metagRoot

F438435

General Info

Members	Datasets	Scaffolds	Average Seq Length
414	258	396	254

Family's Representative Sequence

Representative Sequence	3300049581\|Ga0501047_0088318\|Ga0501047_0088318_1545_2306
Length	244
Sequence	MSEDVQETFLSHLIELRTRLVRSLLAVGVAAIPMLYFSSELYDLLAMPLIHSLPQGSRMIATGVITPFLIPMKIAVMAAFIVALPYVLYQAWAFVAPGLYSHEKRLALPLVVSSTLLFVVGMLFCYFVVFRKVFAFIAHFAPKSISVAPDIEAYFNFVLGMFLAFGLAFEVPVVVVVLVISGLVTVEQLREWRGYVVVTPPDVVSQISLALPMCLLYEAGIVFAQLAARRRKPDPLEEGRGEEA

Samples

	Sample ID	Description	Type	Environment
1	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
2	2643221569	Achromobacter sp. Root565	Isolate	Unclassified
3	2643221594	Achromobacter sp. Root170	Isolate	Unclassified
4	2643221603	Noviherbaspirillum sp. Root189	Isolate	Unclassified
5	2643221621	Achromobacter sp. Root83	Isolate	Unclassified
6	2739367655	Pusillimonas sp. YR330	Isolate	Unclassified
7	2808606395	Achromobacter sp. SLBN-14	Isolate	Unclassified
8	2855730933	Achromobacter sp. HZ28	Isolate	Nodule
9	2855767633	Achromobacter sp. HZ34	Isolate	Nodule
10	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
11	2857542790	Achromobacter sp. R-72367	Isolate	Unclassified
12	2858950400	Achromobacter sp. K91	Isolate	Unclassified
13	2881412998	Achromobacter aloeverae AVA-1	Isolate	Unclassified
14	2881927736	Candidimonas sp. SYP-B2681	Isolate	Rhizosphere
15	2895511927	Pseudoxanthomonas sp. SGD-5-1	Isolate	Rhizosphere
16	2941479691
17	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
18	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
19	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
20	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
21	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
22	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
23	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
24	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
25	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
26	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
27	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
28	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
29	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
30	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
31	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
32	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
33	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
34	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
35	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
36	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
37	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
38	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
39	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
40	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
41	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
42	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
43	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
44	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
45	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
46	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
47	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
48	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
49	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
50	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
51	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
52	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
53	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
54	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
55	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
56	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
57	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
58	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
59	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
60	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
61	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
62	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
63	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
64	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
65	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
66	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
68	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
69	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
70	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
72	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
73	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
74	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
75	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
76	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
77	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
78	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
79	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
80	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
81	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
82	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
83	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
84	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
85	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
86	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
87	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
88	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
89	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
90	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
91	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
136	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
138	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
139	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
140	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
141	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
142	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
143	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
144	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
145	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
146	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
147	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
148	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
149	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
150	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
151	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
152	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
153	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
154	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
155	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
156	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
157	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
158	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
159	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
160	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
161	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
162	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
163	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
164	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
165	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
166	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
167	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
168	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
169	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
170	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
171	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
172	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
173	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
174	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
175	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
176	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
177	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
178	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
179	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
180	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
181	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
182	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
183	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
184	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
185	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
186	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
187	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
188	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
189	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
190	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
191	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
192	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
193	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
194	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
195	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
196	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
197	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
198	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
199	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
200	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
201	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
202	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
203	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
204	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
205	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
206	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
207	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
208	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
209	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
210	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
211	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
212	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
213	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
214	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
215	3300049522	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control	Metagenome	Rhizosphere
216	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
217	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
220	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
221	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
222	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
223	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
224	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
225	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
226	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
227	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
228	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
229	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
230	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
231	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
232	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
233	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
234	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
235	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
236	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
237	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
238	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
239	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
240	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
241	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
242	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
243	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
244	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
245	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
246	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
247	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
248	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
249	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
250	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
251	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
252	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
253	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
254	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
255	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
256	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
257	8002392321	Alcaligenes faecalis Mc250	Isolate	Rhizosphere
258	8048746797	Alcaligenes endophyticus DSM 100498	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	95.65
Metatranscriptomes	0
Isolates	4.35

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.14
Nodule	0.48
Rhizoplane	1.69
Rhizosphere	86.47
Stem	0
Stem Tuber	0
Unclassified	8.21

