216
297 Ga0207698_10000439 3300026142 Bacteria 23939
298 Ga0207698_10039089 3300026142 Bacteria 3512
299 Ga0209968_1000516 3300027526 Bacteria 6078
300 Ga0209999_1026635 3300027543 Bacteria 1069
301 Ga0209966_1000006 3300027695 Bacteria 102095
302 Ga0207428_10205016 3300027907 Bacteria 1483
303 Ga0207428_10342674 3300027907 Bacteria 1101
304 Ga0268265_10187828 3300028380 Bacteria 1782
305 Ga0268265_10418215 3300028380 Bacteria 1244
306 Ga0268264_10517319 3300028381 Bacteria 1166
307 Ga0307515_10000751 3300028794 Bacteria 75067
308 Ga0307513_10000013 3300031456 Bacteria 325682
309 Ga0307513_10000130 3300031456 Bacteria 106451
310 Ga0307513_10118072 3300031456 Bacteria 2628
311 Ga0307408_100015605 3300031548 Bacteria 5059
312 Ga0307408_100309014 3300031548 Bacteria 1327
313 Ga0307408_100438436 3300031548 Bacteria 1130
314 Ga0307408_101324808 3300031548 Bacteria 676
315 Ga0307514_10000763 3300031649 Bacteria 53536
316 Ga0265314_10386385 3300031711 Bacteria 760
317 Ga0265342_10268660 3300031712 Bacteria 905
318 Ga0307406_10009264 3300031901 Bacteria 5517
319 Ga0307412_10410907 3300031911 Bacteria 1105
320 Ga0307412_10842322 3300031911 Bacteria 799
321 Ga0307416_100343629 3300032002 Bacteria 1506
322 Ga0307416_100938718 3300032002 Bacteria 967
323 Ga0307416_101714614 3300032002 Bacteria 733
324 Ga0307414_10541999 3300032004 Bacteria 1036
325 Ga0307510_10086836 3300033180 Bacteria 2998
326 Ga0373940_0063568 3300035088 Bacteria 1061
327 Ga0373952_0000068 3300035092 Bacteria 13110
328 Ga0373960_0008558 3300035121 Bacteria 2455
329 Ga0373942_0092938 3300035207 Bacteria 912
330 Ga0395899_0046182 3300037312 Bacteria 3244
331 Ga0395899_0081755 3300037312 Bacteria 2350
332 Ga0395900_0012981 3300037418 Bacteria 8512
333 Ga0395900_0071544 3300037418 Bacteria 3565
334 Ga0395900_1077296 3300037418 Bacteria 721
335 Ga0395900_1714167 3300037418 Bacteria 539
336 Ga0395898_0029810 3300037466 Bacteria 5461
337 Ga0395898_0273725 3300037466 Bacteria 1610
338 Ga0395905_0183233 3300037471 Bacteria 1966
339 Ga0395905_0200002 3300037471 Bacteria 1873
340 Ga0395905_0396133 3300037471 Bacteria 1275
341 Ga0395905_0577481 3300037471 Bacteria 1025
342 Ga0395905_0814512 3300037471 Bacteria 837
343 Ga0395905_1392329 3300037471 Bacteria 605
344 Ga0395901_0045472 3300038443 Bacteria 4556
345 Ga0436365_1205206 3300039437 Bacteria 699
346 Ga0436361_0039286 3300039447 Bacteria 8008
347 Ga0436361_0158828 3300039447 Bacteria 6962
348 Ga0451793_0153404 3300041452 Bacteria 1058
349 Ga0451797_0825067 3300041453 Bacteria 670
350 Ga0451795_1338211 3300041456 Bacteria 762
351 Ga0451807_2226608 3300041486 Bacteria 1398
352 Ga0451845_0764397 3300041501 Bacteria 591
353 Ga0451853_2056391 3300041512 Bacteria 1086
354 Ga0439450_093439 3300042008 Bacteria 757
355 Ga0439458_0027508 3300042157 Bacteria 1342
356 Ga0439464_0090843 3300042439 Bacteria 920
357 Ga0450893_0015748 3300042532 Bacteria 1276
358 Ga0451577_0627905 3300042876 Bacteria 975
359 Ga0466969_0003247 3300044656 Bacteria 8647
360 Ga0453683_0001138 3300044673 Bacteria 24154
361 Ga0453683_0353620 3300044673 Bacteria 944
362 Ga0466965_0024604 3300044683 Bacteria 2913
363 Ga0466966_0166388 3300044684 Bacteria 1341
364 Ga0466961_0000187 3300044693 Bacteria 41670
365 Ga0466961_0535281 3300044693 Bacteria 706
366 Ga0466964_0102263 3300044706 Bacteria 1265
367 Ga0453684_0136671 3300044712 Bacteria 2934
368 Ga0453684_0342383 3300044712 Bacteria 1688
369 Ga0466959_0238626 3300045049 Bacteria 1256
370 Ga0451576_0056022 3300045051 Bacteria 4124
371 Ga0495663_0063992 3300046525 Bacteria 1160
372 Ga0495621_0236516 3300046539 Bacteria 743
373 Ga0495656_0201648 3300046615 Bacteria 987
374 Ga0495615_0022832 3300048090 Bacteria 1427
375 Ga0496106_0687088 3300048909 Bacteria 816
376 Ga0496108_0209743 3300048911 Bacteria 1691
377 Ga0496108_0600498 3300048911 Bacteria 959
378 Ga0496108_0824960 3300048911 Bacteria 799
379 Ga0496109_0023684 3300048912 Bacteria 5450
380 Ga0496110_0007264 3300048913 Bacteria 8832
381 Ga0496111_0016401 3300048914 Bacteria 5103
