F438200

General Info

Members Datasets Scaffolds Average Seq Length
413 231 394 444

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939582691|2939584656
Length 504
Sequence PQTAVIVLAAGAGTRMRSATPKMLHTLGGRSMIAHVLHALTALTPSQVVVVVGHGRDLVNAEVNRVAEQTGSSILTVVQEEQLGTGHAVDVGLAGLPDDFTGTVVITTADVPLLGGETLAALAAAHEGAQATILTTTLADPTGYGRIIRDADGAVAAIIEQADADDAQRAIGEINSGVYAFDAAALRSALTRLSTDNAQGELYITDAVAILRADGHTVRAQHIADTTQVSGVNDRVQLAALGAELNRRIIVGHQRAGVTIIDPATTWIDVDVEIGRDTVVHPGTQLLGATWIGADCTIGPDSTLTSMEVGDGASVIRTHGELSVIGAGATVGPFAYLRPGTDLGADGKLGAFVETKNAVIGTGTKVPHLTYVGDADIGEHSNIGASSVFVNYDGETKRRTRIGSHVRTGSDTMFIAPVVIGDGAYTGAGTVVRDDVPPGALAVSAGSQRNIEGWVQRKRPSSPAAEAARLASAAEAARKAAAETVSDDAAEPVSHEDIDPESTP

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
4 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
5 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
6 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
7 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
8 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
9 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
10 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
11 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
12 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
13 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
14 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
15 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
16 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
17 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
18 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
19 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
120 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
121 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
122 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
123 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
132 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
139 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
227 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.4
Metatranscriptomes 0
Isolates 4.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.08
Nodule 0.24
Rhizoplane 3.39
Rhizosphere 82.57
Stem 0
Stem Tuber 0
Unclassified 8.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10026772 3300003320 Bacteria 3832
2 Ga0055540_1004226 3300003792 Bacteria 6598
3 Ga0070658_10068213 3300005327 Bacteria 2907
4 Ga0070683_100002053 3300005329 Bacteria 15880
5 Ga0070683_100013981 3300005329 Bacteria 7011
6 Ga0070670_100009304 3300005331 Bacteria 8393
7 Ga0068869_100000800 3300005334 Bacteria 17959
8 Ga0068868_100000260 3300005338 Bacteria 35922
9 Ga0068868_100061181 3300005338 Bacteria 2982
10 Ga0070661_100000465 3300005344 Bacteria 30986
11 Ga0070668_100013630 3300005347 Bacteria 6070
12 Ga0070669_100035472 3300005353 Bacteria 3614
13 Ga0070671_100002343 3300005355 Bacteria 14628
14 Ga0070667_100000556 3300005367 Bacteria 37028
15 Ga0070667_100000791 3300005367 Bacteria 29649
16 Ga0070667_100055913 3300005367 Bacteria 3332
17 Ga0070714_100003669 3300005435 Bacteria 11491
18 Ga0070714_100003886 3300005435 Bacteria 11221
19 Ga0070713_100055177 3300005436 Bacteria 3300
20 Ga0070710_10034345 3300005437 Bacteria 2759
21 Ga0070706_100022612 3300005467 Bacteria 5789
22 Ga0070698_100003484 3300005471 Bacteria 17319
23 Ga0070684_100001193 3300005535 Bacteria 18667
24 Ga0070684_100004335 3300005535 Bacteria 10782
25 Ga0070684_100110204 3300005535 Bacteria 2468
26 Ga0068853_100000152 3300005539 Bacteria 47430
27 Ga0068853_100154083 3300005539 Bacteria 2070
28 Ga0070665_100005840 3300005548 Bacteria 12627
29 Ga0068855_100008957 3300005563 Bacteria 12099
30 Ga0068855_100030369 3300005563 Bacteria 6464
31 Ga0068857_100000969 3300005577 Bacteria 21932
32 Ga0068857_100001491 3300005577 Bacteria 18629
33 Ga0068856_100001256 3300005614 Bacteria 26663