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25151J46595_10000121	3300003187	Bacteria	106308
2	Ga0065707_10133595	3300005295	Bacteria	1879
3	Ga0070690_100273902	3300005330	Bacteria	1202
4	Ga0070680_100108562	3300005336	Bacteria	2309
5	Ga0070680_100156632	3300005336	Bacteria	1914
6	Ga0070691_10070659	3300005341	Bacteria	1693
7	Ga0070692_10005338	3300005345	Bacteria	5466
8	Ga0070692_10049161	3300005345	Bacteria	2187
9	Ga0070668_100032982	3300005347	Bacteria	3942
10	Ga0070669_100013450	3300005353	Bacteria	5817
11	Ga0070671_100347337	3300005355	Bacteria	1266
12	Ga0070673_100192733	3300005364	Bacteria	1751
13	Ga0070688_100014595	3300005365	Bacteria	4454
14	Ga0070714_100162681	3300005435	Bacteria	2020
15	Ga0070713_100273337	3300005436	Bacteria	1548
16	Ga0070701_10092455	3300005438	Bacteria	1660
17	Ga0070705_100011800	3300005440	Bacteria	4422
18	Ga0070705_100092270	3300005440	Bacteria	1890
19	Ga0070705_100131972	3300005440	Bacteria	1631
20	Ga0070700_100002243	3300005441	Bacteria	9838
21	Ga0070700_100226574	3300005441	Bacteria	1328
22	Ga0070694_100027416	3300005444	Bacteria	3699
23	Ga0070694_100071167	3300005444	Bacteria	2397
24	Ga0070694_100150449	3300005444	Bacteria	1699
25	Ga0070681_10000081	3300005458	Bacteria	71809
26	Ga0070706_100604159	3300005467	Bacteria	1019
27	Ga0070698_100004625	3300005471	Bacteria	15121
28	Ga0070699_100008120	3300005518	Bacteria	9115
29	Ga0070699_100026431	3300005518	Bacteria	5005
30	Ga0070684_100037235	3300005535	Bacteria	4172
31	Ga0070697_100000299	3300005536	Bacteria	39638
32	Ga0070697_100001557	3300005536	Bacteria	17448
33	Ga0070672_100049380	3300005543	Bacteria	3273
34	Ga0070686_100008570	3300005544	Bacteria	5729
35	Ga0070686_100195935	3300005544	Bacteria	1445
36	Ga0070695_100001505	3300005545	Bacteria	12926
37	Ga0070695_100140378	3300005545	Bacteria	1675
38	Ga0070696_100005214	3300005546	Bacteria	8687
39	Ga0070696_100107821	3300005546	Bacteria	2003
40	Ga0070704_100082967	3300005549	Bacteria	2365
41	Ga0070704_100094376	3300005549	Bacteria	2238
42	Ga0070704_100511488	3300005549	Bacteria	1044
43	Ga0068854_100084875	3300005578	Bacteria	2344
44	Ga0070702_100019072	3300005615	Bacteria	3569
45	Ga0068859_100030833	3300005617	Bacteria	5381
46	Ga0068859_100077059	3300005617	Bacteria	3375
47	Ga0068859_100365204	3300005617	Bacteria	1539
48	Ga0068859_100654246	3300005617	Bacteria	1143
49	Ga0068861_100042570	3300005719	Bacteria	3404
50	Ga0068861_100123837	3300005719	Bacteria	2089
51	Ga0068851_10000833	3300005834	Bacteria	13285
52	Ga0068870_10105949	3300005840	Bacteria	1597
53	Ga0068863_100077785	3300005841	Bacteria	3140
54	Ga0068858_100089947	3300005842	Bacteria	2856
55	Ga0068858_100266925	3300005842	Bacteria	1628
56	Ga0068862_100006958	3300005844	Bacteria	9385
57	Ga0081539_10004782	3300005985	Bacteria	14603
58	Ga0075364_10000064	3300006051	Bacteria	40534
59	Ga0075364_10119128	3300006051	Bacteria	1766
60	Ga0075364_10234931	3300006051	Bacteria	1245
61	Ga0097621_100000756	3300006237	Bacteria	22691
62	Ga0097621_100009154	3300006237	Bacteria	7180
63	Ga0097621_100059983	3300006237	Bacteria	3117
64	Ga0068871_100000588	3300006358	Bacteria	24949
65	Ga0068871_100020785	3300006358	Bacteria	5034
66	Ga0068871_100110605	3300006358	Bacteria	2311
67	Ga0075428_100000183	3300006844	Bacteria	58831
68	Ga0075428_100013956	3300006844	Bacteria	8945
69	Ga0075428_100125731	3300006844	Bacteria	2790
70	Ga0075428_100497743	3300006844	Bacteria	1304
71	Ga0075430_100044517	3300006846	Bacteria	3752
72	Ga0075430_100051971	3300006846	Bacteria	3451
73	Ga0075430_100094969	3300006846	Bacteria	2492
74	Ga0075430_100134450	3300006846	Bacteria	2061
75	Ga0075430_100545153	3300006846	Bacteria	957
76	Ga0075431_100020329	3300006847	Bacteria	6782
77	Ga0075431_100126308	3300006847	Bacteria	2639
78	Ga0075433_10020641	3300006852	Bacteria	5513
79	Ga0075433_10288450	3300006852	Bacteria	1454
80	Ga0075434_100545125	3300006871	Bacteria	1180
81	Ga0075429_100000100	3300006880	Bacteria	47693
82	Ga0075429_100000891	3300006880	Bacteria	23613
83	Ga0075429_100023534	3300006880	Bacteria	5346
84	Ga0075429_100107458	3300006880	Bacteria	2438
85	Ga0075429_100235862	3300006880	Bacteria	1602
86	Ga0068865_100003408	3300006881	Bacteria	9515
87	Ga0068865_100195513	3300006881	Bacteria	1567
88	Ga0075436_100000529	3300006914	Bacteria	24848
89	Ga0075436_100097782	3300006914	Bacteria	2042
90	Ga0075436_100187270	3300006914	Bacteria	1464
91	Ga0075436_100227222	3300006914	Bacteria	1325
92	Ga0097620_100030834	3300006931	Bacteria	5381
93	Ga0097620_100077057	3300006931	Bacteria	3375
94	Ga0097620_100365175	3300006931	Bacteria	1539
95	Ga0097620_100654288	3300006931	Bacteria	1143
96	Ga0075435_100009301	3300007076	Bacteria	7103
97	Ga0075435_100049195	3300007076	Bacteria	3389
98	Ga0075435_100049567	3300007076	Bacteria	3378
99	Ga0099794_10007992	3300007265	Bacteria	4375
100	Ga0105240_10250742	3300009093	Bacteria	2047
101	Ga0111539_10013498	3300009094	Bacteria	10209
102	Ga0111539_10026296	3300009094	Bacteria	7118
103	Ga0111539_10036478	3300009094	Bacteria	5944
104	Ga0105245_10034272	3300009098	Bacteria	4503
105	Ga0114129_10000219	3300009147	Bacteria	63579
106	Ga0114129_10011817	3300009147	Bacteria	12420
107	Ga0114129_10059094	3300009147	Bacteria	5361
108	Ga0114129_10105488	3300009147	Bacteria	3894
109	Ga0105243_10142327	3300009148	Bacteria	2048
110	Ga0105243_10176224	3300009148	Bacteria	1856
111	Ga0105242_10035256	3300009176	Bacteria	4012
112	Ga0105248_10127952	3300009177	Bacteria	2866
113	Ga0105249_10344341	3300009553	Bacteria	1508
114	Ga0105249_10553725	3300009553	Bacteria	1201
115	Ga0099796_10148697	3300010159	Bacteria	921
116	Ga0105239_10445947	3300010375	Bacteria	1468
117	Ga0157370_10316779	3300013104	Bacteria	1439
118	Ga0157374_10044742	3300013296	Bacteria	4093
119	Ga0163162_10053995	3300013306	Bacteria	4040
120	Ga0157372_10673196	3300013307	Bacteria	1205
121	Ga0157375_10164416	3300013308	Bacteria	2363
122	Ga0157380_10023431	3300014326	Bacteria	4657
123	Ga0157379_10030332	3300014968	Bacteria	4813
124	Ga0157376_10037458	3300014969	Bacteria	3937
125	Ga0157376_10179948	3300014969	Bacteria	1932
126	Ga0163161_10139874	3300017792	Bacteria	1832
127	Ga0209676_1023281	3300025292	Bacteria	2030
128	Ga0209025_1000019	3300025294	Bacteria	631548
129	Ga0209050_1003191	3300025298	Bacteria	12417
130	Ga0207656_10000625	3300025321	Bacteria	11589
131	Ga0207682_10117830	3300025893	Bacteria	1175
132	Ga0207685_10023931	3300025905	Bacteria	2086
133	Ga0207643_10084029	3300025908	Bacteria	1848
134	Ga0207705_10010384	3300025909	Bacteria	6771
135	Ga0207707_10007590	3300025912	Bacteria	9451
136	Ga0207695_10208927	3300025913	Bacteria	1864
137	Ga0207660_10071075	3300025917	Bacteria	2531
138	Ga0207660_10118931	3300025917	Bacteria	1999
139	Ga0207660_10142174	3300025917	Bacteria	1835
140	Ga0207660_10548921	3300025917	Bacteria	940
141	Ga0207662_10011539	3300025918	Bacteria	4905
142	Ga0207662_10065746	3300025918	Bacteria	2184
143	Ga0207652_10024822	3300025921	Bacteria	4975
144	Ga0207652_10351510	3300025921	Bacteria	1330
145	Ga0207681_10002005	3300025923	Bacteria	13073
146	Ga0207694_10143668	3300025924	Bacteria	1920
147	Ga0207659_10039287	3300025926	Bacteria	3299
148	Ga0207687_10053211	3300025927	Bacteria	2827
149	Ga0207700_10211200	3300025928	Bacteria	1641
150	Ga0207664_10142962	3300025929	Bacteria	2026
151	Ga0207706_10044590	3300025933	Bacteria	3930
152	Ga0207709_10467383	3300025935	Bacteria	978
153	Ga0207669_10328419	3300025937	Bacteria	1173
