F438381

General Info

Members Datasets Scaffolds Average Seq Length
414 264 411 127

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0001376|Ga0439436_0001376_6513_6980
Length 155
Sequence VSLLASTPKLRTPDRSGSRSPLTFRSPAMTHRSRLAGFIIDCETGDVDRAAGFWSNALGLPLGDGYDEDGASYVELRNAPGELHVEVQKVDHPSRVHLDIEADDIDAEAARLERLGAKKLKFVKRWWVMEAPTGHRFCVVRMKHPERGAPPKVWD

Samples

Sample ID Description Type Environment
1 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
2 2643221695 Lysobacter sp. Root494 Isolate Unclassified
3 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
67 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
68 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
69 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
133 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
134 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
140 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
178 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
179 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
182 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
183 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
187 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
190 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
236 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
240 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
257 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 2.17
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.53
Nodule 0
Rhizoplane 7.73
Rhizosphere 74.64
Stem 0
Stem Tuber 0
Unclassified 4.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1050502 3300002987 Bacteria 571
2 JGI25151J46595_10025752 3300003187 Bacteria 2386
3 JGI25151J46595_10064240 3300003187 Bacteria 1150
4 rootH1_10279069 3300003323 Bacteria 4455
5 Ga0055537_1000026 3300003773 Bacteria 105126
6 Ga0055537_1000048 3300003773 Bacteria 87588
7 Ga0055524_1000005 3300003775 Bacteria 344542
8 Ga0055524_1012893 3300003775 Bacteria 3184
9 Ga0055524_1015303 3300003775 Bacteria 2802
10 Ga0055536_1004203 3300003781 Bacteria 7441
11 Ga0055536_1049238 3300003781 Bacteria 937
12 Ga0055536_1050887 3300003781 Bacteria 911
13 Ga0055534_1000002 3300003784 Bacteria 390762
14 Ga0055534_1021758 3300003784 Bacteria 1068
15 Ga0055528_1000002 3300003790 Bacteria 368879
16 Ga0055528_1028219 3300003790 Bacteria 1555
17 Ga0055530_10002663 3300003791 Bacteria 11155
18 Ga0055530_10063415 3300003791 Bacteria 817
19 Ga0055531_10004927 3300003794 Bacteria 7937
20 Ga0055531_10006156 3300003794 Bacteria 6863
21 Ga0055531_10015993 3300003794 Bacteria 3266
22 Ga0055531_10025311 3300003794 Bacteria 2160
23 Ga0055531_10036980 3300003794 Bacteria 1493
24 Ga0065704_10103600 3300005289 Bacteria 2167
25 Ga0065715_10030246 3300005293 Bacteria 1432
26 Ga0065715_10160176 3300005293 Bacteria 1637
27 Ga0065715_10652733 3300005293 Bacteria 677
28 Ga0070658_11107924 3300005327 Bacteria 689
29 Ga0070670_100055917 3300005331 Bacteria 3386
30 Ga0070670_100373921 3300005331 Bacteria 1255
31 Ga0070670_100615261 3300005331 Bacteria 973
32 Ga0070670_101004835 3300005331 Bacteria 759
33 Ga0070666_10000825 3300005335 Bacteria 18805
34 Ga0070682_100467482 3300005337 Bacteria 970
35 Ga0068868_100001561 3300005338 Bacteria 15635
36 Ga0070689_100534554 3300005340 Bacteria 1008
37 Ga0070689_101199240 3300005340 Bacteria 681
38 Ga0070675_102258889 3300005354 Bacteria 501
39 Ga0070671_100000950 3300005355 Bacteria 21210
40 Ga0070671_100044356 3300005355 Bacteria 3695
41 Ga0070659_101727677 3300005366 Bacteria 560
42 Ga0070667_100539486 3300005367 Bacteria 1071
43 Ga0070709_10569546 3300005434 Bacteria 869
44 Ga0070713_100003100 3300005436 Bacteria 10934
45 Ga0070710_10005099 3300005437 Bacteria 6215
46 Ga0070701_10755794 3300005438 Bacteria 659
47 Ga0070711_100000263 3300005439 Bacteria 26963
48 Ga0070705_100044385 3300005440 Bacteria 2553
49 Ga0070708_100930663 3300005445 Bacteria 816
50 Ga0070678_100000129 3300005456 Bacteria 30238
51 Ga0070681_10001479 3300005458 Bacteria 20744
52 Ga0068867_100218077 3300005459 Bacteria 1536
53 Ga0068867_100533587 3300005459 Bacteria 1014
54 Ga0070685_10856606 3300005466 Bacteria 674
55 Ga0070706_100696817 3300005467 Bacteria 942
56 Ga0070706_100819642 3300005467 Bacteria 861
57 Ga0070679_100135880 3300005530 Bacteria 2440
58 Ga0068853_100171111 3300005539 Bacteria 1965
59 Ga0070672_100006385 3300005543 Bacteria 7919
60 Ga0070696_100579174 3300005546 Bacteria 902
61 Ga0070665_100031450 3300005548 Bacteria 5342
62 Ga0070664_102340300 3300005564 Bacteria 507
63 Ga0068856_100020067 3300005614 Bacteria 6489
64 Ga0070702_101276108 3300005615 Bacteria 595
65 Ga0068866_10006495 3300005718 Bacteria 4872
66 Ga0068863_100039647 3300005841 Bacteria 4480
67 Ga0068858_100004518 3300005842 Bacteria 13641
68 Ga0068860_100006186 3300005843 Bacteria 12043
69 Ga0075363_100727616 3300006048 Bacteria 600
70 Ga0070715_10001731 3300006163 Bacteria 6484
71 Ga0070715_10033305 3300006163 Bacteria 2105
72 Ga0070716_100021192 3300006173 Bacteria 3421
73 Ga0070716_100098734 3300006173 Bacteria 1785
74 Ga0097621_101652645 3300006237 Unclassified 609
75 Ga0068871_102096733 3300006358 Bacteria 538
76 Ga0068865_100018826 3300006881 Bacteria 4462
77 Ga0097620_101664154 3300006931 Bacteria 705
78 Ga0075435_100247789 3300007076 Bacteria 1516
79 Ga0105245_10163320 3300009098 Bacteria 2115
80 Ga0105245_10343164 3300009098 Bacteria 1477
81 Ga0105243_10755002 3300009148 Bacteria 954
82 Ga0105243_10877552 3300009148 Bacteria 890
83 Ga0105241_10003120 3300009174 Bacteria 12329
84 Ga0105242_10008904 3300009176 Bacteria 7702
85 Ga0105242_11029793 3300009176 Bacteria 833
86 Ga0105248_10010045 3300009177 Bacteria 10424
87 Ga0105248_10534513 3300009177 Bacteria 1322
88 Ga0105237_10022049 3300009545 Bacteria 6537
89 Ga0105238_11135824 3300009551 Unclassified 805
90 Ga0105249_11717872 3300009553 Bacteria 700
91 Ga0105249_11822731 3300009553 Bacteria 681