34 Ga0068856_100003279 3300005614 Bacteria 16453
35 Ga0068856_100008755 3300005614 Bacteria 9840
36 Ga0068852_100000028 3300005616 Bacteria 113383
37 Ga0068852_100000419 3300005616 Bacteria 28349
38 Ga0068852_100040010 3300005616 Bacteria 3952
39 Ga0068852_100069815 3300005616 Bacteria 3080
40 Ga0068859_100033409 3300005617 Bacteria 5165
41 Ga0068864_100001146 3300005618 Bacteria 22120
42 Ga0068863_100001025 3300005841 Bacteria 27909
43 Ga0068863_100001329 3300005841 Bacteria 24634
44 Ga0068858_100003222 3300005842 Bacteria 16289
45 Ga0068858_100016818 3300005842 Bacteria 6869
46 Ga0068860_100000087 3300005843 Bacteria 158242
47 Ga0068860_100000402 3300005843 Bacteria 56413
48 Ga0068862_100000077 3300005844 Bacteria 116781
49 Ga0081455_10038324 3300005937 Bacteria 4245
50 Ga0070717_10104982 3300006028 Bacteria 2404
51 Ga0075365_10057850 3300006038 Bacteria 2580
52 Ga0075365_10088145 3300006038 Bacteria 2111
53 Ga0075365_10130418 3300006038 Bacteria 1739
54 Ga0075363_100052419 3300006048 Bacteria 2178
55 Ga0075364_10001414 3300006051 Bacteria 13011
56 Ga0075364_10008782 3300006051 Bacteria 6047
57 Ga0075369_10013804 3300006186 Bacteria 3214
58 Ga0075369_10030188 3300006186 Bacteria 2281
59 Ga0097621_100008871 3300006237 Bacteria 7270
60 Ga0097621_100200678 3300006237 Bacteria 1731
61 Ga0068871_100000709 3300006358 Bacteria 22603
62 Ga0075428_100000631 3300006844 Bacteria 36078
63 Ga0075428_100017906 3300006844 Bacteria 7829
64 Ga0075430_100085345 3300006846 Bacteria 2644
65 Ga0075431_100000069 3300006847 Bacteria 59736
66 Ga0075431_100014094 3300006847 Bacteria 8082
67 Ga0097620_100033410 3300006931 Bacteria 5165
68 Ga0105240_10000130 3300009093 Bacteria 154390
69 Ga0105240_10004663 3300009093 Bacteria 20744
70 Ga0105240_10004717 3300009093 Bacteria 20577
71 Ga0105240_10014173 3300009093 Bacteria 10889
72 Ga0105240_10028931 3300009093 Bacteria 7228
73 Ga0105240_10099140 3300009093 Bacteria 3547
74 Ga0111539_10011076 3300009094 Bacteria 11346
75 Ga0105245_10000513 3300009098 Bacteria 35501
76 Ga0105245_10044791 3300009098 Unclassified 3950
77 Ga0105247_10000060 3300009101 Bacteria 127879
78 Ga0105247_10000593 3300009101 Bacteria 29374
79 Ga0105241_10000413 3300009174 Bacteria 32308
80 Ga0105241_10000899 3300009174 Bacteria 22474
81 Ga0105241_10001581 3300009174 Bacteria 17418
82 Ga0105241_10002059 3300009174 Bacteria 15191
83 Ga0105241_10064197 3300009174 Bacteria 2834
84 Ga0105248_10000050 3300009177 Bacteria 152667
85 Ga0105248_10004134 3300009177 Bacteria 16057
86 Ga0105237_10002531 3300009545 Bacteria 22627
87 Ga0105237_10003582 3300009545 Bacteria 18371
88 Ga0105238_10000811 3300009551 Bacteria 32377
89 Ga0105238_10001260 3300009551 Bacteria 25455
90 Ga0105238_10006252 3300009551 Bacteria 11832
91 Ga0105238_10089397 3300009551 Bacteria 3067
92 Ga0105249_10000042 3300009553 Bacteria 195242
93 Ga0105239_10001400 3300010375 Bacteria 32307
94 Ga0105239_10004315 3300010375 Bacteria 17049
95 Ga0105239_10006021 3300010375 Bacteria 14112
96 Ga0105239_10228958 3300010375 Bacteria 2085
97 Ga0105246_10000107 3300011119 Bacteria 36702
98 Ga0157369_10001886 3300013105 Bacteria 25283
99 Ga0157369_10005366 3300013105 Bacteria 14928
100 Ga0157369_10045057 3300013105 Bacteria 4799
101 Ga0157369_10117732 3300013105 Bacteria 2820
102 Ga0157369_10134238 3300013105 Bacteria 2621
103 Ga0157374_10002747 3300013296 Bacteria 14789
104 Ga0157374_10004223 3300013296 Bacteria 12077
105 Ga0157374_10137643 3300013296 Bacteria 2368
106 Ga0157378_10002169 3300013297 Bacteria 17423
107 Ga0157378_10021534 3300013297 Bacteria 5670
108 Ga0157378_10047880 3300013297 Unclassified 3801
109 Ga0163162_10152298 3300013306 Bacteria 2431
110 Ga0163162_10301216 3300013306 Bacteria 1735
111 Ga0157372_10004183 3300013307 Bacteria 15450
112 Ga0157372_10099769 3300013307 Bacteria 3313