154	Ga0207704_10016097	3300025938	Bacteria	3833
155	Ga0207711_10098403	3300025941	Bacteria	2585
156	Ga0207651_10042207	3300025960	Bacteria	3034
157	Ga0207712_10246126	3300025961	Bacteria	1443
158	Ga0207712_10346697	3300025961	Bacteria	1233
159	Ga0207712_10481635	3300025961	Bacteria	1058
160	Ga0207668_10057398	3300025972	Bacteria	2715
161	Ga0207677_10035966	3300026023	Bacteria	3222
162	Ga0207703_10032118	3300026035	Bacteria	4155
163	Ga0207703_10215073	3300026035	Bacteria	1716
164	Ga0207641_10292724	3300026088	Bacteria	1535
165	Ga0207648_10140371	3300026089	Bacteria	2129
166	Ga0207676_10502823	3300026095	Bacteria	1151
167	Ga0207676_10935343	3300026095	Bacteria	852
168	Ga0207683_10157241	3300026121	Bacteria	2054
169	Ga0207698_10001438	3300026142	Bacteria	13837
170	Ga0209969_1001356	3300027360	Bacteria	3362
171	Ga0209967_1001553	3300027364	Bacteria	2938
172	Ga0209967_1016929	3300027364	Bacteria	1049
173	Ga0209981_1006671	3300027378	Bacteria	1547
174	Ga0209996_1001620	3300027395	Bacteria	2736
175	Ga0209984_1001105	3300027424	Bacteria	2885
176	Ga0210000_1000210	3300027462	Bacteria	8428
177	Ga0210000_1002454	3300027462	Bacteria	2639
178	Ga0210000_1003595	3300027462	Bacteria	2235
179	Ga0210000_1006821	3300027462	Bacteria	1665
180	Ga0209995_1005371	3300027471	Bacteria	2058
181	Ga0209999_1001050	3300027543	Bacteria	4698
182	Ga0209999_1008885	3300027543	Bacteria	1817
183	Ga0209999_1012064	3300027543	Bacteria	1563
184	Ga0209982_1010324	3300027552	Bacteria	1383
185	Ga0209983_1001989	3300027665	Bacteria	4527
186	Ga0209588_1056789	3300027671	Bacteria	1265
187	Ga0209971_1003692	3300027682	Bacteria	3629
188	Ga0209971_1024654	3300027682	Bacteria	1436
189	Ga0209974_10001114	3300027876	Bacteria	9526
190	Ga0209974_10051481	3300027876	Bacteria	1385
191	Ga0207428_10000290	3300027907	Bacteria	67367
192	Ga0207428_10040931	3300027907	Bacteria	3753
193	Ga0207428_10196146	3300027907	Bacteria	1520
194	Ga0268265_10001159	3300028380	Bacteria	23174
195	Ga0268256_1012950	3300030500	Bacteria	2555
196	Ga0265332_10027925	3300031238	Bacteria	2471
197	Ga0265325_10004810	3300031241	Bacteria	8457
198	Ga0265327_10112271	3300031251	Bacteria	1301
199	Ga0307413_10502678	3300031824	Bacteria	974
200	Ga0307407_10244981	3300031903	Bacteria	1225
201	Ga0307412_10000061	3300031911	Bacteria	126274
202	Ga0307409_100296834	3300031995	Bacteria	1501
203	Ga0307416_100092186	3300032002	Bacteria	2605
204	Ga0307416_100092901	3300032002	Bacteria	2597
205	Ga0307416_100767862	3300032002	Bacteria	1058
206	Ga0307414_10437160	3300032004	Bacteria	1144
207	Ga0307411_10031659	3300032005	Bacteria	3258
208	Ga0307411_10046102	3300032005	Bacteria	2808
209	Ga0307411_10499667	3300032005	Bacteria	1028
210	Ga0373930_0014567	3300034816	Bacteria	1466
211	Ga0373958_0003585	3300034819	Bacteria	2248
212	Ga0373938_0023739	3300034957	Bacteria	1263
213	Ga0373928_0005331	3300035084	Bacteria	2456
214	Ga0373940_0004250	3300035088	Bacteria	3014
215	Ga0373949_0004756	3300035090	Bacteria	3080
216	Ga0373951_0002954	3300035091	Bacteria	4212
217	Ga0373932_0085689	3300035112	Bacteria	1003
218	Ga0373939_0000708	3300035114	Bacteria	8264
219	Ga0373954_0001511	3300035118	Bacteria	9463
220	Ga0373960_0014302	3300035121	Bacteria	2008
221	Ga0373960_0045736	3300035121	Bacteria	1282
222	Ga0373955_0121987	3300035172	Bacteria	1516
223	Ga0373961_0063503	3300035241	Bacteria	1127
224	Ga0373962_0003882	3300035242	Bacteria	3599
225	Ga0373924_0008802	3300035410	Bacteria	3681
226	Ga0373931_0000163	3300035691	Bacteria	29108
227	Ga0373931_0055750	3300035691	Bacteria	2116
228	Ga0373931_0080069	3300035691	Bacteria	1801
229	Ga0373927_0139199	3300035695	Bacteria	1587
230	Ga0373933_0015390	3300035724	Bacteria	4262
231	Ga0373933_0018495	3300035724	Bacteria	3919
232	Ga0373947_0116077	3300035725	Bacteria	1697
233	Ga0373937_0001313	3300036401	Bacteria	20818
234	Ga0373925_0052630	3300037068	Bacteria	3042
235	Ga0395901_0335275	3300038443	Bacteria	1563
236	Ga0439461_0020111	3300041410	Bacteria	1319
237	Ga0451807_2313531	3300041486	Bacteria	1206
238	Ga0439441_000165	3300042001	Bacteria	5856
239	Ga0439441_000219	3300042001	Bacteria	5405
240	Ga0439443_018648	3300042003	Bacteria	1076
241	Ga0439446_0023901	3300042156	Bacteria	1740
242	Ga0439434_0000867	3300042435	Bacteria	8710
243	Ga0439435_0003221	3300042436	Bacteria	3365
244	Ga0439435_0007268	3300042436	Bacteria	2526
245	Ga0439444_0003897	3300042437	Bacteria	2135
246	Ga0439460_0011350	3300042461	Bacteria	2296
247	Ga0439460_0014304	3300042461	Bacteria	2085
248	Ga0451577_0928976	3300042876	Bacteria	783
249	Ga0466965_0061580	3300044683	Bacteria	1876
250	Ga0466964_0021097	3300044706	Bacteria	2516
251	Ga0466968_0003792	3300044735	Bacteria	5604
252	Ga0466960_0151860	3300044901	Bacteria	1238
253	Ga0466960_0194322	3300044901	Bacteria	1106
254	Ga0451576_0008931	3300045051	Bacteria	11690
255	Ga0451576_0060969	3300045051	Bacteria	3934
256	Ga0451576_0630909	3300045051	Bacteria	1126
257	Ga0466967_0008116	3300045976	Bacteria	7660
258	Ga0495592_0009689	3300046454	Bacteria	7252
259	Ga0495651_0292504	3300046462	Bacteria	1096
260	Ga0495651_0310862	3300046462	Bacteria	1054
261	Ga0495608_0049424	3300046511	Bacteria	2792
262	Ga0495642_0056824	3300046528	Bacteria	1617
263	Ga0495652_0034277	3300046529	Bacteria	4426
264	Ga0495587_0004310	3300046536	Bacteria	9395
265	Ga0495621_0110822	3300046539	Bacteria	1052
266	Ga0495645_0001792	3300046543	Bacteria	14572
267	Ga0495656_0002639	3300046615	Bacteria	5979
268	Ga0495599_0021214	3300046678	Bacteria	4051
269	Ga0495669_0016877	3300046684	Bacteria	3131
270	Ga0495670_0138426	3300046691	Bacteria	1272
271	Ga0495600_0029976	3300046809	Bacteria	3524
272	Ga0495636_0050535	3300047318	Bacteria	1740
273	Ga0496104_0049379	3300048907	Bacteria	3968
274	Ga0496105_0115361	3300048908	Bacteria	2216
275	Ga0496108_0374691	3300048911	Bacteria	1243
276	Ga0496111_0110683	3300048914	Bacteria	2022
277	Ga0496114_0092830	3300048917	Bacteria	2565
278	Ga0496116_0017099	3300048919	Bacteria	5647
279	Ga0496116_0024041	3300048919	Bacteria	4517
280	Ga0496116_0061621	3300048919	Bacteria	2427
281	Ga0496117_0016615	3300048920	Bacteria	6197
282	Ga0496118_0089007	3300048921	Bacteria	2133
283	Ga0496118_0111302	3300048921	Bacteria	1815
284	Ga0496119_0004847	3300048922	Bacteria	13183
285	Ga0496121_0000647	3300048924	Bacteria	65033
286	Ga0496121_0027846	3300048924	Bacteria	5278
287	Ga0496121_0038081	3300048924	Bacteria	4265
288	Ga0496121_0141337	3300048924	Bacteria	1785
289	Ga0496122_0025049	3300048925	Bacteria	5198
290	Ga0496123_0000730	3300048926	Bacteria	53397
291	Ga0496123_0060893	3300048926	Bacteria	2430
292	Ga0496124_0000013	3300048927	Bacteria	484884
293	Ga0496124_0070477	3300048927	Bacteria	2899
294	Ga0496124_0116487	3300048927	Bacteria	2142
295	Ga0496124_0143613	3300048927	Bacteria	1880
296	Ga0496125_0000051	3300048928	Bacteria	285754
297	Ga0496125_0039846	3300048928	Bacteria	4038
298	Ga0496126_0153612	3300048929	Bacteria	1971
299	Ga0496126_0303118	3300048929	Bacteria	1317
300	Ga0501299_019360	3300049522	Bacteria	1231
301	Ga0501031_0002251	3300049568	Bacteria	12219
302	Ga0501031_0123884	3300049568	Bacteria	1688
303	Ga0501032_0004848	3300049569	Bacteria	10081
304	Ga0501033_0041374	3300049570	Bacteria	3439
305	Ga0501033_0047082	3300049570	Bacteria	3206
306	Ga0501034_0069468	3300049571	Bacteria	3533
307	Ga0501034_0099113	3300049571	Bacteria	2909
308	Ga0501034_0143795	3300049571	Bacteria	2363
309	Ga0501034_0175346	3300049571	Bacteria	2110
310	Ga0501034_0246297	3300049571	Bacteria	1732