92 Ga0105032_101844 3300009979 Bacteria 1916
93 Ga0105029_102163 3300009984 Bacteria 1263
94 Ga0157335_1011157 3300012492 Bacteria 733
95 Ga0157327_1036356 3300012512 Bacteria 641
96 Ga0157373_10029356 3300013100 Bacteria 3960
97 Ga0157370_10117916 3300013104 Bacteria 2480
98 Ga0157374_10001326 3300013296 Bacteria 21038
99 Ga0157378_10004724 3300013297 Bacteria 11942
100 Ga0157378_10244182 3300013297 Bacteria 1717
101 Ga0157375_10021432 3300013308 Bacteria 5925
102 Ga0157375_10285729 3300013308 Bacteria 1813
103 Ga0157375_10433159 3300013308 Bacteria 1481
104 Ga0163163_10607305 3300014325 Unclassified 1157
105 Ga0163163_10643692 3300014325 Bacteria 1124
106 Ga0163163_12630490 3300014325 Unclassified 561
107 Ga0157380_10046142 3300014326 Bacteria 3421
108 Ga0157380_10074521 3300014326 Bacteria 2756
109 Ga0157377_10801441 3300014745 Bacteria 694
110 Ga0157379_10026260 3300014968 Bacteria 5184
111 Ga0157379_10664349 3300014968 Unclassified 976
112 Ga0157376_10031733 3300014969 Bacteria 4235
113 Ga0182006_1190782 3300015261 Bacteria 681
114 Ga0183360_10001 3300015689 Bacteria 3943671
115 Ga0163161_11164536 3300017792 Bacteria 665
116 Ga0206349_1739388 3300020075 Bacteria 788
117 Ga0213874_10093023 3300021377 Bacteria 993
118 Ga0213876_10315539 3300021384 Bacteria 831
119 Ga0209565_1000001 3300025263 Bacteria 2950419
120 Ga0209673_1000001 3300025273 Bacteria 3176258
121 Ga0209673_1012557 3300025273 Bacteria 3405
122 Ga0209675_1000001 3300025291 Bacteria 2950293
123 Ga0209675_1009702 3300025291 Bacteria 3374
124 Ga0209675_1013574 3300025291 Bacteria 2536
125 Ga0209675_1024145 3300025291 Bacteria 1559
126 Ga0209676_1001618 3300025292 Bacteria 19930
127 Ga0209676_1003150 3300025292 Bacteria 10532
128 Ga0209676_1003842 3300025292 Bacteria 8816
129 Ga0209676_1004893 3300025292 Bacteria 7227
130 Ga0209676_1007625 3300025292 Bacteria 5023
131 Ga0209025_1002068 3300025294 Bacteria 22789
132 Ga0209025_1019043 3300025294 Bacteria 3841
133 Ga0209025_1058085 3300025294 Bacteria 1473
134 Ga0209025_1101801 3300025294 Bacteria 907
135 Ga0209564_1000001 3300025295 Bacteria 3176258
136 Ga0209564_1009131 3300025295 Bacteria 4770
137 Ga0209758_1068029 3300025297 Bacteria 1136
138 Ga0209050_1002652 3300025298 Bacteria 14661
139 Ga0209050_1040326 3300025298 Bacteria 1302
140 Ga0209256_1000006 3300025299 Bacteria 1250310
141 Ga0209256_1004471 3300025299 Bacteria 8749
142 Ga0209256_1006494 3300025299 Bacteria 6155
143 Ga0209256_1013829 3300025299 Bacteria 2965
144 Ga0209257_1000210 3300025304 Bacteria 140822
145 Ga0209257_1001873 3300025304 Bacteria 22782
146 Ga0209257_1004162 3300025304 Bacteria 11486
147 Ga0209257_1011128 3300025304 Bacteria 4393
148 Ga0209257_1013848 3300025304 Bacteria 3533
149 Ga0209257_1019441 3300025304 Bacteria 2557
150 Ga0207642_10014798 3300025899 Bacteria 2889
151 Ga0207680_10636523 3300025903 Bacteria 763
152 Ga0207699_10416568 3300025906 Bacteria 959
153 Ga0207707_10015708 3300025912 Bacteria 6597
154 Ga0207693_10000060 3300025915 Bacteria 93715
155 Ga0207663_10342683 3300025916 Bacteria 1129
156 Ga0207652_10385458 3300025921 Bacteria 1265
157 Ga0207650_10155386 3300025925 Bacteria 1809
158 Ga0207650_10668574 3300025925 Bacteria 876
159 Ga0207687_10422745 3300025927 Bacteria 1100
160 Ga0207687_11853944 3300025927 Bacteria 516
161 Ga0207700_10004851 3300025928 Bacteria 7985
162 Ga0207644_10074772 3300025931 Bacteria 2487
163 Ga0207644_10082183 3300025931 Bacteria 2382
164 Ga0207686_10071702 3300025934 Bacteria 2230
165 Ga0207709_10000536 3300025935 Bacteria 32696
166 Ga0207709_10439099 3300025935 Bacteria 1006
167 Ga0207709_10758142 3300025935 Bacteria 781
168 Ga0207669_10080136 3300025937 Bacteria 2087
169 Ga0207665_10010152 3300025939 Bacteria 6181
170 Ga0207691_11156669 3300025940 Bacteria 642
171 Ga0207689_10122284 3300025942 Bacteria 2141
172 Ga0207689_10315865 3300025942 Bacteria 1296
173 Ga0207679_10306153 3300025945 Bacteria 1371
174 Ga0207679_11876941 3300025945 Bacteria 547
175 Ga0207667_10406925 3300025949 Bacteria 1385
176 Ga0207667_11054288 3300025949 Bacteria 798
177 Ga0207658_10014029 3300025986 Bacteria 5484
178 Ga0207677_10893545 3300026023 Bacteria 800
179 Ga0207703_10439954 3300026035 Bacteria 1216
180 Ga0207639_10441697 3300026041 Bacteria 1180
181 Ga0207678_11076218 3300026067 Bacteria 712
182 Ga0207648_10086909 3300026089 Bacteria 2728
183 Ga0207648_10169551 3300026089 Bacteria 1929
184 Ga0207676_10285289 3300026095 Bacteria 1501
185 Ga0207675_100565865 3300026118 Bacteria 1137
186 Ga0207675_102635844 3300026118 Bacteria 512
187 Ga0207683_10000725 3300026121 Bacteria 29989
188 Ga0207683_10367780 3300026121 Bacteria 1321
189 Ga0209969_1008947 3300027360 Bacteria 1423
190 Ga0210000_1022795 3300027462 Bacteria 962
191 Ga0209999_1001283 3300027543 Bacteria 4307
192 Ga0209982_1000376 3300027552 Bacteria 5402
193 Ga0209970_1001376 3300027614 Bacteria 4243
194 Ga0209983_1004588 3300027665 Bacteria 2898
195 Ga0209983_1007465 3300027665 Bacteria 2240
196 Ga0209971_1002037 3300027682 Bacteria 4916
197 Ga0209971_1004083 3300027682 Bacteria 3454
198 Ga0209974_10007276 3300027876 Bacteria 3818
199 Ga0209974_10135883 3300027876 Bacteria 879
200 Ga0265354_1000799 3300028016 Bacteria 5120
201 Ga0265357_1000612 3300028023 Bacteria 2203
202 Ga0265355_1000292 3300028036 Bacteria 2426
203 Ga0268266_10102606 3300028379 Bacteria 2523
204 Ga0268264_10202403 3300028381 Bacteria 1817
205 Ga0307515_10349603 3300028794 Bacteria 1126
206 Ga0265338_10075355 3300028800 Bacteria 2863
207 Ga0316182_1368861 3300030745 Bacteria 1843
208 Ga0265763_1041217 3300030763 Bacteria 557
209 Ga0265770_1000541 3300030878 Bacteria 5253
210 Ga0265770_1032428 3300030878 Bacteria 881
211 Ga0265770_1071912 3300030878 Bacteria 662
212 Ga0265765_1004191 3300030879 Bacteria 1474
213 Ga0265771_1007814 3300031010 Bacteria 736
214 Ga0265760_10014238 3300031090 Bacteria 2277
215 Ga0307408_100012320 3300031548 Bacteria 5662
216 Ga0307408_100293681 3300031548 Bacteria 1358