113 Ga0157372_10102003 3300013307 Bacteria 3277
114 Ga0157375_10000409 3300013308 Bacteria 38902
115 Ga0157375_10028258 3300013308 Bacteria 5254
116 Ga0157379_10000269 3300014968 Bacteria 40897
117 Ga0157379_10095677 3300014968 Bacteria 2665
118 Ga0157376_10000550 3300014969 Bacteria 24090
119 Ga0213876_10002110 3300021384 Bacteria 11766
120 Ga0209673_1008342 3300025273 Bacteria 4620
121 Ga0209051_1001345 3300025303 Bacteria 21360
122 Ga0209051_1003362 3300025303 Bacteria 10530
123 Ga0209051_1027756 3300025303 Bacteria 2250
124 Ga0207710_10000010 3300025900 Bacteria 482087
125 Ga0207710_10000588 3300025900 Bacteria 21466
126 Ga0207705_10020886 3300025909 Bacteria 4673
127 Ga0207705_10054293 3300025909 Bacteria 2888
128 Ga0207654_10000359 3300025911 Bacteria 26847
129 Ga0207654_10000599 3300025911 Bacteria 20310
130 Ga0207654_10001829 3300025911 Bacteria 11031
131 Ga0207695_10000035 3300025913 Bacteria 486590
132 Ga0207695_10000119 3300025913 Bacteria 235221
133 Ga0207695_10000292 3300025913 Bacteria 123721
134 Ga0207695_10000998 3300025913 Bacteria 50094
135 Ga0207695_10015396 3300025913 Bacteria 9003
136 Ga0207695_10039881 3300025913 Bacteria 5043
137 Ga0207695_10106413 3300025913 Bacteria 2791
138 Ga0207671_10000047 3300025914 Bacteria 196307
139 Ga0207671_10000238 3300025914 Bacteria 82806
140 Ga0207671_10000830 3300025914 Bacteria 39238
141 Ga0207649_10000650 3300025920 Bacteria 23191
142 Ga0207681_10034834 3300025923 Bacteria 3313
143 Ga0207694_10000089 3300025924 Bacteria 103520
144 Ga0207694_10000934 3300025924 Bacteria 25855
145 Ga0207694_10062317 3300025924 Bacteria 2904
146 Ga0207650_10002624 3300025925 Bacteria 12437
147 Ga0207687_10000707 3300025927 Bacteria 22619
148 Ga0207687_10069959 3300025927 Bacteria 2504
149 Ga0207664_10015808 3300025929 Bacteria 5491
150 Ga0207644_10002255 3300025931 Bacteria 12508
151 Ga0207711_10001406 3300025941 Bacteria 22551
152 Ga0207711_10004360 3300025941 Bacteria 12073
153 Ga0207689_10000163 3300025942 Bacteria 57617
154 Ga0207661_10104221 3300025944 Bacteria 2388
155 Ga0207667_10001714 3300025949 Bacteria 27583
156 Ga0207667_10014789 3300025949 Bacteria 8879
157 Ga0207712_10000010 3300025961 Bacteria 455972
158 Ga0207668_10002892 3300025972 Bacteria 10073
159 Ga0207658_10000076 3300025986 Bacteria 108585
160 Ga0207658_10000677 3300025986 Bacteria 29704
161 Ga0207677_10000055 3300026023 Bacteria 98214
162 Ga0207703_10009823 3300026035 Bacteria 7505
163 Ga0207703_10009922 3300026035 Bacteria 7471
164 Ga0207639_10000103 3300026041 Bacteria 70103
165 Ga0207702_10000782 3300026078 Bacteria 33667
166 Ga0207702_10001505 3300026078 Bacteria 23043
167 Ga0207702_10011205 3300026078 Bacteria 7478
168 Ga0207641_10000457 3300026088 Bacteria 46657
169 Ga0207641_10000849 3300026088 Bacteria 32380
170 Ga0207676_10002880 3300026095 Bacteria 12259
171 Ga0207674_10000840 3300026116 Bacteria 40031
172 Ga0207674_10003714 3300026116 Bacteria 18637
173 Ga0207683_10018755 3300026121 Bacteria 5903
174 Ga0207698_10000160 3300026142 Bacteria 43055
175 Ga0207698_10000575 3300026142 Bacteria 21456
176 Ga0207698_10108364 3300026142 Bacteria 2322
177 Ga0209970_1001034 3300027614 Bacteria 4924
178 Ga0209998_10000082 3300027717 Bacteria 37343
179 Ga0209974_10001015 3300027876 Bacteria 9913
180 Ga0207428_10129849 3300027907 Bacteria 1929
181 Ga0268266_10090662 3300028379 Bacteria 2679
182 Ga0268265_10000014 3300028380 Bacteria 330186
183 Ga0268264_10000150 3300028381 Bacteria 158263
184 Ga0268264_10000795 3300028381 Bacteria 34167
185 Ga0265337_1001931 3300028556 Bacteria 9857
186 Ga0265326_10002013 3300028558 Bacteria 6951
187 Ga0265319_1001695 3300028563 Bacteria 12725
188 Ga0265318_10000586 3300028577 Bacteria 25566
189 Ga0265336_10000001 3300028666 Bacteria 916179
190 Ga0265338_10000004 3300028800 Bacteria 644793
191 Ga0265340_10000002 3300031247 Bacteria 711693