311	Ga0501036_0002932	3300049572	Bacteria	13538
312	Ga0501036_0291774	3300049572	Bacteria	1364
313	Ga0501037_0031431	3300049573	Bacteria	3920
314	Ga0501037_0099829	3300049573	Bacteria	2096
315	Ga0501038_0003252	3300049574	Bacteria	15152
316	Ga0501038_0105415	3300049574	Bacteria	2342
317	Ga0501039_0190667	3300049575	Bacteria	1612
318	Ga0501039_0227209	3300049575	Bacteria	1467
319	Ga0501039_0262288	3300049575	Bacteria	1358
320	Ga0501040_0099446	3300049576	Bacteria	2028
321	Ga0501040_0213080	3300049576	Bacteria	1373
322	Ga0501041_0003094	3300049577	Bacteria	9566
323	Ga0501041_0027333	3300049577	Bacteria	3438
324	Ga0501041_0182860	3300049577	Bacteria	1312
325	Ga0501042_0121062	3300049578	Bacteria	1884
326	Ga0501046_0445518	3300049580	Bacteria	931
327	Ga0501047_0007469	3300049581	Bacteria	10288
328	Ga0501047_0088318	3300049581	Bacteria	2977
329	Ga0501068_0175559	3300049584	Bacteria	1353
330	Ga0501071_0005475	3300049587	Bacteria	8166
331	Ga0501072_0007949	3300049588	Bacteria	8052
332	Ga0501072_0019791	3300049588	Bacteria	5208
333	Ga0501072_0032348	3300049588	Bacteria	4097
334	Ga0501072_0119991	3300049588	Bacteria	2095
335	Ga0501072_0306966	3300049588	Bacteria	1261
336	Ga0501072_0577198	3300049588	Bacteria	887
337	Ga0501073_0189820	3300049589	Bacteria	1422
338	Ga0501074_0039630	3300049590	Bacteria	3412
339	Ga0501075_0073177	3300049591	Bacteria	2591
340	Ga0501075_0197443	3300049591	Bacteria	1534
341	Ga0501076_0000429	3300049592	Bacteria	26487
342	Ga0501076_0152707	3300049592	Bacteria	1879
343	Ga0501080_0000634	3300049742	Bacteria	27899
344	Ga0501080_0353201	3300049742	Bacteria	1327
345	Ga0501080_0354967	3300049742	Bacteria	1323
346	Ga0501081_0007073	3300049743	Bacteria	7295
347	Ga0501035_0007059	3300049822	Bacteria	10500
348	Ga0501035_0008352	3300049822	Bacteria	9637
349	Ga0501035_0067048	3300049822	Bacteria	3185
350	Ga0501035_0103017	3300049822	Bacteria	2504
351	Ga0501035_0486882	3300049822	Bacteria	1017
352	Ga0501044_0004069	3300049823	Bacteria	16400
353	Ga0501044_0004999	3300049823	Bacteria	14800
354	Ga0501044_0054136	3300049823	Bacteria	4126
355	Ga0501045_0009276	3300049824	Bacteria	6882
356	nmdc:mga00v17_102409_c1	3300050491	Bacteria	1809
357	nmdc:mga00v17_121185_c1	3300050491	Bacteria	1665
358	nmdc:mga00v17_170_c1	3300050491	Bacteria	38298
359	nmdc:mga00v17_30220_c1	3300050491	Bacteria	3186
360	nmdc:mga0k408_102330_c1	3300050493	Bacteria	1689
361	nmdc:mga05p37_1255_c1	3300050507	Bacteria	29442
362	nmdc:mga05p37_348256_c1	3300050507	Bacteria	1745
363	nmdc:mga05p37_389_c1	3300050507	Bacteria	47594
364	nmdc:mga05p37_46253_c1	3300050507	Bacteria	5351
365	nmdc:mga09592_109_c1	3300050508	Bacteria	51482
366	nmdc:mga09592_110701_c1	3300050508	Bacteria	2356
367	nmdc:mga09592_120181_c1	3300050508	Bacteria	2256
368	nmdc:mga09592_166_c1	3300050508	Bacteria	46469
369	nmdc:mga09592_51500_c1	3300050508	Bacteria	3474
370	nmdc:mga09592_81025_c2	3300050508	Bacteria	1303
371	nmdc:mga0qj67_141945_c1	3300050509	Bacteria	1948
372	nmdc:mga0qj67_38319_c1	3300050509	Bacteria	3760
373	nmdc:mga0qj67_6675_c1	3300050509	Bacteria	8476
374	nmdc:mga0qj67_76517_c1	3300050509	Bacteria	2677
375	nmdc:mga06r32_257369_c1	3300050510	Bacteria	1733
376	nmdc:mga06r32_550472_c1	3300050510	Bacteria	1128
377	nmdc:mga06r32_71031_c1	3300050510	Bacteria	3368
378	nmdc:mga06r32_7661_c1	3300050510	Bacteria	9710
379	nmdc:mga08y16_10670_c1	3300050511	Bacteria	9643
380	nmdc:mga08y16_2159_c1	3300050511	Bacteria	20171
381	nmdc:mga08y16_75349_c1	3300050511	Bacteria	3517
382	nmdc:mga0rr50_19059_c1	3300050513	Bacteria	4622
383	nmdc:mga08x19_128705_c1	3300050514	Bacteria	1702
384	nmdc:mga08x19_1688_c1	3300050514	Bacteria	13577
385	nmdc:mga08x19_258_c1	3300050514	Bacteria	28365
386	nmdc:mga08x19_293322_c1	3300050514	Bacteria	1129
387	nmdc:mga0a205_94583_c1	3300050515	Bacteria	2887
388	Ga0495601_0015529	3300053077	Bacteria	4602
389	Ga0495595_0004491	3300053084	Bacteria	5614
390	Ga0500634_0058415	3300053161	Bacteria	2055
391	Ga0501084_0015444	3300054114	Bacteria	6332
392	Ga0501082_0078152	3300060353	Bacteria	2854
393	Ga0501082_0108989	3300060353	Bacteria	2397
394	Ga0501082_0780919	3300060353	Bacteria	836
395	Ga0501082_0806248	3300060353	Bacteria	821
396	Ga0530510_0182648	3300061734	Bacteria	1556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049822	Ga0501035_0103017	Ga0501035_0103017_1325_2086	195
2	3300025292	Ga0209676_1023281	Ga0209676_10232813	210
3	3300025298	Ga0209050_1003191	Ga0209050_100319111	210
4	3300049577	Ga0501041_0027333	Ga0501041_0027333_200_898	213
5	3300049581	Ga0501047_0088318	Ga0501047_0088318_1545_2306	215
6	3300049742	Ga0501080_0354967	Ga0501080_0354967_421_1182	215
7	3300025905	Ga0207685_10023931	Ga0207685_100239313	218
8	3300044706	Ga0466964_0021097	Ga0466964_0021097_357_1115	221
9	3300044735	Ga0466968_0003792	Ga0466968_0003792_1994_2752	221
10	3300005617	Ga0068859_100030833	Ga0068859_1000308335	222
11	3300005841	Ga0068863_100077785	Ga0068863_1000777856	222
12	3300005842	Ga0068858_100089947	Ga0068858_1000899473	222
13	3300006237	Ga0097621_100009154	Ga0097621_1000091543	222
14	3300006358	Ga0068871_100020785	Ga0068871_1000207853	222
15	3300006931	Ga0097620_100030834	Ga0097620_1000308347	222
16	3300009098	Ga0105245_10034272	Ga0105245_100342724	222
17	3300009176	Ga0105242_10035256	Ga0105242_100352568	222
18	3300009177	Ga0105248_10127952	Ga0105248_101279522	222
19	3300009553	Ga0105249_10553725	Ga0105249_105537252	222
20	3300013296	Ga0157374_10044742	Ga0157374_100447427	222
21	3300013306	Ga0163162_10053995	Ga0163162_100539957	222
22	3300013308	Ga0157375_10164416	Ga0157375_101644162	222
23	3300014326	Ga0157380_10023431	Ga0157380_100234319	222
24	3300014968	Ga0157379_10030332	Ga0157379_100303323	222
25	3300014969	Ga0157376_10037458	Ga0157376_100374587	222
26	3300025909	Ga0207705_10010384	Ga0207705_100103848	222
27	3300025921	Ga0207652_10024822	Ga0207652_100248225	222
28	3300025927	Ga0207687_10053211	Ga0207687_100532114	222
29	3300025937	Ga0207669_10328419	Ga0207669_103284192	222
30	3300025961	Ga0207712_10481635	Ga0207712_104816352	222
31	3300026035	Ga0207703_10032118	Ga0207703_100321182	222
32	3300026089	Ga0207648_10140371	Ga0207648_101403712	222
33	3300031238	Ga0265332_10027925	Ga0265332_100279252	222
34	3300005719	Ga0068861_100123837	Ga0068861_1001238375	224
35	3300048927	Ga0496124_0000013	Ga0496124_0000013_444525_445322	225
36	3300005438	Ga0070701_10092455	Ga0070701_100924553	226
37	3300005549	Ga0070704_100082967	Ga0070704_1000829672	226
38	3300005617	Ga0068859_100077059	Ga0068859_1000770592	226
39	3300005834	Ga0068851_10000833	Ga0068851_1000083314	226
40	3300005842	Ga0068858_100266925	Ga0068858_1002669252	226
41	3300006237	Ga0097621_100059983	Ga0097621_1000599833	226
42	3300006358	Ga0068871_100110605	Ga0068871_1001106053	226
43	3300006871	Ga0075434_100545125	Ga0075434_1005451251	226
44	3300006931	Ga0097620_100077057	Ga0097620_1000770577	226
45	3300009093	Ga0105240_10250742	Ga0105240_102507424	226
46	3300009148	Ga0105243_10142327	Ga0105243_101423271	226
47	3300025321	Ga0207656_10000625	Ga0207656_1000062514	226
48	3300025913	Ga0207695_10208927	Ga0207695_102089274	226
49	3300025924	Ga0207694_10143668	Ga0207694_101436683	226
50	3300025935	Ga0207709_10467383	Ga0207709_104673831	226
51	3300025941	Ga0207711_10098403	Ga0207711_100984032	226
52	3300025961	Ga0207712_10346697	Ga0207712_103466972	226
53	3300026023	Ga0207677_10035966	Ga0207677_100359662	226
54	3300026035	Ga0207703_10215073	Ga0207703_102150732	226