217 Ga0307408_100372699 3300031548 Bacteria 1218
218 Ga0316576_10043748 3300031727 Unclassified 3232
219 Ga0316576_10309618 3300031727 Bacteria 1179
220 Ga0316578_10057209 3300031728 Unclassified 2291
221 Ga0307405_10401965 3300031731 Bacteria 1072
222 Ga0307405_10806371 3300031731 Archaea 787
223 Ga0316577_10289334 3300031733 Bacteria 928
224 Ga0307413_10302127 3300031824 Bacteria 1214
225 Ga0307410_10627765 3300031852 Bacteria 899
226 Ga0307410_10815986 3300031852 Bacteria 794
227 Ga0307406_10002178 3300031901 Bacteria 10669
228 Ga0307406_10427823 3300031901 Bacteria 1056
229 Ga0307406_10592671 3300031901 Bacteria 913
230 Ga0307406_10689744 3300031901 Bacteria 852
231 Ga0307407_10117543 3300031903 Bacteria 1680
232 Ga0307407_10532970 3300031903 Archaea 865
233 Ga0307412_10114423 3300031911 Bacteria 1932
234 Ga0307412_10147987 3300031911 Bacteria 1729
235 Ga0307412_10964569 3300031911 Bacteria 751
236 Ga0307412_11899707 3300031911 Bacteria 549
237 Ga0307409_100025944 3300031995 Bacteria 4122
238 Ga0307409_100177474 3300031995 Bacteria 1882
239 Ga0307416_100608686 3300032002 Bacteria 1173
240 Ga0307416_100621400 3300032002 Bacteria 1162
241 Ga0307416_100963487 3300032002 Bacteria 955
242 Ga0307414_10046633 3300032004 Bacteria 2976
243 Ga0307414_10105161 3300032004 Bacteria 2133
244 Ga0307414_10344318 3300032004 Bacteria 1277
245 Ga0307414_10355238 3300032004 Bacteria 1259
246 Ga0307414_10394551 3300032004 Bacteria 1200
247 Ga0307414_10443127 3300032004 Bacteria 1137
248 Ga0307414_10511334 3300032004 Bacteria 1064
249 Ga0307414_10714010 3300032004 Bacteria 908
250 Ga0307414_10767148 3300032004 Bacteria 877
251 Ga0307411_10024275 3300032005 Bacteria 3611
252 Ga0307411_10371174 3300032005 Bacteria 1173
253 Ga0307411_10388017 3300032005 Bacteria 1151
254 Ga0307411_10525994 3300032005 Bacteria 1005
255 Ga0307411_10907641 3300032005 Bacteria 783
256 Ga0307411_11407705 3300032005 Bacteria 638
257 Ga0307415_100122174 3300032126 Bacteria 1955
258 Ga0307415_100193675 3300032126 Bacteria 1606
259 Ga0307415_100224906 3300032126 Bacteria 1507
260 Ga0373934_0036289 3300035086 Bacteria 1942
261 Ga0373923_0037664 3300035111 Bacteria 1980
262 Ga0373923_0224311 3300035111 Bacteria 874
263 Ga0373956_0073395 3300035119 Bacteria 1563
264 Ga0373957_0093712 3300035120 Bacteria 1196
265 Ga0316574_0013203 3300035398 Bacteria 4744
266 Ga0316574_0036639 3300035398 Bacteria 3004
267 Ga0373924_0246386 3300035410 Bacteria 791
268 Ga0373927_0022208 3300035695 Bacteria 4157
269 Ga0373933_0542793 3300035724 Bacteria 763
270 Ga0373933_0965391 3300035724 Bacteria 561
271 Ga0373947_0062871 3300035725 Bacteria 2260
272 Ga0373937_0144011 3300036401 Bacteria 2230
273 Ga0316582_0188759 3300036647 Bacteria 1404
274 Ga0316584_0101814 3300036712 Bacteria 2151
275 Ga0373925_0054046 3300037068 Unclassified 3003
276 Ga0395905_0581818 3300037471 Bacteria 1021
277 Ga0237819_00598 3300038705 Bacteria 12061
278 Ga0436365_0738787 3300039437 Bacteria 7867
279 Ga0436363_1272918 3300039450 Bacteria 5167
280 Ga0439436_0001376 3300041404 Bacteria 7012
281 Ga0439436_0017691 3300041404 Bacteria 2133
282 Ga0439436_0021534 3300041404 Bacteria 1915
283 Ga0439436_0037635 3300041404 Bacteria 1393
284 Ga0439436_0178064 3300041404 Bacteria 604
285 Ga0439439_0001871 3300041406 Bacteria 4342
286 Ga0439439_0136562 3300041406 Bacteria 691
287 Ga0439447_030263 3300041407 Bacteria 1365
288 Ga0439465_0155875 3300041413 Bacteria 817
289 Ga0451789_0433371 3300041443 Bacteria 650
290 Ga0451793_1095447 3300041452 Bacteria 541
291 Ga0451795_1344704 3300041456 Bacteria 1243
292 Ga0451807_0656857 3300041486 Bacteria 526
293 Ga0451807_1870589 3300041486 Unclassified 510
294 Ga0451807_2654781 3300041486 Bacteria 715
295 Ga0451853_1550552 3300041512 Bacteria 509
296 Ga0451853_2025629 3300041512 Bacteria 2381
297 Ga0439433_0033443 3300041999 Bacteria 1181
298 Ga0439433_0212039 3300041999 Bacteria 514
299 Ga0439432_003803 3300042006 Bacteria 5573
300 Ga0439432_015617 3300042006 Bacteria 2561
301 Ga0439432_059391 3300042006 Bacteria 1181
302 Ga0439449_0005960 3300042007 Bacteria 4656
303 Ga0439449_0011350 3300042007 Bacteria 3352
304 Ga0439449_0012611 3300042007 Bacteria 3179
305 Ga0439449_0033879 3300042007 Bacteria 1902
306 Ga0439462_0115073 3300042015 Bacteria 746
307 Ga0450909_056504 3300042185 Bacteria 617
308 Ga0453683_0033250 3300044673 Bacteria 3252
309 Ga0453683_0067409 3300044673 Bacteria 2237
310 Ga0453684_0001398 3300044712 Bacteria 69823
311 Ga0453684_0028127 3300044712 Bacteria 8036
312 Ga0451576_0000081 3300045051 Bacteria 239875
313 Ga0495629_0231503 3300046459 Bacteria 1274
314 Ga0495651_0337836 3300046462 Bacteria 999
315 Ga0495653_0450959 3300046463 Bacteria 809
316 Ga0495580_0297647 3300046472 Bacteria 1099
317 Ga0495607_0091913 3300046501 Bacteria 1643
318 Ga0495606_0029542 3300046507 Bacteria 3845
319 Ga0495616_0020310 3300046513 Bacteria 3616
320 Ga0495628_0549436 3300046516 Bacteria 829
321 Ga0495665_0158275 3300046531 Bacteria 1181
322 Ga0495587_0224446 3300046536 Bacteria 1059
323 Ga0495598_0027794 3300046537 Bacteria 1563
324 Ga0495621_0004829 3300046539 Bacteria 3821
325 Ga0495621_0164498 3300046539 Bacteria 879
326 Ga0495656_0002671 3300046615 Bacteria 5953
327 Ga0495656_0010631 3300046615 Bacteria 3352
328 Ga0495656_0078950 3300046615 Bacteria 1480
329 Ga0495656_0275049 3300046615 Bacteria 857
330 Ga0495668_0003240 3300046616 Bacteria 12402
331 Ga0495659_0019143 3300046664 Bacteria 2289
332 Ga0495659_0056640 3300046664 Bacteria 1439
333 Ga0495588_0163001 3300046674 Bacteria 1179
334 Ga0495657_0543328 3300046675 Bacteria 675
335 Ga0495623_0223424 3300046679 Bacteria 1072
336 Ga0495669_0287299 3300046684 Bacteria 792
337 Ga0495670_0171504 3300046691 Bacteria 1143
338 Ga0495604_0208052 3300047317 Bacteria 1353
339 Ga0495604_0477755 3300047317 Bacteria 811
340 Ga0495636_0015139 3300047318 Bacteria 3072
341 Ga0495636_0146418 3300047318 Bacteria 1057
342 Ga0495674_0074939 3300047319 Bacteria 2913