192 Ga0265327_10000128 3300031251 Bacteria 165601
193 Ga0265327_10001742 3300031251 Bacteria 25763
194 Ga0265316_10041361 3300031344 Bacteria 3689
195 Ga0265316_10162732 3300031344 Bacteria 1668
196 Ga0316576_10001527 3300031727 Bacteria 12531
197 Ga0316578_10070183 3300031728 Bacteria 2074
198 Ga0316578_10081492 3300031728 Bacteria 1925
199 Ga0307406_10009897 3300031901 Bacteria 5367
200 Ga0316583_10006387 3300032133 Bacteria 4232
201 Ga0316582_0023195 3300036647 Bacteria 3695
202 Ga0316584_0017797 3300036712 Bacteria 5117
203 Ga0316581_0021191 3300037588 Bacteria 1907
204 Ga0436364_0412886 3300037853 Bacteria 4147
205 Ga0436364_1308388 3300037853 Bacteria 35210
206 Ga0436365_0979604 3300039437 Bacteria 3882
207 Ga0436365_1646946 3300039437 Bacteria 25220
208 Ga0436365_1897965 3300039437 Bacteria 2246
209 Ga0439465_0002904 3300041413 Bacteria 5617
210 Ga0451793_0689373 3300041452 Bacteria 4462
211 Ga0451843_0145349 3300041509 Bacteria 1881
212 Ga0439445_0013860 3300042004 Bacteria 1956
213 Ga0439434_0004061 3300042435 Bacteria 4273
214 Ga0451577_0084912 3300042876 Bacteria 2825
215 Ga0466969_0032861 3300044656 Bacteria 2636
216 Ga0466972_0002574 3300044658 Bacteria 8985
217 Ga0466972_0021251 3300044658 Bacteria 3238
218 Ga0466965_0000697 3300044683 Bacteria 12460
219 Ga0466965_0014231 3300044683 Bacteria 3764
220 Ga0466966_0001105 3300044684 Bacteria 17291
221 Ga0466966_0001218 3300044684 Bacteria 16526
222 Ga0466966_0075255 3300044684 Bacteria 2110
223 Ga0466961_0001949 3300044693 Bacteria 12864
224 Ga0466963_0001937 3300044694 Bacteria 11342
225 Ga0466963_0008234 3300044694 Bacteria 6248
226 Ga0466963_0012616 3300044694 Bacteria 5176
227 Ga0453684_0044426 3300044712 Bacteria 5945
228 Ga0466968_0001182 3300044735 Bacteria 9248
229 Ga0466968_0001521 3300044735 Bacteria 8322
230 Ga0466970_0035880 3300044765 Bacteria 2626
231 Ga0466957_0000981 3300044842 Bacteria 14668
232 Ga0466957_0003667 3300044842 Bacteria 8475
233 Ga0466957_0164482 3300044842 Bacteria 1442
234 Ga0466960_0000319 3300044901 Bacteria 16503
235 Ga0466960_0000959 3300044901 Bacteria 10242
236 Ga0466960_0002911 3300044901 Bacteria 6510
237 Ga0466960_0083212 3300044901 Bacteria 1617
238 Ga0466959_0000774 3300045049 Bacteria 18746
239 Ga0466959_0001867 3300045049 Bacteria 13243
240 Ga0466959_0043428 3300045049 Bacteria 3313
241 Ga0466959_0107650 3300045049 Bacteria 1992
242 Ga0466958_0001131 3300045836 Bacteria 12328
243 Ga0466958_0001942 3300045836 Bacteria 10134
244 Ga0466958_0073153 3300045836 Bacteria 2100
245 Ga0466967_0022720 3300045976 Bacteria 5125
246 Ga0466967_0050522 3300045976 Bacteria 3641
247 Ga0466967_0056031 3300045976 Bacteria 3474
248 Ga0466967_0057077 3300045976 Bacteria 3445
249 Ga0495638_0021955 3300046460 Bacteria 4195
250 Ga0495638_0102356 3300046460 Bacteria 1711
251 Ga0495653_0057370 3300046463 Bacteria 2963
252 Ga0495648_0015564 3300046524 Bacteria 5518
253 Ga0495635_0102404 3300046663 Bacteria 1957
254 Ga0495588_0059779 3300046674 Bacteria 1972
255 Ga0495646_0035327 3300046680 Bacteria 3101
256 Ga0495604_0000047 3300047317 Bacteria 109717
257 Ga0495672_0033632 3300047320 Bacteria 3175
258 Ga0495672_0041421 3300047320 Bacteria 2785
259 Ga0495673_0002945 3300047469 Bacteria 11483
260 Ga0495686_0003378 3300047472 Bacteria 13897
261 Ga0496100_0027262 3300048903 Bacteria 3512
262 Ga0496100_0115958 3300048903 Bacteria 1868
263 Ga0496101_0067642 3300048904 Bacteria 2609
264 Ga0496101_0106386 3300048904 Bacteria 2106
265 Ga0496102_0049225 3300048905 Bacteria 3834
266 Ga0496103_0023444 3300048906 Bacteria 3721
267 Ga0496104_0237421 3300048907 Bacteria 1735
268 Ga0496107_0022575 3300048910 Bacteria 4446
269 Ga0496108_0082795 3300048911 Bacteria 2721
270 Ga0496109_0084511 3300048912 Bacteria 2928
271 Ga0496112_0019953 3300048915 Bacteria 6343
272 Ga0496113_0003931 3300048916 Bacteria 9016