55	3300026142	Ga0207698_10001438	Ga0207698_1000143813	226
56	3300035410	Ga0373924_0008802	Ga0373924_0008802_2121_2888	226
57	3300035695	Ga0373927_0139199	Ga0373927_0139199_74_832	226
58	3300035724	Ga0373933_0015390	Ga0373933_0015390_1825_2592	226
59	3300035725	Ga0373947_0116077	Ga0373947_0116077_930_1685	226
60	3300037068	Ga0373925_0052630	Ga0373925_0052630_879_1637	226
61	3300046454	Ga0495592_0009689	Ga0495592_0009689_2099_2866	226
62	3300046462	Ga0495651_0310862	Ga0495651_0310862_68_835	226
63	3300046511	Ga0495608_0049424	Ga0495608_0049424_567_1334	226
64	3300046529	Ga0495652_0034277	Ga0495652_0034277_1608_2375	226
65	3300046536	Ga0495587_0004310	Ga0495587_0004310_6201_6968	226
66	3300046543	Ga0495645_0001792	Ga0495645_0001792_6098_6865	226
67	3300046678	Ga0495599_0021214	Ga0495599_0021214_2827_3594	226
68	3300046809	Ga0495600_0029976	Ga0495600_0029976_1295_2062	226
69	3300048907	Ga0496104_0049379	Ga0496104_0049379_1129_1884	226
70	3300048914	Ga0496111_0110683	Ga0496111_0110683_717_1472	226
71	3300048924	Ga0496121_0038081	Ga0496121_0038081_3215_4012	226
72	3300053077	Ga0495601_0015529	Ga0495601_0015529_661_1428	226
73	3300053084	Ga0495595_0004491	Ga0495595_0004491_1837_2604	226
74	3300010375	Ga0105239_10445947	Ga0105239_104459472	227
75	3300049588	Ga0501072_0032348	Ga0501072_0032348_389_1135	227
76	3300049592	Ga0501076_0152707	Ga0501076_0152707_1064_1810	227
77	3300061734	Ga0530510_0182648	Ga0530510_0182648_280_1029	227
78	iso_pu_bacteria	2643221603	2644027025	227
79	3300006846	Ga0075430_100545153	Ga0075430_1005451531	228
80	3300027462	Ga0210000_1003595	Ga0210000_10035955	228
81	3300032002	Ga0307416_100092186	Ga0307416_1000921862	228
82	3300035118	Ga0373954_0001511	Ga0373954_0001511_6392_7147	228
83	3300035172	Ga0373955_0121987	Ga0373955_0121987_172_927	228
84	3300035724	Ga0373933_0018495	Ga0373933_0018495_1078_1833	228
85	3300036401	Ga0373937_0001313	Ga0373937_0001313_2540_3295	228
86	3300042876	Ga0451577_0928976	Ga0451577_0928976_37_771	228
87	3300045051	Ga0451576_0630909	Ga0451576_0630909_174_929	228
88	3300049575	Ga0501039_0262288	Ga0501039_0262288_433_1197	228
89	3300005330	Ga0070690_100273902	Ga0070690_1002739021	229
90	3300005336	Ga0070680_100108562	Ga0070680_1001085623	229
91	3300005341	Ga0070691_10070659	Ga0070691_100706592	229
92	3300005345	Ga0070692_10005338	Ga0070692_100053387	229
93	3300005347	Ga0070668_100032982	Ga0070668_1000329823	229
94	3300005353	Ga0070669_100013450	Ga0070669_1000134504	229
95	3300005364	Ga0070673_100192733	Ga0070673_1001927333	229
96	3300005365	Ga0070688_100014595	Ga0070688_1000145955	229
97	3300005440	Ga0070705_100131972	Ga0070705_1001319723	229
98	3300005441	Ga0070700_100002243	Ga0070700_1000022439	229
99	3300005441	Ga0070700_100226574	Ga0070700_1002265742	229
100	3300005444	Ga0070694_100150449	Ga0070694_1001504492	229
101	3300005543	Ga0070672_100049380	Ga0070672_1000493807	229
102	3300005546	Ga0070696_100107821	Ga0070696_1001078213	229
103	3300005549	Ga0070704_100511488	Ga0070704_1005114882	229
104	3300005578	Ga0068854_100084875	Ga0068854_1000848755	229
105	3300005719	Ga0068861_100042570	Ga0068861_1000425702	229
106	3300005840	Ga0068870_10105949	Ga0068870_101059492	229
107	3300005844	Ga0068862_100006958	Ga0068862_1000069583	229
108	3300006846	Ga0075430_100044517	Ga0075430_1000445176	229
109	3300006846	Ga0075430_100051971	Ga0075430_1000519717	229
110	3300006846	Ga0075430_100094969	Ga0075430_1000949693	229
111	3300006880	Ga0075429_100235862	Ga0075429_1002358622	229
112	3300006881	Ga0068865_100003408	Ga0068865_1000034082	229
113	3300009094	Ga0111539_10036478	Ga0111539_100364786	229
114	3300009147	Ga0114129_10105488	Ga0114129_101054888	229
115	3300009148	Ga0105243_10176224	Ga0105243_101762243	229
116	3300009553	Ga0105249_10344341	Ga0105249_103443413	229
117	3300017792	Ga0163161_10139874	Ga0163161_101398743	229
118	3300025893	Ga0207682_10117830	Ga0207682_101178302	229
119	3300025908	Ga0207643_10084029	Ga0207643_100840292	229
120	3300025917	Ga0207660_10071075	Ga0207660_100710754	229
121	3300025917	Ga0207660_10142174	Ga0207660_101421743	229
122	3300025918	Ga0207662_10011539	Ga0207662_100115394	229
123	3300025923	Ga0207681_10002005	Ga0207681_1000200511	229
124	3300025926	Ga0207659_10039287	Ga0207659_100392873	229
125	3300025933	Ga0207706_10044590	Ga0207706_100445903	229
126	3300025938	Ga0207704_10016097	Ga0207704_100160977	229
127	3300025960	Ga0207651_10042207	Ga0207651_100422077	229
128	3300025961	Ga0207712_10246126	Ga0207712_102461263	229
129	3300025972	Ga0207668_10057398	Ga0207668_100573983	229
130	3300026121	Ga0207683_10157241	Ga0207683_101572414	229
131	3300027462	Ga0210000_1006821	Ga0210000_10068213	229
132	3300027543	Ga0209999_1012064	Ga0209999_10120642	229
133	3300027682	Ga0209971_1003692	Ga0209971_10036927	229
134	3300028380	Ga0268265_10001159	Ga0268265_1000115923	229
135	3300031824	Ga0307413_10502678	Ga0307413_105026781	229
136	3300031903	Ga0307407_10244981	Ga0307407_102449812	229
137	3300031995	Ga0307409_100296834	Ga0307409_1002968341	229
138	3300032002	Ga0307416_100092901	Ga0307416_1000929012	229
139	3300032005	Ga0307411_10031659	Ga0307411_100316597	229
140	3300032005	Ga0307411_10046102	Ga0307411_100461023	229
141	3300034816	Ga0373930_0014567	Ga0373930_0014567_613_1365	229
142	3300038443	Ga0395901_0335275	Ga0395901_0335275_142_909	229
143	3300042001	Ga0439441_000219	Ga0439441_000219_2797_3549	229
144	3300042003	Ga0439443_018648	Ga0439443_018648_259_1011	229
145	3300042436	Ga0439435_0003221	Ga0439435_0003221_1630_2382	229
146	3300042437	Ga0439444_0003897	Ga0439444_0003897_1025_1777	229
147	3300042461	Ga0439460_0011350	Ga0439460_0011350_307_1059	229
148	3300046462	Ga0495651_0292504	Ga0495651_0292504_84_842	229
149	3300046528	Ga0495642_0056824	Ga0495642_0056824_129_884	229
150	3300046539	Ga0495621_0110822	Ga0495621_0110822_33_788	229
151	3300049570	Ga0501033_0041374	Ga0501033_0041374_81_833	229
152	3300049572	Ga0501036_0291774	Ga0501036_0291774_416_1168	229
153	3300049575	Ga0501039_0190667	Ga0501039_0190667_420_1172	229
154	3300049576	Ga0501040_0213080	Ga0501040_0213080_260_1012	229
155	3300049578	Ga0501042_0121062	Ga0501042_0121062_657_1409	229
156	3300049580	Ga0501046_0445518	Ga0501046_0445518_99_851	229
157	3300049588	Ga0501072_0577198	Ga0501072_0577198_55_807	229
158	3300049589	Ga0501073_0189820	Ga0501073_0189820_562_1314	229
159	3300050507	nmdc:mga05p37_348256_c1	nmdc:mga05p37_348256_c1_524_1276	229
160	3300050508	nmdc:mga09592_120181_c1	nmdc:mga09592_120181_c1_1354_2109	229
161	3300050508	nmdc:mga09592_51500_c1	nmdc:mga09592_51500_c1_510_1262	229
162	3300050509	nmdc:mga0qj67_141945_c1	nmdc:mga0qj67_141945_c1_670_1422	229
163	3300050509	nmdc:mga0qj67_38319_c1	nmdc:mga0qj67_38319_c1_345_1100	229
164	3300050509	nmdc:mga0qj67_6675_c1	nmdc:mga0qj67_6675_c1_2833_3588	229
165	3300050509	nmdc:mga0qj67_76517_c1	nmdc:mga0qj67_76517_c1_1470_2222	229
166	3300050510	nmdc:mga06r32_257369_c1	nmdc:mga06r32_257369_c1_648_1400	229
167	3300060353	Ga0501082_0108989	Ga0501082_0108989_134_901	229
168	iso_pu_bacteria	8002392321	8002395910	229
169	iso_pu_bacteria	8048746797	8048747549	229
170	3300005355	Ga0070671_100347337	Ga0070671_1003473372	230
171	3300005436	Ga0070713_100273337	Ga0070713_1002733372	230
172	3300005440	Ga0070705_100092270	Ga0070705_1000922702	230
173	3300005518	Ga0070699_100008120	Ga0070699_1000081205	230
174	3300005535	Ga0070684_100037235	Ga0070684_1000372353	230
175	3300005544	Ga0070686_100008570	Ga0070686_1000085708	230