343 Ga0495681_0051041 3300047470 Bacteria 1947
344 Ga0495602_0020932 3300048088 Bacteria 6452
345 Ga0495602_0381634 3300048088 Bacteria 1009
346 Ga0496100_0131565 3300048903 Bacteria 1763
347 Ga0496100_0159832 3300048903 Bacteria 1614
348 Ga0496101_0002352 3300048904 Bacteria 11604
349 Ga0496102_0189241 3300048905 Bacteria 1939
350 Ga0496102_0209341 3300048905 Bacteria 1839
351 Ga0496103_0293268 3300048906 Bacteria 1046
352 Ga0496103_0462131 3300048906 Bacteria 814
353 Ga0496104_0134776 3300048907 Bacteria 2372
354 Ga0496105_0028625 3300048908 Bacteria 4556
355 Ga0496105_0731644 3300048908 Bacteria 757
356 Ga0496107_0006651 3300048910 Bacteria 7958
357 Ga0496107_0035766 3300048910 Bacteria 3561
358 Ga0496108_0006755 3300048911 Bacteria 9287
359 Ga0496109_0001391 3300048912 Bacteria 20067
360 Ga0496109_0729662 3300048912 Bacteria 928
361 Ga0496110_0005095 3300048913 Bacteria 10264
362 Ga0496110_0478589 3300048913 Bacteria 1134
363 Ga0496110_0515577 3300048913 Bacteria 1088
364 Ga0496111_0033934 3300048914 Bacteria 3641
365 Ga0496111_0965200 3300048914 Bacteria 612
366 Ga0496112_0090971 3300048915 Bacteria 3020
367 Ga0496113_0185370 3300048916 Bacteria 1650
368 Ga0496113_0192406 3300048916 Bacteria 1619
369 Ga0496114_0003264 3300048917 Bacteria 12455
370 Ga0496114_0244107 3300048917 Bacteria 1580
371 Ga0496115_0359471 3300048918 Bacteria 1186
372 Ga0496118_0000629 3300048921 Bacteria 58021
373 Ga0496122_0483738 3300048925 Bacteria 605
374 Ga0496123_0329517 3300048926 Bacteria 717
375 Ga0496124_0000822 3300048927 Bacteria 50548
376 Ga0496125_0062431 3300048928 Bacteria 2979
377 Ga0496125_0450325 3300048928 Bacteria 737
378 Ga0501291_132842 3300049514 Bacteria 550
379 Ga0501031_0027291 3300049568 Bacteria 3723
380 Ga0501031_0158483 3300049568 Bacteria 1479
381 Ga0501032_0034302 3300049569 Bacteria 3474
382 Ga0501032_0289098 3300049569 Bacteria 1061
383 Ga0501033_0034003 3300049570 Bacteria 3825
384 Ga0501033_0705756 3300049570 Bacteria 686
385 Ga0501034_0000535 3300049571 Bacteria 60322
386 Ga0501034_0032794 3300049571 Bacteria 5273
387 Ga0501034_0733995 3300049571 Bacteria 884
388 Ga0501036_0005233 3300049572 Bacteria 10495
389 Ga0501037_0015045 3300049573 Bacteria 5691
390 Ga0501038_0026617 3300049574 Bacteria 5150
391 Ga0501039_0043613 3300049575 Bacteria 3464
392 Ga0501039_1135722 3300049575 Bacteria 605
393 Ga0501043_0001094 3300049579 Bacteria 23803
394 Ga0501043_0034048 3300049579 Bacteria 4007
395 Ga0501047_0458218 3300049581 Bacteria 1104
396 Ga0501068_0022106 3300049584 Bacteria 3717
397 Ga0501070_0032768 3300049586 Bacteria 4347
398 Ga0501071_0233369 3300049587 Bacteria 1386
399 Ga0501071_1285436 3300049587 Bacteria 565
400 Ga0501073_0040906 3300049589 Bacteria 3277
401 Ga0501075_1150697 3300049591 Bacteria 589
402 Ga0501076_0350639 3300049592 Bacteria 1212
403 Ga0501207_057200 3300049654 Bacteria 708
404 Ga0501280_027353 3300049776 Bacteria 877
405 Ga0501035_0006646 3300049822 Bacteria 10824
406 Ga0501044_0015254 3300049823 Bacteria 8276
407 nmdc:mga0rr50_132187_c1 3300050513 Bacteria 1999
408 Ga0500573_0344078 3300053140 Bacteria 727
409 Ga0500622_0072213 3300053156 Bacteria 1743
410 Ga0587130_009491 3300059631 Bacteria 938
411 Ga0530510_0989585 3300061734 Bacteria 643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007076 Ga0075435_100247789 Ga0075435_1002477893 121
2 3300050513 nmdc:mga0rr50_132187_c1 nmdc:mga0rr50_132187_c1_500_865 121
3 3300025949 Ga0207667_11054288 Ga0207667_110542882 123
4 3300041404 Ga0439436_0178064 Ga0439436_0178064_92_466 123
5 3300049575 Ga0501039_1135722 Ga0501039_1135722_154_534 123
6 3300049587 Ga0501071_1285436 Ga0501071_1285436_23_403 123
7 3300049591 Ga0501075_1150697 Ga0501075_1150697_82_474 123
8 3300049592 Ga0501076_0350639 Ga0501076_0350639_130_504 123
9 3300061734 Ga0530510_0989585 Ga0530510_0989585_114_488 123
10 iso_pu_bacteria 2842780639 2842782113 123
11 3300021377 Ga0213874_10093023 Ga0213874_100930232 124
12 3300021384 Ga0213876_10315539 Ga0213876_103155392 124
13 3300039437 Ga0436365_0738787 Ga0436365_0738787_947_1324 124
14 3300039450 Ga0436363_1272918 Ga0436363_1272918_2849_3226 124
15 iso_pu_bacteria 2571042365 2572254946 124
16 iso_pu_bacteria 2643221695 2644530666 124
17 3300003323 rootH1_10279069 rootH1_102790695 125
18 3300006237 Ga0097621_101652645 Ga0097621_1016526451 125
19 3300013100 Ga0157373_10029356 Ga0157373_100293564 125
20 3300013104 Ga0157370_10117916 Ga0157370_101179162 125
21 3300015261 Ga0182006_1190782 Ga0182006_11907821 125
22 3300025935 Ga0207709_10000536 Ga0207709_1000053624 125
23 3300025942 Ga0207689_10122284 Ga0207689_101222842 125
24 3300028800 Ga0265338_10075355 Ga0265338_100753554 125
25 3300041486 Ga0451807_0656857 Ga0451807_0656857_85_462 125
26 3300046472 Ga0495580_0297647 Ga0495580_0297647_226_603 125
27 3300048913 Ga0496110_0478589 Ga0496110_0478589_433_810 125
28 3300048925 Ga0496122_0483738 Ga0496122_0483738_200_577 125
29 3300048926 Ga0496123_0329517 Ga0496123_0329517_219_596 125
30 3300048928 Ga0496125_0450325 Ga0496125_0450325_128_505 125
31 3300053140 Ga0500573_0344078 Ga0500573_0344078_223_600 125
32 3300059631 Ga0587130_009491 Ga0587130_009491_51_431 125
33 3300005331 Ga0070670_100615261 Ga0070670_1006152612 126
34 3300005331 Ga0070670_101004835 Ga0070670_1010048351 126
35 3300005335 Ga0070666_10000825 Ga0070666_1000082516 126
36 3300005337 Ga0070682_100467482 Ga0070682_1004674822 126
37 3300005338 Ga0068868_100001561 Ga0068868_1000015615 126
38 3300005340 Ga0070689_100534554 Ga0070689_1005345541 126
39 3300005354 Ga0070675_102258889 Ga0070675_1022588891 126
40 3300005355 Ga0070671_100000950 Ga0070671_1000009503 126
41 3300005355 Ga0070671_100044356 Ga0070671_1000443563 126
42 3300005367 Ga0070667_100539486 Ga0070667_1005394862 126
43 3300005434 Ga0070709_10569546 Ga0070709_105695462 126
44 3300005436 Ga0070713_100003100 Ga0070713_1000031002 126
45 3300005437 Ga0070710_10005099 Ga0070710_100050995 126