273 Ga0496115_0037214 3300048918 Bacteria 3856
274 Ga0496117_0001137 3300048920 Bacteria 40112
275 Ga0496117_0016250 3300048920 Bacteria 6290
276 Ga0496117_0067785 3300048920 Bacteria 2412
277 Ga0496118_0001501 3300048921 Bacteria 34760
278 Ga0496118_0001770 3300048921 Bacteria 31255
279 Ga0496118_0033068 3300048921 Bacteria 4250
280 Ga0496119_0002651 3300048922 Bacteria 19384
281 Ga0496119_0016984 3300048922 Bacteria 5503
282 Ga0496119_0087245 3300048922 Bacteria 1781
283 Ga0496120_0030284 3300048923 Bacteria 3292
284 Ga0496121_0003146 3300048924 Bacteria 23812
285 Ga0496121_0150134 3300048924 Bacteria 1716
286 Ga0496122_0001995 3300048925 Bacteria 30405
287 Ga0496122_0071484 3300048925 Bacteria 2472
288 Ga0496125_0000015 3300048928 Bacteria 516648
289 Ga0496126_0006264 3300048929 Bacteria 13290
290 Ga0496126_0013766 3300048929 Bacteria 8204
291 Ga0501031_0003795 3300049568 Bacteria 9721
292 Ga0501031_0088893 3300049568 Bacteria 2014
293 Ga0501032_0011946 3300049569 Bacteria 6219
294 Ga0501032_0013541 3300049569 Bacteria 5797
295 Ga0501032_0052331 3300049569 Bacteria 2751
296 Ga0501033_0043947 3300049570 Bacteria 3326
297 Ga0501033_0054614 3300049570 Bacteria 2954
298 Ga0501034_0003863 3300049571 Bacteria 16877
299 Ga0501036_0001413 3300049572 Bacteria 18455
300 Ga0501036_0083512 3300049572 Bacteria 2700
301 Ga0501036_0088459 3300049572 Bacteria 2618
302 Ga0501036_0264805 3300049572 Bacteria 1440
303 Ga0501036_0286147 3300049572 Bacteria 1379
304 Ga0501037_0001555 3300049573 Bacteria 16751
305 Ga0501037_0004692 3300049573 Bacteria 9934
306 Ga0501037_0147348 3300049573 Bacteria 1683
307 Ga0501038_0009321 3300049574 Bacteria 9005
308 Ga0501038_0026018 3300049574 Bacteria 5212
309 Ga0501038_0037308 3300049574 Bacteria 4261
310 Ga0501039_0000929 3300049575 Bacteria 21375
311 Ga0501039_0004683 3300049575 Bacteria 10351
312 Ga0501039_0165606 3300049575 Bacteria 1738
313 Ga0501040_0013259 3300049576 Bacteria 5421
314 Ga0501040_0029784 3300049576 Bacteria 3684
315 Ga0501040_0042962 3300049576 Bacteria 3080
316 Ga0501041_0001342 3300049577 Bacteria 13549
317 Ga0501041_0010307 3300049577 Bacteria 5507
318 Ga0501041_0051221 3300049577 Bacteria 2516
319 Ga0501042_0015362 3300049578 Bacteria 5240
320 Ga0501042_0137348 3300049578 Bacteria 1762
321 Ga0501043_0002664 3300049579 Bacteria 14997
322 Ga0501043_0011344 3300049579 Bacteria 6975
323 Ga0501043_0077253 3300049579 Bacteria 2616
324 Ga0501046_0003187 3300049580 Bacteria 15122
325 Ga0501046_0026960 3300049580 Bacteria 4692
326 Ga0501047_0003285 3300049581 Bacteria 15310
327 Ga0501047_0011332 3300049581 Bacteria 8442
328 Ga0501047_0155673 3300049581 Bacteria 2159
329 Ga0501048_0001694 3300049582 Bacteria 16806
330 Ga0501048_0007416 3300049582 Bacteria 8313
331 Ga0501048_0117637 3300049582 Bacteria 1877
332 Ga0501068_0014766 3300049584 Bacteria 4469
333 Ga0501068_0057268 3300049584 Bacteria 2363
334 Ga0501069_0108065 3300049585 Bacteria 1583
335 Ga0501070_0003402 3300049586 Bacteria 13806
336 Ga0501070_0037108 3300049586 Bacteria 4068
337 Ga0501071_0001347 3300049587 Bacteria 14041
338 Ga0501071_0007797 3300049587 Bacteria 7059
339 Ga0501071_0042642 3300049587 Bacteria 3252
340 Ga0501071_0065267 3300049587 Bacteria 2643
341 Ga0501072_0001073 3300049588 Bacteria 20313
342 Ga0501072_0004896 3300049588 Bacteria 10186
343 Ga0501072_0006049 3300049588 Bacteria 9234
344 Ga0501072_0056876 3300049588 Bacteria 3082
345 Ga0501072_0112423 3300049588 Bacteria 2168
346 Ga0501074_0001828 3300049590 Bacteria 14567
347 Ga0501075_0007876 3300049591 Bacteria 7397
348 Ga0501075_0011017 3300049591 Bacteria 6381
349 Ga0501075_0012090 3300049591 Bacteria 6127
350 Ga0501075_0059978 3300049591 Bacteria 2867
351 Ga0501076_0019047 3300049592 Bacteria 5236
352 Ga0501077_0032460 3300049593 Bacteria 3323
353 Ga0501077_0093252 3300049593 Bacteria 1908