382 Ga0496114_0012721 3300048917 Bacteria 6741
383 Ga0501298_116502 3300049521 Bacteria 625
384 Ga0501073_0475238 3300049589 Bacteria 864
385 Ga0501044_0087076 3300049823 Bacteria 3155
386 Ga0501044_0219577 3300049823 Bacteria 1852
387 Ga0501044_0673136 3300049823 Bacteria 922
388 nmdc:mga03683_103773_c1 3300050489 Bacteria 1251
389 nmdc:mga03683_20453_c1 3300050489 Bacteria 2539
390 nmdc:mga00v17_11069_c1 3300050491 Bacteria 4948
391 nmdc:mga0k408_129982_c1 3300050493 Bacteria 1495
392 nmdc:mga0k408_322568_c1 3300050493 Bacteria 922
393 nmdc:mga07m45_348364_c1 3300050496 Bacteria 860
394 nmdc:mga07m45_97242_c2 3300050496 Bacteria 1164
395 nmdc:mga09592_61657_c1 3300050508 Bacteria 3172
396 nmdc:mga0qj67_372941_c1 3300050509 Bacteria 1152
397 nmdc:mga08y16_8844_c1 3300050511 Bacteria 10570
398 nmdc:mga08y16_996035_c1 3300050511 Bacteria 818
399 nmdc:mga0n895_207369_c1 3300050512 Bacteria 1990
400 nmdc:mga0rr50_29685_c1 3300050513 Bacteria 3860
401 nmdc:mga0rr50_530232_c1 3300050513 Bacteria 1002
402 nmdc:mga0rr50_743542_c1 3300050513 Bacteria 837
403 nmdc:mga08x19_3436_c1 3300050514 Bacteria 9443
404 nmdc:mga08x19_421011_c1 3300050514 Bacteria 938
405 nmdc:mga0sz30_45151_c1 3300050516 Bacteria 1110
406 Ga0500644_0036175 3300053088 Bacteria 1605
407 Ga0500566_0083163 3300053094 Bacteria 1778
408 Ga0500593_003703 3300053117 Bacteria 5828
409 Ga0500628_009199 3300053129 Bacteria 1737
410 Ga0500645_000699 3300053730 Bacteria 20816
411 Ga0500645_002996 3300053730 Bacteria 7150
412 Ga0500645_007508 3300053730 Bacteria 3790
413 Ga0500661_009467 3300055283 Bacteria 1783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032002 Ga0307416_100938718 Ga0307416_1009387182 154
2 3300005343 Ga0070687_100113138 Ga0070687_1001131382 156
3 3300005985 Ga0081539_10238078 Ga0081539_102380781 156
4 3300025918 Ga0207662_10136189 Ga0207662_101361892 156
5 3300025949 Ga0207667_10432765 Ga0207667_104327652 156
6 3300027526 Ga0209968_1000516 Ga0209968_10005167 156
7 3300027543 Ga0209999_1026635 Ga0209999_10266352 156
8 3300027695 Ga0209966_1000006 Ga0209966_100000645 156
9 3300005356 Ga0070674_100031589 Ga0070674_1000315894 157
10 3300005459 Ga0068867_100179367 Ga0068867_1001793672 157
11 3300005471 Ga0070698_100806684 Ga0070698_1008066842 157
12 3300006195 Ga0075366_10186599 Ga0075366_101865992 157
13 3300006358 Ga0068871_100863243 Ga0068871_1008632431 157
14 3300006914 Ga0075436_100004155 Ga0075436_1000041559 157
15 3300006914 Ga0075436_100492333 Ga0075436_1004923332 157
16 3300007076 Ga0075435_101117612 Ga0075435_1011176122 157
17 3300009176 Ga0105242_10512902 Ga0105242_105129022 157
18 3300013308 Ga0157375_13388240 Ga0157375_133882401 157
19 3300014326 Ga0157380_10840155 Ga0157380_108401552 157
20 3300014326 Ga0157380_10874138 Ga0157380_108741381 157
21 3300017792 Ga0163161_11284130 Ga0163161_112841302 157
22 3300025934 Ga0207686_10231908 Ga0207686_102319082 157
23 3300025934 Ga0207686_10662145 Ga0207686_106621451 157
24 3300026089 Ga0207648_10052954 Ga0207648_100529543 157
25 3300050493 nmdc:mga0k408_322568_c1 nmdc:mga0k408_322568_c1_166_639 157
26 3300050513 nmdc:mga0rr50_29685_c1 nmdc:mga0rr50_29685_c1_1949_2422 157
27 3300050513 nmdc:mga0rr50_743542_c1 nmdc:mga0rr50_743542_c1_195_668 157
28 3300050514 nmdc:mga08x19_3436_c1 nmdc:mga08x19_3436_c1_2969_3442 157
29 3300050514 nmdc:mga08x19_421011_c1 nmdc:mga08x19_421011_c1_194_667 157
30 3300050516 nmdc:mga0sz30_45151_c1 nmdc:mga0sz30_45151_c1_165_638 157
31 3300005354 Ga0070675_100025065 Ga0070675_1000250652 158
32 3300005356 Ga0070674_100409626 Ga0070674_1004096262 158
33 3300005434 Ga0070709_10079822 Ga0070709_100798222 158
34 3300005435 Ga0070714_101646165 Ga0070714_1016461651 158
35 3300005436 Ga0070713_100006032 Ga0070713_1000060322 158
36 3300005437 Ga0070710_10140827 Ga0070710_101408272 158
37 3300005437 Ga0070710_10556359 Ga0070710_105563592 158
38 3300005439 Ga0070711_100361499 Ga0070711_1003614992 158
39 3300005459 Ga0068867_100731939 Ga0068867_1007319391 158
40 3300005543 Ga0070672_100990370 Ga0070672_1009903702 158