46 3300005439 Ga0070711_100000263 Ga0070711_10000026317 126
47 3300005440 Ga0070705_100044385 Ga0070705_1000443852 126
48 3300005445 Ga0070708_100930663 Ga0070708_1009306632 126
49 3300005456 Ga0070678_100000129 Ga0070678_10000012911 126
50 3300005458 Ga0070681_10001479 Ga0070681_100014795 126
51 3300005459 Ga0068867_100218077 Ga0068867_1002180772 126
52 3300005467 Ga0070706_100696817 Ga0070706_1006968171 126
53 3300005467 Ga0070706_100819642 Ga0070706_1008196421 126
54 3300005530 Ga0070679_100135880 Ga0070679_1001358802 126
55 3300005539 Ga0068853_100171111 Ga0068853_1001711112 126
56 3300005546 Ga0070696_100579174 Ga0070696_1005791742 126
57 3300005548 Ga0070665_100031450 Ga0070665_1000314505 126
58 3300005614 Ga0068856_100020067 Ga0068856_1000200672 126
59 3300005615 Ga0070702_101276108 Ga0070702_1012761082 126
60 3300005718 Ga0068866_10006495 Ga0068866_100064952 126
61 3300005841 Ga0068863_100039647 Ga0068863_1000396472 126
62 3300005842 Ga0068858_100004518 Ga0068858_10000451812 126
63 3300005843 Ga0068860_100006186 Ga0068860_10000618611 126
64 3300006163 Ga0070715_10001731 Ga0070715_100017312 126
65 3300006163 Ga0070715_10033305 Ga0070715_100333052 126
66 3300006173 Ga0070716_100021192 Ga0070716_1000211922 126
67 3300006173 Ga0070716_100098734 Ga0070716_1000987342 126
68 3300006358 Ga0068871_102096733 Ga0068871_1020967332 126
69 3300006881 Ga0068865_100018826 Ga0068865_1000188262 126
70 3300006931 Ga0097620_101664154 Ga0097620_1016641542 126
71 3300009098 Ga0105245_10163320 Ga0105245_101633202 126
72 3300009148 Ga0105243_10755002 Ga0105243_107550022 126
73 3300009174 Ga0105241_10003120 Ga0105241_1000312011 126
74 3300009176 Ga0105242_10008904 Ga0105242_100089049 126
75 3300009177 Ga0105248_10010045 Ga0105248_1001004510 126
76 3300009177 Ga0105248_10534513 Ga0105248_105345132 126
77 3300009545 Ga0105237_10022049 Ga0105237_100220494 126
78 3300009551 Ga0105238_11135824 Ga0105238_111358242 126
79 3300009553 Ga0105249_11822731 Ga0105249_118227311 126
80 3300012492 Ga0157335_1011157 Ga0157335_10111572 126
81 3300013296 Ga0157374_10001326 Ga0157374_1000132611 126
82 3300013297 Ga0157378_10004724 Ga0157378_100047244 126
83 3300013308 Ga0157375_10021432 Ga0157375_100214326 126
84 3300014325 Ga0163163_10607305 Ga0163163_106073052 126
85 3300014325 Ga0163163_10643692 Ga0163163_106436922 126
86 3300014325 Ga0163163_12630490 Ga0163163_126304901 126
87 3300014968 Ga0157379_10026260 Ga0157379_100262602 126
88 3300014969 Ga0157376_10031733 Ga0157376_100317333 126
89 3300025899 Ga0207642_10014798 Ga0207642_100147982 126
90 3300025903 Ga0207680_10636523 Ga0207680_106365231 126
91 3300025906 Ga0207699_10416568 Ga0207699_104165682 126
92 3300025912 Ga0207707_10015708 Ga0207707_100157082 126
93 3300025915 Ga0207693_10000060 Ga0207693_1000006062 126
94 3300025916 Ga0207663_10342683 Ga0207663_103426832 126
95 3300025921 Ga0207652_10385458 Ga0207652_103854582 126
96 3300025925 Ga0207650_10155386 Ga0207650_101553862 126
97 3300025927 Ga0207687_10422745 Ga0207687_104227452 126
98 3300025928 Ga0207700_10004851 Ga0207700_100048515 126
99 3300025931 Ga0207644_10074772 Ga0207644_100747721 126
100 3300025931 Ga0207644_10082183 Ga0207644_100821833 126
101 3300025934 Ga0207686_10071702 Ga0207686_100717022 126
102 3300025935 Ga0207709_10758142 Ga0207709_107581421 126
103 3300025939 Ga0207665_10010152 Ga0207665_100101522 126
104 3300025942 Ga0207689_10315865 Ga0207689_103158652 126
105 3300025949 Ga0207667_10406925 Ga0207667_104069252 126
106 3300025986 Ga0207658_10014029 Ga0207658_100140292 126
107 3300026035 Ga0207703_10439954 Ga0207703_104399542 126
108 3300026041 Ga0207639_10441697 Ga0207639_104416972 126
109 3300026089 Ga0207648_10169551 Ga0207648_101695512 126
110 3300026095 Ga0207676_10285289 Ga0207676_102852892 126
111 3300026118 Ga0207675_100565865 Ga0207675_1005658652 126
112 3300026121 Ga0207683_10000725 Ga0207683_1000072511 126
113 3300028016 Ga0265354_1000799 Ga0265354_10007994 126
114 3300028023 Ga0265357_1000612 Ga0265357_10006123 126
115 3300028036 Ga0265355_1000292 Ga0265355_10002922 126
116 3300028379 Ga0268266_10102606 Ga0268266_101026062 126
117 3300028381 Ga0268264_10202403 Ga0268264_102024031 126
118 3300030763 Ga0265763_1041217 Ga0265763_10412171 126
119 3300030878 Ga0265770_1000541 Ga0265770_10005414 126
120 3300030878 Ga0265770_1032428 Ga0265770_10324282 126
121 3300030878 Ga0265770_1071912 Ga0265770_10719121 126
122 3300030879 Ga0265765_1004191 Ga0265765_10041912 126
123 3300031010 Ga0265771_1007814 Ga0265771_10078141 126
124 3300031090 Ga0265760_10014238 Ga0265760_100142382 126
125 3300031727 Ga0316576_10043748 Ga0316576_100437484 126
126 3300031727 Ga0316576_10309618 Ga0316576_103096181 126
127 3300031728 Ga0316578_10057209 Ga0316578_100572092 126
128 3300031731 Ga0307405_10806371 Ga0307405_108063712 126
129 3300031733 Ga0316577_10289334 Ga0316577_102893343 126
130 3300031903 Ga0307407_10532970 Ga0307407_105329701 126
131 3300031911 Ga0307412_10964569 Ga0307412_109645692 126
132 3300032002 Ga0307416_100963487 Ga0307416_1009634872 126
133 3300032004 Ga0307414_10443127 Ga0307414_104431272 126
134 3300032005 Ga0307411_10024275 Ga0307411_100242753 126
135 3300032005 Ga0307411_10388017 Ga0307411_103880172 126
136 3300032126 Ga0307415_100122174 Ga0307415_1001221742 126
137 3300032126 Ga0307415_100193675 Ga0307415_1001936752 126
138 3300035086 Ga0373934_0036289 Ga0373934_0036289_965_1345 126
139 3300035111 Ga0373923_0037664 Ga0373923_0037664_1070_1450 126
140 3300035111 Ga0373923_0224311 Ga0373923_0224311_424_804 126
141 3300035119 Ga0373956_0073395 Ga0373956_0073395_701_1081 126
142 3300035120 Ga0373957_0093712 Ga0373957_0093712_628_1008 126
143 3300035398 Ga0316574_0013203 Ga0316574_0013203_2763_3143 126
144 3300035398 Ga0316574_0036639 Ga0316574_0036639_1062_1442 126
145 3300035410 Ga0373924_0246386 Ga0373924_0246386_223_603 126
146 3300035695 Ga0373927_0022208 Ga0373927_0022208_1684_2064 126
147 3300035724 Ga0373933_0542793 Ga0373933_0542793_224_604 126