354 Ga0501077_0105763 3300049593 Bacteria 1783
355 Ga0501079_0004833 3300049741 Bacteria 9981
356 Ga0501079_0019952 3300049741 Bacteria 5121
357 Ga0501079_0087335 3300049741 Bacteria 2414
358 Ga0501080_0025779 3300049742 Bacteria 5461
359 Ga0501080_0108483 3300049742 Bacteria 2573
360 Ga0501081_0002359 3300049743 Bacteria 11894
361 Ga0501081_0100848 3300049743 Bacteria 2041
362 Ga0501081_0137995 3300049743 Bacteria 1746
363 Ga0501083_0114251 3300049744 Bacteria 1773
364 Ga0501083_0158195 3300049744 Bacteria 1482
365 Ga0501035_0000497 3300049822 Bacteria 44253
366 Ga0501035_0013669 3300049822 Bacteria 7489
367 Ga0501035_0102581 3300049822 Bacteria 2509
368 Ga0501044_0007277 3300049823 Bacteria 12164
369 Ga0501044_0035022 3300049823 Bacteria 5259
370 Ga0501044_0042930 3300049823 Bacteria 4700
371 Ga0501045_0000930 3300049824 Bacteria 19127
372 nmdc:mga03n38_15418_c1 3300050490 Bacteria 2950
373 nmdc:mga03n38_16949_c1 3300050490 Bacteria 2844
374 nmdc:mga0yw44_8245_c1 3300050492 Bacteria 5178
375 nmdc:mga06z11_67686_c1 3300050494 Bacteria 1880
376 nmdc:mga05p37_90630_c1 3300050507 Bacteria 3768
377 nmdc:mga09592_2876_c1 3300050508 Bacteria 13953
378 nmdc:mga0qj67_10802_c1 3300050509 Bacteria 6829
379 nmdc:mga06r32_332_c1 3300050510 Bacteria 39263
380 nmdc:mga08y16_13049_c1 3300050511 Bacteria 8741
381 Ga0500643_003561 3300053087 Bacteria 7411
382 Ga0500643_010167 3300053087 Bacteria 3529
383 Ga0500652_008367 3300053131 Bacteria 3444
384 Ga0500645_000490 3300053730 Bacteria 26762
385 Ga0501084_0113323 3300054114 Bacteria 2279
386 Ga0501084_0121113 3300054114 Bacteria 2200
387 Ga0501082_0039974 3300060353 Bacteria 4046
388 Ga0501082_0097214 3300060353 Bacteria 2545
389 Ga0466962_0057087 3300061719 Bacteria 1864
390 Ga0530510_0008961 3300061734 Bacteria 7010
391 Ga0530510_0017209 3300061734 Bacteria 5121
392 Ga0530510_0019727 3300061734 Bacteria 4789
393 Ga0530510_0130373 3300061734 Bacteria 1849
394 Ga0530510_0173752 3300061734 Bacteria 1596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0147348 Ga0501037_0147348_527_1666 275
2 3300061719 Ga0466962_0057087 Ga0466962_0057087_604_1845 278
3 3300037588 Ga0316581_0021191 Ga0316581_0021191_507_1895 279
4 3300044842 Ga0466957_0164482 Ga0466957_0164482_162_1418 290
5 3300005467 Ga0070706_100022612 Ga0070706_1000226122 306
6 3300005471 Ga0070698_100003484 Ga0070698_1000034848 306
7 3300006237 Ga0097621_100008871 Ga0097621_1000088714 310
8 3300049585 Ga0501069_0108065 Ga0501069_0108065_285_1529 310
9 3300036647 Ga0316582_0023195 Ga0316582_0023195_1872_3356 311
10 3300031251 Ga0265327_10001742 Ga0265327_100017427 312
11 3300005353 Ga0070669_100035472 Ga0070669_1000354724 315
12 3300005367 Ga0070667_100000791 Ga0070667_10000079119 315
13 3300005617 Ga0068859_100033409 Ga0068859_1000334094 315
14 3300005841 Ga0068863_100001025 Ga0068863_10000102517 315
15 3300005842 Ga0068858_100016818 Ga0068858_1000168183 315
16 3300005843 Ga0068860_100000087 Ga0068860_10000008720 315
17 3300005844 Ga0068862_100000077 Ga0068862_10000007775 315
18 3300006931 Ga0097620_100033410 Ga0097620_1000334104 315
19 3300009101 Ga0105247_10000060 Ga0105247_1000006076 315
20 3300009177 Ga0105248_10000050 Ga0105248_1000005015 315
21 3300009553 Ga0105249_10000042 Ga0105249_10000042138 315
22 3300013306 Ga0163162_10301216 Ga0163162_103012161 315
23 3300014968 Ga0157379_10095677 Ga0157379_100956772 315
24 3300025900 Ga0207710_10000010 Ga0207710_1000001078 315
25 3300025923 Ga0207681_10034834 Ga0207681_100348342 315
26 3300025941 Ga0207711_10001406 Ga0207711_1000140621 315
27 3300025961 Ga0207712_10000010 Ga0207712_10000010313 315
28 3300025986 Ga0207658_10000677 Ga0207658_1000067719 315
29 3300026035 Ga0207703_10009823 Ga0207703_100098234 315
30 3300026088 Ga0207641_10000849 Ga0207641_1000084911 315
31 3300028380 Ga0268265_10000014 Ga0268265_10000014140 315