41 3300005564 Ga0070664_101364000 Ga0070664_1013640002 158
42 3300006881 Ga0068865_100088477 Ga0068865_1000884772 158
43 3300006931 Ga0097620_100395299 Ga0097620_1003952992 158
44 3300014969 Ga0157376_10335975 Ga0157376_103359752 158
45 3300025898 Ga0207692_10616427 Ga0207692_106164272 158
46 3300025906 Ga0207699_10075499 Ga0207699_100754992 158
47 3300025906 Ga0207699_10477518 Ga0207699_104775182 158
48 3300025907 Ga0207645_10392272 Ga0207645_103922722 158
49 3300025916 Ga0207663_10219685 Ga0207663_102196852 158
50 3300025926 Ga0207659_10102795 Ga0207659_101027952 158
51 3300025940 Ga0207691_10706239 Ga0207691_107062392 158
52 3300026089 Ga0207648_10051845 Ga0207648_100518454 158
53 3300026089 Ga0207648_10950650 Ga0207648_109506502 158
54 3300037471 Ga0395905_0814512 Ga0395905_0814512_151_627 158
55 3300039437 Ga0436365_1205206 Ga0436365_1205206_117_593 158
56 3300044684 Ga0466966_0166388 Ga0466966_0166388_393_869 158
57 iso_pu_bacteria 2846037992 2846041766 158
58 3300003792 Ga0055540_1011074 Ga0055540_10110742 159
59 3300003794 Ga0055531_10000333 Ga0055531_1000033316 159
60 3300005340 Ga0070689_100909367 Ga0070689_1009093671 159
61 3300005353 Ga0070669_100635250 Ga0070669_1006352501 159
62 3300005365 Ga0070688_100249092 Ga0070688_1002490922 159
63 3300005435 Ga0070714_100005268 Ga0070714_1000052687 159
64 3300005471 Ga0070698_101216260 Ga0070698_1012162602 159
65 3300005563 Ga0068855_100072046 Ga0068855_1000720462 159
66 3300005616 Ga0068852_100023546 Ga0068852_1000235464 159
67 3300006163 Ga0070715_10241043 Ga0070715_102410432 159
68 3300009093 Ga0105240_10209517 Ga0105240_102095172 159
69 3300009094 Ga0111539_11297666 Ga0111539_112976661 159
70 3300009551 Ga0105238_10536316 Ga0105238_105363162 159
71 3300009551 Ga0105238_11656540 Ga0105238_116565401 159
72 3300013102 Ga0157371_10641884 Ga0157371_106418842 159
73 3300013307 Ga0157372_11161394 Ga0157372_111613942 159
74 3300014326 Ga0157380_11751070 Ga0157380_117510702 159
75 3300025297 Ga0209758_1060326 Ga0209758_10603262 159
76 3300025303 Ga0209051_1000214 Ga0209051_100021441 159
77 3300025304 Ga0209257_1000015 Ga0209257_1000015352 159
78 3300025909 Ga0207705_10512415 Ga0207705_105124151 159
79 3300025918 Ga0207662_10019933 Ga0207662_100199335 159
80 3300025919 Ga0207657_10390324 Ga0207657_103903242 159
81 3300025924 Ga0207694_11159875 Ga0207694_111598752 159
82 3300025936 Ga0207670_10558884 Ga0207670_105588842 159
83 3300025945 Ga0207679_11306854 Ga0207679_113068542 159
84 3300025949 Ga0207667_10057212 Ga0207667_100572124 159
85 3300026035 Ga0207703_10199575 Ga0207703_101995752 159
86 3300026118 Ga0207675_100975473 Ga0207675_1009754732 159
87 3300026142 Ga0207698_10039089 Ga0207698_100390892 159
88 3300028380 Ga0268265_10187828 Ga0268265_101878282 159
89 3300031548 Ga0307408_100309014 Ga0307408_1003090142 159
90 3300031548 Ga0307408_100438436 Ga0307408_1004384362 159
91 3300031711 Ga0265314_10386385 Ga0265314_103863851 159
92 3300031712 Ga0265342_10268660 Ga0265342_102686602 159
93 3300031911 Ga0307412_10842322 Ga0307412_108423222 159
94 3300032002 Ga0307416_100343629 Ga0307416_1003436292 159
95 3300035092 Ga0373952_0000068 Ga0373952_0000068_3598_4077 159
96 3300035121 Ga0373960_0008558 Ga0373960_0008558_1448_1927 159
97 3300035207 Ga0373942_0092938 Ga0373942_0092938_102_581 159
98 3300037312 Ga0395899_0081755 Ga0395899_0081755_1035_1514 159
99 3300037418 Ga0395900_0012981 Ga0395900_0012981_6166_6645 159
100 3300037471 Ga0395905_0183233 Ga0395905_0183233_381_860 159
101 3300038443 Ga0395901_0045472 Ga0395901_0045472_2396_2875 159
102 3300044673 Ga0453683_0001138 Ga0453683_0001138_2239_2718 159
103 3300045051 Ga0451576_0056022 Ga0451576_0056022_586_1065 159
104 3300046539 Ga0495621_0236516 Ga0495621_0236516_116_595 159
105 3300048909 Ga0496106_0687088 Ga0496106_0687088_107_589 159
106 3300048911 Ga0496108_0600498 Ga0496108_0600498_139_621 159
107 3300049521 Ga0501298_116502 Ga0501298_116502_133_612 159
108 3300050493 nmdc:mga0k408_129982_c1 nmdc:mga0k408_129982_c1_516_995 159