148 3300035724 Ga0373933_0965391 Ga0373933_0965391_165_545 126
149 3300035725 Ga0373947_0062871 Ga0373947_0062871_505_885 126
150 3300036401 Ga0373937_0144011 Ga0373937_0144011_1023_1403 126
151 3300036647 Ga0316582_0188759 Ga0316582_0188759_378_758 126
152 3300036712 Ga0316584_0101814 Ga0316584_0101814_717_1097 126
153 3300037068 Ga0373925_0054046 Ga0373925_0054046_940_1320 126
154 3300041443 Ga0451789_0433371 Ga0451789_0433371_69_452 126
155 3300041452 Ga0451793_1095447 Ga0451793_1095447_77_457 126
156 3300044673 Ga0453683_0033250 Ga0453683_0033250_2607_2999 126
157 3300044673 Ga0453683_0067409 Ga0453683_0067409_1370_1750 126
158 3300044712 Ga0453684_0028127 Ga0453684_0028127_5048_5440 126
159 3300046459 Ga0495629_0231503 Ga0495629_0231503_142_522 126
160 3300046462 Ga0495651_0337836 Ga0495651_0337836_406_786 126
161 3300046463 Ga0495653_0450959 Ga0495653_0450959_107_487 126
162 3300046516 Ga0495628_0549436 Ga0495628_0549436_252_632 126
163 3300046531 Ga0495665_0158275 Ga0495665_0158275_52_432 126
164 3300046536 Ga0495587_0224446 Ga0495587_0224446_277_657 126
165 3300046539 Ga0495621_0004829 Ga0495621_0004829_2348_2728 126
166 3300046539 Ga0495621_0164498 Ga0495621_0164498_470_856 126
167 3300046615 Ga0495656_0010631 Ga0495656_0010631_2682_3062 126
168 3300046664 Ga0495659_0056640 Ga0495659_0056640_292_672 126
169 3300046675 Ga0495657_0543328 Ga0495657_0543328_124_504 126
170 3300046679 Ga0495623_0223424 Ga0495623_0223424_189_569 126
171 3300047317 Ga0495604_0208052 Ga0495604_0208052_284_664 126
172 3300047317 Ga0495604_0477755 Ga0495604_0477755_142_522 126
173 3300047318 Ga0495636_0015139 Ga0495636_0015139_2289_2669 126
174 3300047318 Ga0495636_0146418 Ga0495636_0146418_650_1030 126
175 3300047319 Ga0495674_0074939 Ga0495674_0074939_2091_2471 126
176 3300048088 Ga0495602_0020932 Ga0495602_0020932_447_827 126
177 3300048088 Ga0495602_0381634 Ga0495602_0381634_107_487 126
178 3300048903 Ga0496100_0159832 Ga0496100_0159832_217_597 126
179 3300048904 Ga0496101_0002352 Ga0496101_0002352_9566_9946 126
180 3300048905 Ga0496102_0189241 Ga0496102_0189241_80_460 126
181 3300048905 Ga0496102_0209341 Ga0496102_0209341_572_952 126
182 3300048906 Ga0496103_0293268 Ga0496103_0293268_617_997 126
183 3300048906 Ga0496103_0462131 Ga0496103_0462131_46_426 126
184 3300048907 Ga0496104_0134776 Ga0496104_0134776_1178_1558 126
185 3300048908 Ga0496105_0028625 Ga0496105_0028625_405_785 126
186 3300048908 Ga0496105_0731644 Ga0496105_0731644_235_615 126
187 3300048910 Ga0496107_0006651 Ga0496107_0006651_4410_4790 126
188 3300048910 Ga0496107_0035766 Ga0496107_0035766_2366_2746 126
189 3300048911 Ga0496108_0006755 Ga0496108_0006755_8075_8455 126
190 3300048912 Ga0496109_0001391 Ga0496109_0001391_6972_7352 126
191 3300048912 Ga0496109_0729662 Ga0496109_0729662_240_620 126
192 3300048913 Ga0496110_0005095 Ga0496110_0005095_9057_9437 126
193 3300048914 Ga0496111_0033934 Ga0496111_0033934_1197_1577 126
194 3300048915 Ga0496112_0090971 Ga0496112_0090971_1786_2166 126
195 3300048916 Ga0496113_0185370 Ga0496113_0185370_492_872 126
196 3300048916 Ga0496113_0192406 Ga0496113_0192406_877_1257 126
197 3300048917 Ga0496114_0003264 Ga0496114_0003264_4003_4383 126
198 3300048918 Ga0496115_0359471 Ga0496115_0359471_335_715 126
199 3300003773 Ga0055537_1000026 Ga0055537_100002626 127
200 3300003773 Ga0055537_1000048 Ga0055537_100004854 127
201 3300003775 Ga0055524_1000005 Ga0055524_1000005183 127
202 3300003784 Ga0055534_1000002 Ga0055534_1000002146 127
203 3300003790 Ga0055528_1000002 Ga0055528_1000002146 127
204 3300005293 Ga0065715_10652733 Ga0065715_106527332 127
205 3300005327 Ga0070658_11107924 Ga0070658_111079241 127
206 3300005331 Ga0070670_100055917 Ga0070670_1000559174 127
207 3300005331 Ga0070670_100373921 Ga0070670_1003739211 127
208 3300005340 Ga0070689_101199240 Ga0070689_1011992402 127
209 3300005366 Ga0070659_101727677 Ga0070659_1017276771 127
210 3300005438 Ga0070701_10755794 Ga0070701_107557941 127
211 3300005459 Ga0068867_100533587 Ga0068867_1005335871 127
212 3300005466 Ga0070685_10856606 Ga0070685_108566062 127
213 3300005543 Ga0070672_100006385 Ga0070672_1000063859 127
214 3300005564 Ga0070664_102340300 Ga0070664_1023403002 127
215 3300009098 Ga0105245_10343164 Ga0105245_103431642 127
216 3300009148 Ga0105243_10877552 Ga0105243_108775522 127
217 3300009176 Ga0105242_11029793 Ga0105242_110297932 127
218 3300009553 Ga0105249_11717872 Ga0105249_117178722 127
219 3300009984 Ga0105029_102163 Ga0105029_1021633 127
220 3300013297 Ga0157378_10244182 Ga0157378_102441822 127
221 3300013308 Ga0157375_10285729 Ga0157375_102857292 127
222 3300013308 Ga0157375_10433159 Ga0157375_104331592 127
223 3300014326 Ga0157380_10046142 Ga0157380_100461423 127
224 3300014745 Ga0157377_10801441 Ga0157377_108014412 127
225 3300014968 Ga0157379_10664349 Ga0157379_106643492 127
226 3300015689 Ga0183360_10001 Ga0183360_100013256 127
227 3300017792 Ga0163161_11164536 Ga0163161_111645362 127
228 3300020075 Ga0206349_1739388 Ga0206349_17393881 127
229 3300025263 Ga0209565_1000001 Ga0209565_1000001599 127
230 3300025273 Ga0209673_1000001 Ga0209673_1000001599 127
231 3300025291 Ga0209675_1000001 Ga0209675_10000011933 127
232 3300025295 Ga0209564_1000001 Ga0209564_10000012095 127
233 3300025299 Ga0209256_1000006 Ga0209256_1000006531 127
234 3300025925 Ga0207650_10668574 Ga0207650_106685742 127
235 3300025927 Ga0207687_11853944 Ga0207687_118539441 127
236 3300025935 Ga0207709_10439099 Ga0207709_104390991 127
237 3300025937 Ga0207669_10080136 Ga0207669_100801363 127
238 3300025940 Ga0207691_11156669 Ga0207691_111566691 127
239 3300025945 Ga0207679_10306153 Ga0207679_103061534 127
240 3300025945 Ga0207679_11876941 Ga0207679_118769411 127
241 3300026023 Ga0207677_10893545 Ga0207677_108935452 127
242 3300026067 Ga0207678_11076218 Ga0207678_110762181 127
243 3300026089 Ga0207648_10086909 Ga0207648_100869092 127
244 3300026118 Ga0207675_102635844 Ga0207675_1026358441 127