32 3300028381 Ga0268264_10000150 Ga0268264_1000015019 315
33 3300048903 Ga0496100_0115958 Ga0496100_0115958_371_1828 315
34 3300048904 Ga0496101_0106386 Ga0496101_0106386_489_1946 315
35 3300048906 Ga0496103_0023444 Ga0496103_0023444_2088_3545 315
36 3300048910 Ga0496107_0022575 Ga0496107_0022575_2541_3998 315
37 3300048920 Ga0496117_0001137 Ga0496117_0001137_19334_20791 315
38 3300048921 Ga0496118_0001770 Ga0496118_0001770_28892_30349 315
39 3300048922 Ga0496119_0002651 Ga0496119_0002651_16677_18134 315
40 3300048923 Ga0496120_0030284 Ga0496120_0030284_1082_2539 315
41 3300048924 Ga0496121_0003146 Ga0496121_0003146_20790_22247 315
42 3300048929 Ga0496126_0013766 Ga0496126_0013766_2144_3601 315
43 3300046463 Ga0495653_0057370 Ga0495653_0057370_1703_2947 316
44 3300031727 Ga0316576_10001527 Ga0316576_100015275 318
45 3300031728 Ga0316578_10081492 Ga0316578_100814922 318
46 3300032133 Ga0316583_10006387 Ga0316583_100063873 318
47 3300025913 Ga0207695_10015396 Ga0207695_100153967 321
48 3300025949 Ga0207667_10014789 Ga0207667_100147892 321
49 3300045836 Ga0466958_0073153 Ga0466958_0073153_750_2087 322
50 3300013307 Ga0157372_10099769 Ga0157372_100997692 323
51 3300028556 Ga0265337_1001931 Ga0265337_100193111 323
52 3300028558 Ga0265326_10002013 Ga0265326_100020137 323
53 3300028563 Ga0265319_1001695 Ga0265319_10016957 323
54 3300028577 Ga0265318_10000586 Ga0265318_1000058625 323
55 3300028666 Ga0265336_10000001 Ga0265336_10000001470 323
56 3300028800 Ga0265338_10000004 Ga0265338_10000004412 323
57 3300031247 Ga0265340_10000002 Ga0265340_10000002412 323
58 3300031344 Ga0265316_10041361 Ga0265316_100413612 323
59 3300005548 Ga0070665_100005840 Ga0070665_10000584015 324
60 3300009093 Ga0105240_10004717 Ga0105240_100047179 324
61 3300009098 Ga0105245_10044791 Ga0105245_100447913 324
62 3300009174 Ga0105241_10001581 Ga0105241_1000158118 324
63 3300009177 Ga0105248_10004134 Ga0105248_100041347 324
64 3300010375 Ga0105239_10004315 Ga0105239_1000431514 324
65 3300013297 Ga0157378_10047880 Ga0157378_100478804 324
66 3300025913 Ga0207695_10000119 Ga0207695_1000011955 324
67 3300025941 Ga0207711_10004360 Ga0207711_100043607 324
68 3300006844 Ga0075428_100017906 Ga0075428_1000179062 325
69 3300006846 Ga0075430_100085345 Ga0075430_1000853452 325
70 3300027717 Ga0209998_10000082 Ga0209998_1000008233 325
71 3300046680 Ga0495646_0035327 Ga0495646_0035327_817_2199 325
72 3300047317 Ga0495604_0000047 Ga0495604_0000047_62300_63682 325
73 3300013296 Ga0157374_10137643 Ga0157374_101376431 326
74 3300027876 Ga0209974_10001015 Ga0209974_100010158 326
75 3300005338 Ga0068868_100061181 Ga0068868_1000611812 327
76 3300006237 Ga0097621_100200678 Ga0097621_1002006782 327
77 3300009551 Ga0105238_10006252 Ga0105238_100062522 327
78 3300006038 Ga0075365_10130418 Ga0075365_101304182 329
79 3300036712 Ga0316584_0017797 Ga0316584_0017797_253_1671 330
80 3300050490 nmdc:mga03n38_16949_c1 nmdc:mga03n38_16949_c1_14_1435 330
81 3300028379 Ga0268266_10090662 Ga0268266_100906623 331
82 3300049581 Ga0501047_0155673 Ga0501047_0155673_669_2102 331
83 3300006847 Ga0075431_100000069 Ga0075431_1000000693 332
84 3300005435 Ga0070714_100003886 Ga0070714_1000038863 333
85 3300005563 Ga0068855_100030369 Ga0068855_1000303692 333
86 3300005614 Ga0068856_100008755 Ga0068856_1000087558 333
87 3300009093 Ga0105240_10028931 Ga0105240_100289311 333
88 3300013105 Ga0157369_10005366 Ga0157369_100053668 333
89 3300013307 Ga0157372_10004183 Ga0157372_100041838 333
90 3300013307 Ga0157372_10102003 Ga0157372_101020032 333
91 3300025909 Ga0207705_10020886 Ga0207705_100208861 333
92 3300026078 Ga0207702_10011205 Ga0207702_100112053 333
93 3300025929 Ga0207664_10015808 Ga0207664_100158083 334
94 3300005539 Ga0068853_100154083 Ga0068853_1001540831 335
95 3300037853 Ga0436364_1308388 Ga0436364_1308388_13682_15100 335