109 3300002705 JGI25156J39149_1000024 JGI25156J39149_100002432 160
110 3300002738 JGI25154J39366_1000043 JGI25154J39366_100004333 160
111 3300002741 JGI25157J39369_1000031 JGI25157J39369_100003196 160
112 3300002774 JGI25150J39212_1001566 JGI25150J39212_10015662 160
113 3300002774 JGI25150J39212_1006954 JGI25150J39212_10069542 160
114 3300002987 JGI25159J45721_1001109 JGI25159J45721_10011099 160
115 3300002987 JGI25159J45721_1001763 JGI25159J45721_10017633 160
116 3300003187 JGI25151J46595_10010167 JGI25151J46595_100101673 160
117 3300003187 JGI25151J46595_10010989 JGI25151J46595_100109895 160
118 3300003215 JGI25153J46596_10112642 JGI25153J46596_101126421 160
119 3300003354 JGI25160J50197_1000136 JGI25160J50197_100013658 160
120 3300003374 JGI25161J50226_1000007 JGI25161J50226_1000007142 160
121 3300003771 Ga0055526_1000974 Ga0055526_10009743 160
122 3300003771 Ga0055526_1007304 Ga0055526_10073043 160
123 3300003773 Ga0055537_1000328 Ga0055537_10003288 160
124 3300003775 Ga0055524_1000101 Ga0055524_100010155 160
125 3300003784 Ga0055534_1003209 Ga0055534_10032094 160
126 3300003790 Ga0055528_1001455 Ga0055528_10014555 160
127 3300003791 Ga0055530_10000251 Ga0055530_1000025121 160
128 3300003792 Ga0055540_1000099 Ga0055540_100009932 160
129 3300003794 Ga0055531_10006848 Ga0055531_100068484 160
130 3300003794 Ga0055531_10060772 Ga0055531_100607722 160
131 3300004625 Ga0055543_1000061 Ga0055543_100006144 160
132 3300005262 Ga0065165_1023154 Ga0065165_10231543 160
133 3300005262 Ga0065165_1023574 Ga0065165_10235743 160
134 3300005262 Ga0065165_1025675 Ga0065165_10256751 160
135 3300005262 Ga0065165_1038683 Ga0065165_10386832 160
136 3300005295 Ga0065707_10055231 Ga0065707_100552312 160
137 3300005338 Ga0068868_100417363 Ga0068868_1004173632 160
138 3300005353 Ga0070669_101180242 Ga0070669_1011802421 160
139 3300005455 Ga0070663_100314147 Ga0070663_1003141472 160
140 3300005539 Ga0068853_100765809 Ga0068853_1007658092 160
141 3300005543 Ga0070672_100312086 Ga0070672_1003120862 160
142 3300005547 Ga0070693_100142524 Ga0070693_1001425242 160
143 3300005577 Ga0068857_100585434 Ga0068857_1005854342 160
144 3300005578 Ga0068854_100505831 Ga0068854_1005058312 160
145 3300005842 Ga0068858_100001525 Ga0068858_10000152510 160
146 3300006051 Ga0075364_10040327 Ga0075364_100403273 160
147 3300006177 Ga0075362_10017353 Ga0075362_100173532 160
148 3300006844 Ga0075428_101330001 Ga0075428_1013300012 160
149 3300006880 Ga0075429_100064566 Ga0075429_1000645662 160
150 3300006880 Ga0075429_100321718 Ga0075429_1003217182 160
151 3300009093 Ga0105240_10276867 Ga0105240_102768673 160
152 3300009094 Ga0111539_10045965 Ga0111539_100459655 160
153 3300009094 Ga0111539_10845274 Ga0111539_108452742 160
154 3300009098 Ga0105245_10101063 Ga0105245_101010632 160
155 3300009098 Ga0105245_11023073 Ga0105245_110230731 160
156 3300009174 Ga0105241_10290674 Ga0105241_102906742 160
157 3300009545 Ga0105237_10916448 Ga0105237_109164482 160
158 3300009551 Ga0105238_10111911 Ga0105238_101119112 160
159 3300012513 Ga0157326_1001292 Ga0157326_10012922 160
160 3300013104 Ga0157370_10115252 Ga0157370_101152523 160
161 3300013296 Ga0157374_10370875 Ga0157374_103708752 160
162 3300013306 Ga0163162_10008917 Ga0163162_100089174 160
163 3300013306 Ga0163162_10195313 Ga0163162_101953132 160
164 3300013308 Ga0157375_10068593 Ga0157375_100685931 160
165 3300014326 Ga0157380_10983332 Ga0157380_109833322 160
166 3300014968 Ga0157379_10281726 Ga0157379_102817262 160
167 3300017792 Ga0163161_10095375 Ga0163161_100953753 160
168 3300025206 Ga0209435_100008 Ga0209435_100008361 160
169 3300025245 Ga0207425_1004229 Ga0207425_10042296 160
170 3300025245 Ga0207425_1042346 Ga0207425_10423462 160
171 3300025246 Ga0209646_1000079 Ga0209646_100007984 160
172 3300025250 Ga0209026_1000067 Ga0209026_100006784 160
173 3300025256 Ga0209759_1000056 Ga0209759_100005684 160
174 3300025258 Ga0209129_1003959 Ga0209129_10039593 160
175 3300025263 Ga0209565_1000041 Ga0209565_100004183 160
176 3300025263 Ga0209565_1000538 Ga0209565_100053812 160