176	3300005544	Ga0070686_100195935	Ga0070686_1001959352	230
177	3300005545	Ga0070695_100140378	Ga0070695_1001403782	230
178	3300005615	Ga0070702_100019072	Ga0070702_1000190722	230
179	3300006237	Ga0097621_100000756	Ga0097621_10000075624	230
180	3300006358	Ga0068871_100000588	Ga0068871_10000058826	230
181	3300006844	Ga0075428_100000183	Ga0075428_10000018310	230
182	3300006852	Ga0075433_10288450	Ga0075433_102884502	230
183	3300006880	Ga0075429_100000891	Ga0075429_10000089122	230
184	3300006880	Ga0075429_100107458	Ga0075429_1001074583	230
185	3300006914	Ga0075436_100000529	Ga0075436_10000052912	230
186	3300006914	Ga0075436_100097782	Ga0075436_1000977821	230
187	3300006914	Ga0075436_100187270	Ga0075436_1001872702	230
188	3300007076	Ga0075435_100049195	Ga0075435_1000491953	230
189	3300009094	Ga0111539_10013498	Ga0111539_1001349812	230
190	3300009147	Ga0114129_10000219	Ga0114129_1000021955	230
191	3300013307	Ga0157372_10673196	Ga0157372_106731962	230
192	3300014969	Ga0157376_10179948	Ga0157376_101799482	230
193	3300025918	Ga0207662_10065746	Ga0207662_100657462	230
194	3300025928	Ga0207700_10211200	Ga0207700_102112004	230
195	3300026088	Ga0207641_10292724	Ga0207641_102927242	230
196	3300026095	Ga0207676_10502823	Ga0207676_105028232	230
197	3300026095	Ga0207676_10935343	Ga0207676_109353431	230
198	3300027360	Ga0209969_1001356	Ga0209969_10013563	230
199	3300027364	Ga0209967_1001553	Ga0209967_10015532	230
200	3300027395	Ga0209996_1001620	Ga0209996_10016204	230
201	3300027424	Ga0209984_1001105	Ga0209984_10011055	230
202	3300027462	Ga0210000_1000210	Ga0210000_10002106	230
203	3300027543	Ga0209999_1001050	Ga0209999_10010503	230
204	3300027552	Ga0209982_1010324	Ga0209982_10103242	230
205	3300027665	Ga0209983_1001989	Ga0209983_10019894	230
206	3300027682	Ga0209971_1024654	Ga0209971_10246542	230
207	3300027876	Ga0209974_10001114	Ga0209974_100011147	230
208	3300027907	Ga0207428_10000290	Ga0207428_1000029021	230
209	3300027907	Ga0207428_10040931	Ga0207428_100409317	230
210	3300034819	Ga0373958_0003585	Ga0373958_0003585_1413_2168	230
211	3300035084	Ga0373928_0005331	Ga0373928_0005331_1375_2130	230
212	3300035088	Ga0373940_0004250	Ga0373940_0004250_1564_2319	230
213	3300035090	Ga0373949_0004756	Ga0373949_0004756_1435_2190	230
214	3300035091	Ga0373951_0002954	Ga0373951_0002954_1054_1809	230
215	3300035112	Ga0373932_0085689	Ga0373932_0085689_232_987	230
216	3300035114	Ga0373939_0000708	Ga0373939_0000708_3508_4263	230
217	3300035121	Ga0373960_0014302	Ga0373960_0014302_984_1745	230
218	3300035121	Ga0373960_0045736	Ga0373960_0045736_323_1078	230
219	3300035241	Ga0373961_0063503	Ga0373961_0063503_268_1023	230
220	3300035242	Ga0373962_0003882	Ga0373962_0003882_79_834	230
221	3300035691	Ga0373931_0000163	Ga0373931_0000163_27734_28489	230
222	3300035691	Ga0373931_0055750	Ga0373931_0055750_628_1383	230
223	3300035691	Ga0373931_0080069	Ga0373931_0080069_459_1220	230
224	3300045051	Ga0451576_0008931	Ga0451576_0008931_8091_8846	230
225	3300045051	Ga0451576_0060969	Ga0451576_0060969_2902_3657	230
226	3300045976	Ga0466967_0008116	Ga0466967_0008116_5967_6716	230
227	3300046615	Ga0495656_0002639	Ga0495656_0002639_2791_3546	230
228	3300046684	Ga0495669_0016877	Ga0495669_0016877_2325_3080	230
229	3300046691	Ga0495670_0138426	Ga0495670_0138426_142_897	230
230	3300047318	Ga0495636_0050535	Ga0495636_0050535_513_1271	230
231	3300049588	Ga0501072_0119991	Ga0501072_0119991_992_1747	230
232	3300050493	nmdc:mga0k408_102330_c1	nmdc:mga0k408_102330_c1_432_1196	230
233	3300050507	nmdc:mga05p37_389_c1	nmdc:mga05p37_389_c1_25334_26089	230
234	3300050508	nmdc:mga09592_110701_c1	nmdc:mga09592_110701_c1_1115_1876	230
235	3300050508	nmdc:mga09592_166_c1	nmdc:mga09592_166_c1_43107_43862	230
236	3300050510	nmdc:mga06r32_71031_c1	nmdc:mga06r32_71031_c1_501_1256	230
237	3300050511	nmdc:mga08y16_10670_c1	nmdc:mga08y16_10670_c1_4981_5742	230
238	3300050511	nmdc:mga08y16_2159_c1	nmdc:mga08y16_2159_c1_5826_6581	230
239	3300050514	nmdc:mga08x19_258_c1	nmdc:mga08x19_258_c1_12437_13192	230
240	3300050514	nmdc:mga08x19_293322_c1	nmdc:mga08x19_293322_c1_308_1063	230
241	3300005467	Ga0070706_100604159	Ga0070706_1006041591	231
242	3300005536	Ga0070697_100000299	Ga0070697_10000029913	231
243	3300006844	Ga0075428_100125731	Ga0075428_1001257313	231
244	3300006880	Ga0075429_100023534	Ga0075429_10002353410	231
245	3300009147	Ga0114129_10059094	Ga0114129_100590942	231
246	3300027876	Ga0209974_10051481	Ga0209974_100514812	231
247	3300032002	Ga0307416_100767862	Ga0307416_1007678622	231
248	3300042461	Ga0439460_0014304	Ga0439460_0014304_384_1142	231
249	3300049584	Ga0501068_0175559	Ga0501068_0175559_19_792	231
250	3300049587	Ga0501071_0005475	Ga0501071_0005475_2559_3332	231
251	3300049588	Ga0501072_0019791	Ga0501072_0019791_1267_2040	231
252	3300049590	Ga0501074_0039630	Ga0501074_0039630_1752_2525	231
253	3300049742	Ga0501080_0000634	Ga0501080_0000634_5983_6756	231
254	3300050507	nmdc:mga05p37_46253_c1	nmdc:mga05p37_46253_c1_2566_3327	231
255	3300050508	nmdc:mga09592_81025_c2	nmdc:mga09592_81025_c2_343_1104	231
256	3300050514	nmdc:mga08x19_1688_c1	nmdc:mga08x19_1688_c1_10357_11109	231
257	iso_pu_bacteria	2855730933	2855732806	231
258	iso_pu_bacteria	2855767633	2855771558	231
259	iso_pu_bacteria	2857542790	2857543374	231
260	3300005336	Ga0070680_100156632	Ga0070680_1001566322	232
261	3300005435	Ga0070714_100162681	Ga0070714_1001626812	232
262	3300005440	Ga0070705_100011800	Ga0070705_1000118002	232
263	3300005444	Ga0070694_100027416	Ga0070694_1000274164	232
264	3300005458	Ga0070681_10000081	Ga0070681_1000008146	232
265	3300005518	Ga0070699_100026431	Ga0070699_1000264315	232
266	3300005536	Ga0070697_100001557	Ga0070697_1000015574	232
267	3300005545	Ga0070695_100001505	Ga0070695_10000150512	232
268	3300005546	Ga0070696_100005214	Ga0070696_10000521413	232
269	3300005985	Ga0081539_10004782	Ga0081539_1000478222	232
270	3300006914	Ga0075436_100227222	Ga0075436_1002272222	232
271	3300007076	Ga0075435_100049567	Ga0075435_1000495673	232
272	3300010159	Ga0099796_10148697	Ga0099796_101486971	232
273	3300025912	Ga0207707_10007590	Ga0207707_1000759011	232
274	3300025917	Ga0207660_10118931	Ga0207660_101189312	232
275	3300025921	Ga0207652_10351510	Ga0207652_103515102	232
276	3300025929	Ga0207664_10142962	Ga0207664_101429622	232
277	3300027364	Ga0209967_1016929	Ga0209967_10169292	232
278	3300027378	Ga0209981_1006671	Ga0209981_10066712	232
279	3300027462	Ga0210000_1002454	Ga0210000_10024541	232
280	3300027471	Ga0209995_1005371	Ga0209995_10053712	232
281	3300027543	Ga0209999_1008885	Ga0209999_10088852	232
282	3300032005	Ga0307411_10499667	Ga0307411_104996672	232
283	3300034957	Ga0373938_0023739	Ga0373938_0023739_284_1039	232
284	3300041410	Ga0439461_0020111	Ga0439461_0020111_409_1170	232
285	3300041486	Ga0451807_2313531	Ga0451807_2313531_35_790	232
286	3300042156	Ga0439446_0023901	Ga0439446_0023901_468_1229	232
287	3300042435	Ga0439434_0000867	Ga0439434_0000867_4733_5494	232
288	3300042436	Ga0439435_0007268	Ga0439435_0007268_241_1002	232
289	3300044683	Ga0466965_0061580	Ga0466965_0061580_330_1085	232
290	3300044901	Ga0466960_0151860	Ga0466960_0151860_217_972	232
291	3300044901	Ga0466960_0194322	Ga0466960_0194322_207_962	232
292	3300048924	Ga0496121_0027846	Ga0496121_0027846_4070_4858	232
293	3300049522	Ga0501299_019360	Ga0501299_019360_135_890	232
294	3300049576	Ga0501040_0099446	Ga0501040_0099446_595_1359	232
295	3300049577	Ga0501041_0182860	Ga0501041_0182860_342_1106	232