245 3300026121 Ga0207683_10367780 Ga0207683_103677803 127
246 3300028794 Ga0307515_10349603 Ga0307515_103496032 127
247 3300031548 Ga0307408_100012320 Ga0307408_1000123203 127
248 3300031901 Ga0307406_10002178 Ga0307406_100021788 127
249 3300031911 Ga0307412_10114423 Ga0307412_101144232 127
250 3300031911 Ga0307412_10147987 Ga0307412_101479872 127
251 3300031995 Ga0307409_100025944 Ga0307409_1000259444 127
252 3300032002 Ga0307416_100621400 Ga0307416_1006214002 127
253 3300032004 Ga0307414_10046633 Ga0307414_100466333 127
254 3300032004 Ga0307414_10105161 Ga0307414_101051613 127
255 3300032004 Ga0307414_10344318 Ga0307414_103443182 127
256 3300032004 Ga0307414_10394551 Ga0307414_103945511 127
257 3300032004 Ga0307414_10714010 Ga0307414_107140102 127
258 3300032004 Ga0307414_10767148 Ga0307414_107671482 127
259 3300032005 Ga0307411_10907641 Ga0307411_109076411 127
260 3300038705 Ga0237819_00598 Ga0237819_00598_1705_2091 127
261 3300041404 Ga0439436_0001376 Ga0439436_0001376_6513_6980 127
262 3300041404 Ga0439436_0021534 Ga0439436_0021534_1356_1739 127
263 3300041406 Ga0439439_0001871 Ga0439439_0001871_11_394 127
264 3300041407 Ga0439447_030263 Ga0439447_030263_306_689 127
265 3300041456 Ga0451795_1344704 Ga0451795_1344704_354_737 127
266 3300041486 Ga0451807_1870589 Ga0451807_1870589_56_439 127
267 3300041512 Ga0451853_2025629 Ga0451853_2025629_1677_2066 127
268 3300041999 Ga0439433_0033443 Ga0439433_0033443_217_684 127
269 3300042006 Ga0439432_059391 Ga0439432_059391_158_541 127
270 3300042007 Ga0439449_0033879 Ga0439449_0033879_299_682 127
271 3300042015 Ga0439462_0115073 Ga0439462_0115073_301_684 127
272 3300042185 Ga0450909_056504 Ga0450909_056504_143_526 127
273 3300044712 Ga0453684_0001398 Ga0453684_0001398_8734_9120 127
274 3300045051 Ga0451576_0000081 Ga0451576_0000081_178786_179172 127
275 3300046501 Ga0495607_0091913 Ga0495607_0091913_1002_1388 127
276 3300046507 Ga0495606_0029542 Ga0495606_0029542_2253_2639 127
277 3300046513 Ga0495616_0020310 Ga0495616_0020310_866_1252 127
278 3300046537 Ga0495598_0027794 Ga0495598_0027794_465_848 127
279 3300046615 Ga0495656_0275049 Ga0495656_0275049_351_734 127
280 3300046616 Ga0495668_0003240 Ga0495668_0003240_5445_5828 127
281 3300046674 Ga0495588_0163001 Ga0495588_0163001_286_669 127
282 3300046684 Ga0495669_0287299 Ga0495669_0287299_181_600 127
283 3300047470 Ga0495681_0051041 Ga0495681_0051041_723_1109 127
284 3300048914 Ga0496111_0965200 Ga0496111_0965200_199_582 127
285 3300048917 Ga0496114_0244107 Ga0496114_0244107_11_394 127
286 3300048921 Ga0496118_0000629 Ga0496118_0000629_54579_54962 127
287 3300048927 Ga0496124_0000822 Ga0496124_0000822_48743_49126 127
288 3300049571 Ga0501034_0000535 Ga0501034_0000535_21684_22067 127
289 3300049571 Ga0501034_0733995 Ga0501034_0733995_231_620 127
290 3300053156 Ga0500622_0072213 Ga0500622_0072213_355_741 127
291 3300002987 JGI25159J45721_1050502 JGI25159J45721_10505021 128
292 3300003187 JGI25151J46595_10025752 JGI25151J46595_100257521 128
293 3300003187 JGI25151J46595_10064240 JGI25151J46595_100642402 128
294 3300003775 Ga0055524_1012893 Ga0055524_10128932 128
295 3300003775 Ga0055524_1015303 Ga0055524_10153032 128
296 3300003781 Ga0055536_1004203 Ga0055536_10042038 128
297 3300003781 Ga0055536_1049238 Ga0055536_10492382 128
298 3300003781 Ga0055536_1050887 Ga0055536_10508872 128
299 3300003784 Ga0055534_1021758 Ga0055534_10217582 128
300 3300003790 Ga0055528_1028219 Ga0055528_10282192 128
301 3300003791 Ga0055530_10002663 Ga0055530_100026635 128
302 3300003791 Ga0055530_10063415 Ga0055530_100634151 128
303 3300003794 Ga0055531_10004927 Ga0055531_100049272 128
304 3300003794 Ga0055531_10006156 Ga0055531_100061567 128
305 3300003794 Ga0055531_10015993 Ga0055531_100159932 128
306 3300003794 Ga0055531_10025311 Ga0055531_100253112 128
307 3300003794 Ga0055531_10036980 Ga0055531_100369802 128
308 3300005289 Ga0065704_10103600 Ga0065704_101036003 128
309 3300005293 Ga0065715_10030246 Ga0065715_100302462 128
310 3300005293 Ga0065715_10160176 Ga0065715_101601762 128
311 3300006048 Ga0075363_100727616 Ga0075363_1007276161 128
312 3300009979 Ga0105032_101844 Ga0105032_1018442 128
313 3300012512 Ga0157327_1036356 Ga0157327_10363562 128
314 3300014326 Ga0157380_10074521 Ga0157380_100745212 128
315 3300025273 Ga0209673_1012557 Ga0209673_10125572 128
316 3300025291 Ga0209675_1009702 Ga0209675_10097022 128
317 3300025291 Ga0209675_1013574 Ga0209675_10135743 128
318 3300025291 Ga0209675_1024145 Ga0209675_10241453 128
319 3300025292 Ga0209676_1001618 Ga0209676_100161810 128
320 3300025292 Ga0209676_1003150 Ga0209676_10031504 128
321 3300025292 Ga0209676_1003842 Ga0209676_100384210 128
322 3300025292 Ga0209676_1004893 Ga0209676_10048932 128
323 3300025292 Ga0209676_1007625 Ga0209676_10076252 128
324 3300025294 Ga0209025_1002068 Ga0209025_10020682 128
325 3300025294 Ga0209025_1019043 Ga0209025_10190432 128
326 3300025294 Ga0209025_1058085 Ga0209025_10580851 128
327 3300025294 Ga0209025_1101801 Ga0209025_11018011 128
328 3300025295 Ga0209564_1009131 Ga0209564_10091313 128
329 3300025297 Ga0209758_1068029 Ga0209758_10680291 128
330 3300025298 Ga0209050_1002652 Ga0209050_10026528 128
331 3300025298 Ga0209050_1040326 Ga0209050_10403261 128
332 3300025299 Ga0209256_1004471 Ga0209256_10044715 128
333 3300025299 Ga0209256_1006494 Ga0209256_10064945 128
334 3300025299 Ga0209256_1013829 Ga0209256_10138292 128
335 3300025304 Ga0209257_1000210 Ga0209257_1000210116 128
336 3300025304 Ga0209257_1001873 Ga0209257_10018734 128
337 3300025304 Ga0209257_1004162 Ga0209257_100416214 128
338 3300025304 Ga0209257_1011128 Ga0209257_10111283 128
339 3300025304 Ga0209257_1013848 Ga0209257_10138483 128
340 3300025304 Ga0209257_1019441 Ga0209257_10194412 128
341 3300027360 Ga0209969_1008947 Ga0209969_10089472 128
342 3300027462 Ga0210000_1022795 Ga0210000_10227951 128
343 3300027543 Ga0209999_1001283 Ga0209999_10012832 128
344 3300027552 Ga0209982_1000376 Ga0209982_10003763 128