177 3300025263 Ga0209565_1037331 Ga0209565_10373312 160
178 3300025273 Ga0209673_1000012 Ga0209673_10000125 160
179 3300025284 Ga0209130_1000184 Ga0209130_10001845 160
180 3300025284 Ga0209130_1000694 Ga0209130_100069425 160
181 3300025291 Ga0209675_1000483 Ga0209675_100048325 160
182 3300025291 Ga0209675_1007475 Ga0209675_10074756 160
183 3300025292 Ga0209676_1000013 Ga0209676_1000013318 160
184 3300025292 Ga0209676_1008306 Ga0209676_10083064 160
185 3300025294 Ga0209025_1003216 Ga0209025_100321612 160
186 3300025294 Ga0209025_1005696 Ga0209025_10056965 160
187 3300025294 Ga0209025_1010418 Ga0209025_10104184 160
188 3300025294 Ga0209025_1042450 Ga0209025_10424502 160
189 3300025295 Ga0209564_1000363 Ga0209564_100036328 160
190 3300025295 Ga0209564_1002874 Ga0209564_10028748 160
191 3300025295 Ga0209564_1004933 Ga0209564_10049335 160
192 3300025297 Ga0209758_1018953 Ga0209758_10189533 160
193 3300025298 Ga0209050_1000008 Ga0209050_1000008318 160
194 3300025299 Ga0209256_1000003 Ga0209256_100000383 160
195 3300025302 Ga0207426_1000091 Ga0207426_100009177 160
196 3300025302 Ga0207426_1006716 Ga0207426_10067163 160
197 3300025303 Ga0209051_1000005 Ga0209051_1000005318 160
198 3300025304 Ga0209257_1000048 Ga0209257_1000048318 160
199 3300025304 Ga0209257_1007059 Ga0209257_10070595 160
200 3300025917 Ga0207660_11017765 Ga0207660_110177652 160
201 3300025922 Ga0207646_10511355 Ga0207646_105113552 160
202 3300025923 Ga0207681_11093449 Ga0207681_110934491 160
203 3300025927 Ga0207687_10836631 Ga0207687_108366312 160
204 3300025941 Ga0207711_10080858 Ga0207711_100808583 160
205 3300025949 Ga0207667_10193257 Ga0207667_101932572 160
206 3300026035 Ga0207703_10012756 Ga0207703_100127562 160
207 3300026041 Ga0207639_10792700 Ga0207639_107927002 160
208 3300026067 Ga0207678_10355725 Ga0207678_103557252 160
209 3300026089 Ga0207648_10050178 Ga0207648_100501781 160
210 3300026095 Ga0207676_10561131 Ga0207676_105611312 160
211 3300026116 Ga0207674_11215909 Ga0207674_112159091 160
212 3300027907 Ga0207428_10205016 Ga0207428_102050163 160
213 3300027907 Ga0207428_10342674 Ga0207428_103426742 160
214 3300028380 Ga0268265_10418215 Ga0268265_104182152 160
215 3300031548 Ga0307408_100015605 Ga0307408_1000156054 160
216 3300031548 Ga0307408_101324808 Ga0307408_1013248081 160
217 3300031901 Ga0307406_10009264 Ga0307406_100092644 160
218 3300031911 Ga0307412_10410907 Ga0307412_104109072 160
219 3300032004 Ga0307414_10541999 Ga0307414_105419992 160
220 3300037312 Ga0395899_0046182 Ga0395899_0046182_1907_2389 160
221 3300037418 Ga0395900_0071544 Ga0395900_0071544_260_742 160
222 3300037418 Ga0395900_1077296 Ga0395900_1077296_83_565 160
223 3300037418 Ga0395900_1714167 Ga0395900_1714167_16_513 160
224 3300037466 Ga0395898_0029810 Ga0395898_0029810_4095_4577 160
225 3300037466 Ga0395898_0273725 Ga0395898_0273725_1095_1592 160
226 3300037471 Ga0395905_0200002 Ga0395905_0200002_913_1398 160
227 3300037471 Ga0395905_0396133 Ga0395905_0396133_671_1153 160
228 3300037471 Ga0395905_0577481 Ga0395905_0577481_290_772 160
229 3300037471 Ga0395905_1392329 Ga0395905_1392329_80_565 160
230 3300041512 Ga0451853_2056391 Ga0451853_2056391_262_768 160
231 3300042008 Ga0439450_093439 Ga0439450_093439_79_561 160
232 3300042157 Ga0439458_0027508 Ga0439458_0027508_496_981 160
233 3300042439 Ga0439464_0090843 Ga0439464_0090843_79_564 160
234 3300042532 Ga0450893_0015748 Ga0450893_0015748_339_824 160
235 3300044673 Ga0453683_0353620 Ga0453683_0353620_355_846 160
236 3300046525 Ga0495663_0063992 Ga0495663_0063992_594_1076 160
237 3300046615 Ga0495656_0201648 Ga0495656_0201648_215_697 160
238 3300048090 Ga0495615_0022832 Ga0495615_0022832_560_1042 160
239 3300048911 Ga0496108_0209743 Ga0496108_0209743_1163_1648 160
240 3300049589 Ga0501073_0475238 Ga0501073_0475238_55_549 160
241 3300049823 Ga0501044_0087076 Ga0501044_0087076_2299_2784 160
242 3300049823 Ga0501044_0219577 Ga0501044_0219577_123_608 160
243 3300049823 Ga0501044_0673136 Ga0501044_0673136_92_577 160