296	3300049588	Ga0501072_0306966	Ga0501072_0306966_459_1223	232
297	3300049591	Ga0501075_0197443	Ga0501075_0197443_67_831	232
298	3300050514	nmdc:mga08x19_128705_c1	nmdc:mga08x19_128705_c1_256_1011	232
299	3300053161	Ga0500634_0058415	Ga0500634_0058415_777_1568	232
300	3300060353	Ga0501082_0780919	Ga0501082_0780919_30_791	232
301	3300060353	Ga0501082_0806248	Ga0501082_0806248_29_793	232
302	iso_pu_bacteria	2895511927	2895513366	232
303	3300005345	Ga0070692_10049161	Ga0070692_100491612	233
304	3300005617	Ga0068859_100654246	Ga0068859_1006542462	233
305	3300006051	Ga0075364_10119128	Ga0075364_101191281	233
306	3300006051	Ga0075364_10234931	Ga0075364_102349311	233
307	3300006846	Ga0075430_100134450	Ga0075430_1001344502	233
308	3300006852	Ga0075433_10020641	Ga0075433_100206415	233
309	3300006881	Ga0068865_100195513	Ga0068865_1001955131	233
310	3300006931	Ga0097620_100654288	Ga0097620_1006542882	233
311	3300007076	Ga0075435_100009301	Ga0075435_1000093017	233
312	3300007265	Ga0099794_10007992	Ga0099794_100079926	233
313	3300009094	Ga0111539_10026296	Ga0111539_100262967	233
314	3300013104	Ga0157370_10316779	Ga0157370_103167792	233
315	3300027671	Ga0209588_1056789	Ga0209588_10567892	233
316	3300027907	Ga0207428_10196146	Ga0207428_101961462	233
317	3300031241	Ga0265325_10004810	Ga0265325_100048104	233
318	3300031251	Ga0265327_10112271	Ga0265327_101122712	233
319	3300042001	Ga0439441_000165	Ga0439441_000165_3997_4767	233
320	3300048911	Ga0496108_0374691	Ga0496108_0374691_366_1157	233
321	3300048917	Ga0496114_0092830	Ga0496114_0092830_982_1773	233
322	3300048927	Ga0496124_0116487	Ga0496124_0116487_683_1474	233
323	3300049577	Ga0501041_0003094	Ga0501041_0003094_588_1361	233
324	3300049588	Ga0501072_0007949	Ga0501072_0007949_4106_4879	233
325	3300049591	Ga0501075_0073177	Ga0501075_0073177_832_1605	233
326	3300049592	Ga0501076_0000429	Ga0501076_0000429_1614_2387	233
327	3300049742	Ga0501080_0353201	Ga0501080_0353201_377_1150	233
328	3300049743	Ga0501081_0007073	Ga0501081_0007073_2135_2908	233
329	3300049822	Ga0501035_0067048	Ga0501035_0067048_509_1315	233
330	3300049823	Ga0501044_0054136	Ga0501044_0054136_203_1009	233
331	3300049824	Ga0501045_0009276	Ga0501045_0009276_207_980	233
332	3300050491	nmdc:mga00v17_121185_c1	nmdc:mga00v17_121185_c1_46_849	233
333	3300050491	nmdc:mga00v17_30220_c1	nmdc:mga00v17_30220_c1_31_831	233
334	3300050511	nmdc:mga08y16_75349_c1	nmdc:mga08y16_75349_c1_1450_2241	233
335	3300050513	nmdc:mga0rr50_19059_c1	nmdc:mga0rr50_19059_c1_3319_4089	233
336	3300050515	nmdc:mga0a205_94583_c1	nmdc:mga0a205_94583_c1_1577_2347	233
337	3300054114	Ga0501084_0015444	Ga0501084_0015444_1604_2377	233
338	3300060353	Ga0501082_0078152	Ga0501082_0078152_2046_2819	233
339	iso_pu_bacteria	2643221569	2643861635	233
340	3300006051	Ga0075364_10000064	Ga0075364_1000006430	234
341	3300030500	Ga0268256_1012950	Ga0268256_10129502	234
342	3300031911	Ga0307412_10000061	Ga0307412_1000006148	234
343	3300048908	Ga0496105_0115361	Ga0496105_0115361_698_1492	234
344	3300048919	Ga0496116_0017099	Ga0496116_0017099_2675_3469	234
345	3300048919	Ga0496116_0024041	Ga0496116_0024041_3167_3958	234
346	3300048919	Ga0496116_0061621	Ga0496116_0061621_1626_2417	234
347	3300048920	Ga0496117_0016615	Ga0496117_0016615_3217_4008	234
348	3300048921	Ga0496118_0089007	Ga0496118_0089007_1151_1942	234
349	3300048921	Ga0496118_0111302	Ga0496118_0111302_753_1547	234
350	3300048922	Ga0496119_0004847	Ga0496119_0004847_3962_4756	234
351	3300048924	Ga0496121_0000647	Ga0496121_0000647_33003_33797	234
352	3300048924	Ga0496121_0141337	Ga0496121_0141337_660_1451	234
353	3300048925	Ga0496122_0025049	Ga0496122_0025049_1178_1969	234
354	3300048926	Ga0496123_0000730	Ga0496123_0000730_51615_52406	234
355	3300048926	Ga0496123_0060893	Ga0496123_0060893_768_1562	234
356	3300048927	Ga0496124_0070477	Ga0496124_0070477_315_1106	234
357	3300048927	Ga0496124_0143613	Ga0496124_0143613_698_1492	234
358	3300048928	Ga0496125_0000051	Ga0496125_0000051_167894_168688	234
359	3300048928	Ga0496125_0039846	Ga0496125_0039846_777_1568	234
360	3300048929	Ga0496126_0153612	Ga0496126_0153612_351_1145	234
361	3300048929	Ga0496126_0303118	Ga0496126_0303118_474_1265	234
362	3300049570	Ga0501033_0047082	Ga0501033_0047082_188_985	234
363	3300049571	Ga0501034_0099113	Ga0501034_0099113_462_1259	234
364	3300049574	Ga0501038_0105415	Ga0501038_0105415_411_1208	234
365	3300049822	Ga0501035_0008352	Ga0501035_0008352_1295_2092	234
366	3300049823	Ga0501044_0004069	Ga0501044_0004069_2981_3778	234
367	3300050491	nmdc:mga00v17_170_c1	nmdc:mga00v17_170_c1_29646_30455	234
368	iso_pu_bacteria	2599185292	2599902798	234
369	iso_pu_bacteria	2643221594	2643980055	234
370	iso_pu_bacteria	2643221621	2644123599	234
371	iso_pu_bacteria	2808606395	2809033138	234
372	iso_pu_bacteria	2857537821	2857542516	234
373	iso_pu_bacteria	2858950400	2858952193	234
374	iso_pu_bacteria	2941479691	2941482620	234
375	3300003187	JGI25151J46595_10000121	JGI25151J46595_1000012137	235
376	3300005295	Ga0065707_10133595	Ga0065707_101335952	235
377	3300005444	Ga0070694_100071167	Ga0070694_1000711672	235
378	3300005471	Ga0070698_100004625	Ga0070698_1000046255	235
379	3300005549	Ga0070704_100094376	Ga0070704_1000943762	235
380	3300005617	Ga0068859_100365204	Ga0068859_1003652042	235
381	3300006844	Ga0075428_100013956	Ga0075428_1000139567	235
382	3300006844	Ga0075428_100497743	Ga0075428_1004977432	235
383	3300006847	Ga0075431_100020329	Ga0075431_1000203293	235
384	3300006847	Ga0075431_100126308	Ga0075431_1001263082	235
385	3300006880	Ga0075429_100000100	Ga0075429_10000010038	235
386	3300006931	Ga0097620_100365175	Ga0097620_1003651752	235
387	3300009147	Ga0114129_10011817	Ga0114129_100118178	235
388	3300025294	Ga0209025_1000019	Ga0209025_1000019101	235
389	3300025917	Ga0207660_10548921	Ga0207660_105489211	235
390	3300032004	Ga0307414_10437160	Ga0307414_104371601	235
391	3300049568	Ga0501031_0002251	Ga0501031_0002251_6397_7215	235
392	3300049568	Ga0501031_0123884	Ga0501031_0123884_715_1530	235
393	3300049569	Ga0501032_0004848	Ga0501032_0004848_7229_8047	235
394	3300049571	Ga0501034_0069468	Ga0501034_0069468_707_1525	235
395	3300049571	Ga0501034_0143795	Ga0501034_0143795_1018_1833	235
396	3300049571	Ga0501034_0175346	Ga0501034_0175346_108_920	235
397	3300049571	Ga0501034_0246297	Ga0501034_0246297_444_1259	235
398	3300049572	Ga0501036_0002932	Ga0501036_0002932_7975_8793	235
399	3300049573	Ga0501037_0031431	Ga0501037_0031431_3076_3891	235
400	3300049573	Ga0501037_0099829	Ga0501037_0099829_835_1653	235
401	3300049574	Ga0501038_0003252	Ga0501038_0003252_6882_7700	235
402	3300049575	Ga0501039_0227209	Ga0501039_0227209_481_1299	235
403	3300049581	Ga0501047_0007469	Ga0501047_0007469_1027_1845	235
404	3300049822	Ga0501035_0007059	Ga0501035_0007059_8497_9315	235
405	3300049822	Ga0501035_0486882	Ga0501035_0486882_16_831	235
406	3300049823	Ga0501044_0004999	Ga0501044_0004999_8394_9212	235
407	3300050491	nmdc:mga00v17_102409_c1	nmdc:mga00v17_102409_c1_581_1378	235
408	3300050507	nmdc:mga05p37_1255_c1	nmdc:mga05p37_1255_c1_5913_6701	235
409	3300050508	nmdc:mga09592_109_c1	nmdc:mga09592_109_c1_16812_17600	235
410	3300050510	nmdc:mga06r32_550472_c1	nmdc:mga06r32_550472_c1_64_864	235
411	3300050510	nmdc:mga06r32_7661_c1	nmdc:mga06r32_7661_c1_2449_3237	235
412	iso_pu_bacteria	2739367655	2739611302	235
413	iso_pu_bacteria	2881412998	2881415610	235
414	iso_pu_bacteria	2881927736	2881929882	235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00902