345 3300027614 Ga0209970_1001376 Ga0209970_10013763 128
346 3300027665 Ga0209983_1004588 Ga0209983_10045883 128
347 3300027665 Ga0209983_1007465 Ga0209983_10074651 128
348 3300027682 Ga0209971_1002037 Ga0209971_10020377 128
349 3300027682 Ga0209971_1004083 Ga0209971_10040832 128
350 3300027876 Ga0209974_10007276 Ga0209974_100072762 128
351 3300027876 Ga0209974_10135883 Ga0209974_101358832 128
352 3300030745 Ga0316182_1368861 Ga0316182_13688612 128
353 3300031548 Ga0307408_100293681 Ga0307408_1002936812 128
354 3300031548 Ga0307408_100372699 Ga0307408_1003726992 128
355 3300031731 Ga0307405_10401965 Ga0307405_104019652 128
356 3300031824 Ga0307413_10302127 Ga0307413_103021272 128
357 3300031852 Ga0307410_10627765 Ga0307410_106277652 128
358 3300031852 Ga0307410_10815986 Ga0307410_108159862 128
359 3300031901 Ga0307406_10427823 Ga0307406_104278232 128
360 3300031901 Ga0307406_10592671 Ga0307406_105926711 128
361 3300031901 Ga0307406_10689744 Ga0307406_106897441 128
362 3300031903 Ga0307407_10117543 Ga0307407_101175431 128
363 3300031911 Ga0307412_11899707 Ga0307412_118997071 128
364 3300031995 Ga0307409_100177474 Ga0307409_1001774742 128
365 3300032002 Ga0307416_100608686 Ga0307416_1006086862 128
366 3300032004 Ga0307414_10355238 Ga0307414_103552381 128
367 3300032004 Ga0307414_10511334 Ga0307414_105113341 128
368 3300032005 Ga0307411_10371174 Ga0307411_103711742 128
369 3300032005 Ga0307411_10525994 Ga0307411_105259942 128
370 3300032005 Ga0307411_11407705 Ga0307411_114077052 128
371 3300032126 Ga0307415_100224906 Ga0307415_1002249062 128
372 3300037471 Ga0395905_0581818 Ga0395905_0581818_89_475 128
373 3300041404 Ga0439436_0017691 Ga0439436_0017691_985_1371 128
374 3300041404 Ga0439436_0037635 Ga0439436_0037635_888_1274 128
375 3300041406 Ga0439439_0136562 Ga0439439_0136562_221_607 128
376 3300041413 Ga0439465_0155875 Ga0439465_0155875_51_443 128
377 3300041486 Ga0451807_2654781 Ga0451807_2654781_257_643 128
378 3300041512 Ga0451853_1550552 Ga0451853_1550552_26_412 128
379 3300041999 Ga0439433_0212039 Ga0439433_0212039_59_445 128
380 3300042006 Ga0439432_003803 Ga0439432_003803_3453_3839 128
381 3300042006 Ga0439432_015617 Ga0439432_015617_1010_1396 128
382 3300042007 Ga0439449_0005960 Ga0439449_0005960_454_840 128
383 3300042007 Ga0439449_0011350 Ga0439449_0011350_430_816 128
384 3300042007 Ga0439449_0012611 Ga0439449_0012611_1392_1778 128
385 3300046615 Ga0495656_0002671 Ga0495656_0002671_2082_2492 128
386 3300046615 Ga0495656_0078950 Ga0495656_0078950_219_611 128
387 3300046664 Ga0495659_0019143 Ga0495659_0019143_304_696 128
388 3300046691 Ga0495670_0171504 Ga0495670_0171504_706_1104 128
389 3300048903 Ga0496100_0131565 Ga0496100_0131565_747_1133 128
390 3300048913 Ga0496110_0515577 Ga0496110_0515577_691_1077 128
391 3300048928 Ga0496125_0062431 Ga0496125_0062431_1205_1591 128
392 3300049514 Ga0501291_132842 Ga0501291_132842_76_462 128
393 3300049568 Ga0501031_0027291 Ga0501031_0027291_3060_3446 128
394 3300049568 Ga0501031_0158483 Ga0501031_0158483_31_417 128
395 3300049569 Ga0501032_0034302 Ga0501032_0034302_1875_2261 128
396 3300049569 Ga0501032_0289098 Ga0501032_0289098_591_977 128
397 3300049570 Ga0501033_0034003 Ga0501033_0034003_1087_1473 128
398 3300049570 Ga0501033_0705756 Ga0501033_0705756_116_502 128
399 3300049571 Ga0501034_0032794 Ga0501034_0032794_3099_3485 128
400 3300049572 Ga0501036_0005233 Ga0501036_0005233_7904_8290 128
401 3300049573 Ga0501037_0015045 Ga0501037_0015045_3230_3616 128
402 3300049574 Ga0501038_0026617 Ga0501038_0026617_1949_2335 128
403 3300049575 Ga0501039_0043613 Ga0501039_0043613_1086_1472 128
404 3300049579 Ga0501043_0001094 Ga0501043_0001094_22767_23243 128
405 3300049579 Ga0501043_0034048 Ga0501043_0034048_2500_2886 128
406 3300049581 Ga0501047_0458218 Ga0501047_0458218_158_544 128
407 3300049584 Ga0501068_0022106 Ga0501068_0022106_3230_3616 128
408 3300049586 Ga0501070_0032768 Ga0501070_0032768_1711_2097 128
409 3300049587 Ga0501071_0233369 Ga0501071_0233369_401_787 128
410 3300049589 Ga0501073_0040906 Ga0501073_0040906_1150_1536 128
411 3300049654 Ga0501207_057200 Ga0501207_057200_223_609 128
412 3300049776 Ga0501280_027353 Ga0501280_027353_299_685 128
413 3300049822 Ga0501035_0006646 Ga0501035_0006646_6830_7216 128
414 3300049823 Ga0501044_0015254 Ga0501044_0015254_4653_5039 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

37

140

0.86

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

41

139

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lqb-assembly1.cif.gz_B crystal structure of uncharacterized protein kfla3161 0.8408 1 128
2hbp-assembly1.cif.gz_A solution structure of sla1 homology domain 1 0.8358 90 113
7muw-assembly1.cif.gz_Cf reconstruction of the legionella pneumophila dot/icm t4ss 3dva map 4 0.8187 90 113
5kqj-assembly1.cif.gz_A solution structure of antibiotic-resistance factor ant(2'')-ia reveals substrate-regulated conformation dynamics 0.7924 70 114
1whz-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.7822 78 116
ID Description Score Start End Superfamily
af_E7F8R3_156_236_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8741 90 113 2.30.30.30
af_O45110_151_229_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8533 90 114 2.30.30.30
4lqbB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8401 3 128 3.10.180.10
2hbpA00 Mainly Beta;Roll;SH3 type barrels.;SLA1 homology domain 1 0.8358 90 113 2.30.30.700
4lqbB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8282 3 128 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7K2PXF2-F1-model_v4 Glyoxalase-like domain-containing protein 0.9591 78 115
AF-A0A7K0CTN1-F1-model_v4 Glyoxalase-like domain-containing protein 0.9278 68 115
AF-A0A0R0C9K4-F1-model_v4 Glyoxalase 0.9268 1 128
AF-J7VKV6-F1-model_v4 deleted 0.9217 1 128
AF-A0A699YB87-F1-model_v4 deleted 0.9216 1 128

Feature Viewer

pLDDT pTM Quality
93.87 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map