244 3300050489 nmdc:mga03683_20453_c1 nmdc:mga03683_20453_c1_300_803 160
245 3300050491 nmdc:mga00v17_11069_c1 nmdc:mga00v17_11069_c1_927_1430 160
246 3300050496 nmdc:mga07m45_348364_c1 nmdc:mga07m45_348364_c1_220_702 160
247 3300050508 nmdc:mga09592_61657_c1 nmdc:mga09592_61657_c1_2304_2786 160
248 3300050509 nmdc:mga0qj67_372941_c1 nmdc:mga0qj67_372941_c1_204_689 160
249 3300050511 nmdc:mga08y16_8844_c1 nmdc:mga08y16_8844_c1_3290_3772 160
250 3300050511 nmdc:mga08y16_996035_c1 nmdc:mga08y16_996035_c1_323_808 160
251 3300053088 Ga0500644_0036175 Ga0500644_0036175_225_731 160
252 3300053094 Ga0500566_0083163 Ga0500566_0083163_890_1396 160
253 3300053117 Ga0500593_003703 Ga0500593_003703_752_1258 160
254 3300053129 Ga0500628_009199 Ga0500628_009199_847_1353 160
255 3300053730 Ga0500645_007508 Ga0500645_007508_752_1258 160
256 3300055283 Ga0500661_009467 Ga0500661_009467_102_608 160
257 iso_pu_bacteria 2511231002 2511245382 160
258 3300002075 JGI24738J21930_10045893 JGI24738J21930_100458931 161
259 3300005293 Ga0065715_10379789 Ga0065715_103797892 161
260 3300005327 Ga0070658_10026005 Ga0070658_100260056 161
261 3300005329 Ga0070683_100024175 Ga0070683_1000241752 161
262 3300005330 Ga0070690_100002268 Ga0070690_1000022688 161
263 3300005333 Ga0070677_10006728 Ga0070677_100067282 161
264 3300005334 Ga0068869_100002422 Ga0068869_1000024225 161
265 3300005337 Ga0070682_100105278 Ga0070682_1001052782 161
266 3300005338 Ga0068868_100000592 Ga0068868_1000005928 161
267 3300005338 Ga0068868_100014332 Ga0068868_1000143326 161
268 3300005338 Ga0068868_100030991 Ga0068868_1000309912 161
269 3300005340 Ga0070689_100000799 Ga0070689_10000079910 161
270 3300005341 Ga0070691_10004864 Ga0070691_100048646 161
271 3300005343 Ga0070687_100006818 Ga0070687_1000068186 161
272 3300005343 Ga0070687_100259025 Ga0070687_1002590252 161
273 3300005344 Ga0070661_100007365 Ga0070661_1000073658 161
274 3300005345 Ga0070692_10028668 Ga0070692_100286682 161
275 3300005345 Ga0070692_10085666 Ga0070692_100856662 161
276 3300005345 Ga0070692_10730658 Ga0070692_107306581 161
277 3300005354 Ga0070675_100002397 Ga0070675_10000239713 161
278 3300005355 Ga0070671_100301428 Ga0070671_1003014282 161
279 3300005356 Ga0070674_100020398 Ga0070674_1000203982 161
280 3300005356 Ga0070674_100046202 Ga0070674_1000462023 161
281 3300005356 Ga0070674_100161699 Ga0070674_1001616991 161
282 3300005364 Ga0070673_100002338 Ga0070673_10000233814 161
283 3300005366 Ga0070659_100016786 Ga0070659_1000167865 161
284 3300005367 Ga0070667_100084682 Ga0070667_1000846822 161
285 3300005441 Ga0070700_100000404 Ga0070700_1000004045 161
286 3300005444 Ga0070694_100039301 Ga0070694_1000393013 161
287 3300005456 Ga0070678_100006504 Ga0070678_1000065046 161
288 3300005457 Ga0070662_100195849 Ga0070662_1001958492 161
289 3300005459 Ga0068867_100009165 Ga0068867_1000091658 161
290 3300005467 Ga0070706_100652481 Ga0070706_1006524812 161
291 3300005535 Ga0070684_100011119 Ga0070684_1000111194 161
292 3300005539 Ga0068853_100115691 Ga0068853_1001156913 161
293 3300005543 Ga0070672_100000490 Ga0070672_1000004908 161
294 3300005544 Ga0070686_100000720 Ga0070686_10000072017 161
295 3300005544 Ga0070686_100274182 Ga0070686_1002741822 161
296 3300005545 Ga0070695_100022764 Ga0070695_1000227644 161
297 3300005546 Ga0070696_100003412 Ga0070696_1000034126 161
298 3300005547 Ga0070693_100086263 Ga0070693_1000862632 161
299 3300005548 Ga0070665_100615228 Ga0070665_1006152282 161
300 3300005549 Ga0070704_100013326 Ga0070704_1000133262 161
301 3300005549 Ga0070704_100043197 Ga0070704_1000431975 161
302 3300005549 Ga0070704_100205481 Ga0070704_1002054812 161
303 3300005564 Ga0070664_100001675 Ga0070664_10000167521 161
304 3300005578 Ga0068854_100060150 Ga0068854_1000601503 161
305 3300005615 Ga0070702_100000509 Ga0070702_1000005096 161
306 3300005615 Ga0070702_100130286 Ga0070702_1001302862 161
307 3300005616 Ga0068852_100000601 Ga0068852_10000060121 161
308 3300005617 Ga0068859_100011018 Ga0068859_1000110186 161
309 3300005618 Ga0068864_100001478 Ga0068864_10000147820 161