TatC

Sec-independent protein translocase protein (TatC)

11

212

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4htt-assembly2.cif.gz_B	crystal structure of twin arginine translocase receptor- tatc in ddm	0.8395	4	214
4hts-assembly1.cif.gz_A	crystal structure of twin arginine translocase receptor- tatc	0.8203	3	216
4htt-assembly2.cif.gz_B	crystal structure of twin arginine translocase receptor- tatc in ddm	0.7775	4	214
4hts-assembly1.cif.gz_A	crystal structure of twin arginine translocase receptor- tatc	0.7706	3	216
7wkk-assembly1.cif.gz_n	cryo-em structure of the ir subunit from x. laevis npc	0.3231	1	211

ID	Description	Score	Start	End	Superfamily
af_I1LVA8_11_106_1.20.1280.290	Mainly Alpha;Up-down Bundle;Monooxygenase;	0.4978	133	216	1.20.1280.290
af_Q5ABC2_178_268_1.20.1280.290	Mainly Alpha;Up-down Bundle;Monooxygenase;	0.4666	133	214	1.20.1280.290
af_I1LVA8_11_106_1.20.1280.290	Mainly Alpha;Up-down Bundle;Monooxygenase;	0.4505	133	216	1.20.1280.290
af_Q9N2Z6_260_461_1.20.1640.10	Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain	0.4445	37	216	1.20.1640.10
af_Q4D3D9_16_449_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.4417	139	219	1.20.1250.20

ID	Description	Score	Start	End	GO Terms
AF-A0A7X9PIG0-F1-model_v4	Twin-arginine translocase subunit TatC	0.9288	19	216	GO:0009977 GO:0033281 GO:0043953 GO:0065002
AF-A0A522K2D3-F1-model_v4	deleted	0.9241	27	216
AF-A0A1G3G3B4-F1-model_v4	deleted	0.9175	40	216
AF-A0A534CP10-F1-model_v4	Twin-arginine translocase subunit TatC	0.9174	18	221	GO:0009977 GO:0033281 GO:0043953 GO:0065002
AF-A0A521XTW2-F1-model_v4	Sec-independent protein translocase protein TatC	0.9154	4	216	GO:0009977 GO:0033281 GO:0043953 GO:0065002

Feature Viewer

pLDDT	pTM	Quality
74.2	0.71	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F438435

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00902

TatC

Sec-independent protein translocase protein (TatC)

11

212

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map