310 3300005718 Ga0068866_10002328 Ga0068866_100023284 161
311 3300005719 Ga0068861_100002624 Ga0068861_1000026249 161
312 3300005834 Ga0068851_10000354 Ga0068851_1000035410 161
313 3300005840 Ga0068870_10035983 Ga0068870_100359832 161
314 3300005840 Ga0068870_10127774 Ga0068870_101277741 161
315 3300005841 Ga0068863_100106141 Ga0068863_1001061413 161
316 3300005842 Ga0068858_100002133 Ga0068858_10000213316 161
317 3300005843 Ga0068860_100577734 Ga0068860_1005777342 161
318 3300005844 Ga0068862_100025756 Ga0068862_1000257564 161
319 3300006177 Ga0075362_10184548 Ga0075362_101845483 161
320 3300006237 Ga0097621_100001954 Ga0097621_1000019544 161
321 3300006237 Ga0097621_100285351 Ga0097621_1002853512 161
322 3300006353 Ga0075370_10132588 Ga0075370_101325882 161
323 3300006358 Ga0068871_100005743 Ga0068871_1000057433 161
324 3300006358 Ga0068871_100007697 Ga0068871_1000076975 161
325 3300006881 Ga0068865_100000330 Ga0068865_10000033024 161
326 3300006931 Ga0097620_100011018 Ga0097620_1000110186 161
327 3300007076 Ga0075435_100954252 Ga0075435_1009542522 161
328 3300009098 Ga0105245_10001144 Ga0105245_1000114420 161
329 3300009148 Ga0105243_10001169 Ga0105243_100011698 161
330 3300009177 Ga0105248_10029735 Ga0105248_100297356 161
331 3300009551 Ga0105238_10645688 Ga0105238_106456882 161
332 3300009553 Ga0105249_10448723 Ga0105249_104487232 161
333 3300011119 Ga0105246_10080809 Ga0105246_100808092 161
334 3300013296 Ga0157374_10001018 Ga0157374_1000101822 161
335 3300013297 Ga0157378_10000735 Ga0157378_1000073512 161
336 3300013297 Ga0157378_10018149 Ga0157378_100181496 161
337 3300013306 Ga0163162_10023130 Ga0163162_100231302 161
338 3300013308 Ga0157375_10006920 Ga0157375_100069208 161
339 3300014326 Ga0157380_10024183 Ga0157380_100241835 161
340 3300014968 Ga0157379_10018443 Ga0157379_100184435 161
341 3300014969 Ga0157376_10003512 Ga0157376_100035127 161
342 3300025321 Ga0207656_10001618 Ga0207656_100016184 161
343 3300025899 Ga0207642_10002085 Ga0207642_100020857 161
344 3300025908 Ga0207643_10025203 Ga0207643_100252032 161
345 3300025917 Ga0207660_10456157 Ga0207660_104561572 161
346 3300025918 Ga0207662_10265350 Ga0207662_102653502 161
347 3300025920 Ga0207649_10011610 Ga0207649_100116106 161
348 3300025925 Ga0207650_10010622 Ga0207650_100106229 161
349 3300025926 Ga0207659_10011275 Ga0207659_100112753 161
350 3300025927 Ga0207687_10000379 Ga0207687_1000037921 161
351 3300025931 Ga0207644_10003090 Ga0207644_100030903 161
352 3300025932 Ga0207690_10333098 Ga0207690_103330982 161
353 3300025934 Ga0207686_10000979 Ga0207686_100009796 161
354 3300025935 Ga0207709_10005308 Ga0207709_100053087 161
355 3300025936 Ga0207670_10005740 Ga0207670_100057405 161
356 3300025937 Ga0207669_10114233 Ga0207669_101142331 161
357 3300025938 Ga0207704_10000270 Ga0207704_1000027021 161
358 3300025938 Ga0207704_10159176 Ga0207704_101591762 161
359 3300025940 Ga0207691_10000634 Ga0207691_100006348 161
360 3300025941 Ga0207711_10223186 Ga0207711_102231861 161
361 3300025942 Ga0207689_10000775 Ga0207689_1000077521 161
362 3300025944 Ga0207661_10020839 Ga0207661_100208396 161
363 3300025945 Ga0207679_10000987 Ga0207679_100009878 161
364 3300025960 Ga0207651_10005207 Ga0207651_100052078 161
365 3300025961 Ga0207712_10276591 Ga0207712_102765911 161
366 3300025981 Ga0207640_10005693 Ga0207640_100056938 161
367 3300025986 Ga0207658_10057921 Ga0207658_100579212 161
368 3300026023 Ga0207677_10000896 Ga0207677_100008968 161
369 3300026023 Ga0207677_10294905 Ga0207677_102949052 161
370 3300026035 Ga0207703_10014007 Ga0207703_100140076 161
371 3300026075 Ga0207708_10000049 Ga0207708_1000004983 161
372 3300026088 Ga0207641_10087372 Ga0207641_100873723 161
373 3300026089 Ga0207648_10000161 Ga0207648_1000016116 161
374 3300026089 Ga0207648_10032289 Ga0207648_100322896 161
375 3300026095 Ga0207676_10002832 Ga0207676_1000283216 161
376 3300026118 Ga0207675_100002263 Ga0207675_1000022639 161
377 3300026121 Ga0207683_10000831 Ga0207683_1000083127 161
378 3300026121 Ga0207683_10064985 Ga0207683_100649852 161
379 3300026142 Ga0207698_10000439 Ga0207698_1000043920 161
380 3300028381 Ga0268264_10517319 Ga0268264_105173192 161
381 3300028794 Ga0307515_10000751 Ga0307515_1000075133 161
382 3300031456 Ga0307513_10000013 Ga0307513_10000013161 161
383 3300031456 Ga0307513_10000130 Ga0307513_1000013032 161
384 3300031456 Ga0307513_10118072 Ga0307513_101180723 161
385 3300031649 Ga0307514_10000763 Ga0307514_1000076318 161
386 3300032002 Ga0307416_101714614 Ga0307416_1017146142 161
387 3300033180 Ga0307510_10086836 Ga0307510_100868364 161
388 3300035088 Ga0373940_0063568 Ga0373940_0063568_499_1050 161
389 3300039447 Ga0436361_0039286 Ga0436361_0039286_6603_7103 161
390 3300039447 Ga0436361_0158828 Ga0436361_0158828_1340_1840 161
391 3300041452 Ga0451793_0153404 Ga0451793_0153404_61_564 161
392 3300041453 Ga0451797_0825067 Ga0451797_0825067_70_567 161
393 3300041456 Ga0451795_1338211 Ga0451795_1338211_184_687 161
394 3300041486 Ga0451807_2226608 Ga0451807_2226608_167_652 161
395 3300041501 Ga0451845_0764397 Ga0451845_0764397_48_551 161
396 3300042876 Ga0451577_0627905 Ga0451577_0627905_188_715 161
397 3300044656 Ga0466969_0003247 Ga0466969_0003247_4425_4928 161
398 3300044683 Ga0466965_0024604 Ga0466965_0024604_1385_1888 161
399 3300044693 Ga0466961_0000187 Ga0466961_0000187_27271_27774 161
400 3300044693 Ga0466961_0535281 Ga0466961_0535281_56_544 161
401 3300044706 Ga0466964_0102263 Ga0466964_0102263_402_905 161
402 3300044712 Ga0453684_0136671 Ga0453684_0136671_822_1334 161
403 3300044712 Ga0453684_0342383 Ga0453684_0342383_18_533 161
404 3300045049 Ga0466959_0238626 Ga0466959_0238626_98_601 161
405 3300048911 Ga0496108_0824960 Ga0496108_0824960_244_729 161
406 3300048912 Ga0496109_0023684 Ga0496109_0023684_2910_3395 161
407 3300048913 Ga0496110_0007264 Ga0496110_0007264_4289_4774 161
408 3300048914 Ga0496111_0016401 Ga0496111_0016401_4276_4761 161
409 3300048917 Ga0496114_0012721 Ga0496114_0012721_1080_1565 161
410 3300050489 nmdc:mga03683_103773_c1 nmdc:mga03683_103773_c1_151_654 161
411 3300050496 nmdc:mga07m45_97242_c2 nmdc:mga07m45_97242_c2_387_890 161
412 3300050512 nmdc:mga0n895_207369_c1 nmdc:mga0n895_207369_c1_615_1166 161
413 3300050513 nmdc:mga0rr50_530232_c1 nmdc:mga0rr50_530232_c1_425_976 161
414 3300053730 Ga0500645_000699 Ga0500645_000699_7873_8379 161
415 3300053730 Ga0500645_002996 Ga0500645_002996_3438_3947 161
416 iso_pu_bacteria 2881101125 2881104389 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

33

162

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.9476 5 145
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.9348 5 145
5x9q-assembly1.cif.gz_B crystal structure of hldc from burkholderia pseudomallei 0.886 5 160
5x9q-assembly1.cif.gz_B crystal structure of hldc from burkholderia pseudomallei 0.8703 5 160
2b7l-assembly2.cif.gz_D crystal structure of ctp:glycerol-3-phosphate cytidylyltransferase from staphylococcus aureus 0.8655 28 144
ID Description Score Start End Superfamily
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9354 11 160 3.40.50.620
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8899 11 160 3.40.50.620
2b7lD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8655 28 144 3.40.50.620
1cozA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8521 28 157 3.40.50.620
2b7lD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8376 28 144 3.40.50.620
ID Description Score Start End GO Terms
AF-T1BDM0-F1-model_v4 Cytidylyltransferase domain protein (EC 2.7.-.-) 0.9917 30 118 GO:0009058
GO:0016779
AF-A0A259RR08-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase 0.987 5 100 GO:0009058
GO:0016779
AF-T1DC56-F1-model_v4 ADP-heptose synthase 0.9846 1 110 GO:0003824
GO:0009058
AF-A0A353Y5X2-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase 0.9791 1 145 GO:0009058
GO:0016779
AF-A0A259RR08-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase 0.9769 5 100 GO:0009058
GO:0016779

Feature Viewer

pLDDT pTM Quality
91.75 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map