96 3300039437 Ga0436365_1897965 Ga0436365_1897965_453_1871 335
97 3300048918 Ga0496115_0037214 Ga0496115_0037214_11_1441 336
98 3300048920 Ga0496117_0067785 Ga0496117_0067785_388_1998 339
99 3300048921 Ga0496118_0033068 Ga0496118_0033068_850_2460 339
100 3300048922 Ga0496119_0016984 Ga0496119_0016984_806_2416 339
101 3300048925 Ga0496122_0001995 Ga0496122_0001995_17468_19078 339
102 3300048928 Ga0496125_0000015 Ga0496125_0000015_271317_272927 339
103 3300039437 Ga0436365_0979604 Ga0436365_0979604_127_1599 340
104 3300042876 Ga0451577_0084912 Ga0451577_0084912_130_1503 340
105 3300044712 Ga0453684_0044426 Ga0453684_0044426_957_2330 340
106 3300049569 Ga0501032_0013541 Ga0501032_0013541_1567_2958 340
107 3300049572 Ga0501036_0083512 Ga0501036_0083512_1049_2440 340
108 3300049573 Ga0501037_0001555 Ga0501037_0001555_13032_14423 340
109 3300049574 Ga0501038_0026018 Ga0501038_0026018_2127_3518 340
110 3300049575 Ga0501039_0000929 Ga0501039_0000929_18418_19809 340
111 3300049579 Ga0501043_0002664 Ga0501043_0002664_13454_14845 340
112 3300049586 Ga0501070_0037108 Ga0501070_0037108_984_2375 340
113 3300027614 Ga0209970_1001034 Ga0209970_10010344 341
114 3300031344 Ga0265316_10162732 Ga0265316_101627322 343
115 3300041452 Ga0451793_0689373 Ga0451793_0689373_1689_3149 343
116 3300049572 Ga0501036_0286147 Ga0501036_0286147_12_1355 343
117 3300013306 Ga0163162_10152298 Ga0163162_101522982 344
118 3300048924 Ga0496121_0150134 Ga0496121_0150134_176_1606 344
119 3300044684 Ga0466966_0001218 Ga0466966_0001218_12567_14009 345
120 3300044694 Ga0466963_0012616 Ga0466963_0012616_1548_2990 345
121 3300044735 Ga0466968_0001182 Ga0466968_0001182_3350_4792 345
122 3300045049 Ga0466959_0001867 Ga0466959_0001867_9927_11396 345
123 3300005344 Ga0070661_100000465 Ga0070661_10000046510 346
124 3300005539 Ga0068853_100000152 Ga0068853_10000015218 346
125 3300006186 Ga0075369_10013804 Ga0075369_100138044 347
126 3300037853 Ga0436364_0412886 Ga0436364_0412886_1459_2886 347
127 3300039437 Ga0436365_1646946 Ga0436365_1646946_21438_22865 347
128 3300005329 Ga0070683_100013981 Ga0070683_1000139815 348
129 3300005535 Ga0070684_100004335 Ga0070684_1000043353 348
130 3300005616 Ga0068852_100000419 Ga0068852_10000041922 348
131 3300009174 Ga0105241_10000899 Ga0105241_100008994 348
132 3300013105 Ga0157369_10045057 Ga0157369_100450573 348
133 3300025911 Ga0207654_10001829 Ga0207654_100018294 348
134 3300025913 Ga0207695_10000035 Ga0207695_10000035147 348
135 3300025944 Ga0207661_10104221 Ga0207661_101042211 348
136 3300026142 Ga0207698_10000575 Ga0207698_1000057518 348
137 3300046674 Ga0495588_0059779 Ga0495588_0059779_307_1761 348
138 3300047472 Ga0495686_0003378 Ga0495686_0003378_10048_11529 348
139 3300031728 Ga0316578_10070183 Ga0316578_100701831 349
140 3300045976 Ga0466967_0022720 Ga0466967_0022720_2608_4056 349
141 3300048911 Ga0496108_0082795 Ga0496108_0082795_630_2108 349
142 3300048912 Ga0496109_0084511 Ga0496109_0084511_665_2143 349
143 3300048915 Ga0496112_0019953 Ga0496112_0019953_2967_4445 349
144 3300006038 Ga0075365_10088145 Ga0075365_100881452 350
145 3300044694 Ga0466963_0008234 Ga0466963_0008234_1273_2700 350
146 3300005329 Ga0070683_100002053 Ga0070683_10000205313 351
147 3300005331 Ga0070670_100009304 Ga0070670_1000093046 351
148 3300005334 Ga0068869_100000800 Ga0068869_10000080010 351
149 3300005338 Ga0068868_100000260 Ga0068868_10000026027 351
150 3300005355 Ga0070671_100002343 Ga0070671_10000234310 351
151 3300005367 Ga0070667_100000556 Ga0070667_10000055620 351
152 3300005535 Ga0070684_100001193 Ga0070684_1000011937 351
153 3300005614 Ga0068856_100003279 Ga0068856_10000327914 351
154 3300005841 Ga0068863_100001329 Ga0068863_1000013296 351
155 3300005843 Ga0068860_100000402 Ga0068860_10000040226 351
156 3300006358 Ga0068871_100000709 Ga0068871_10000070918 351
157 3300025914 Ga0207671_10000830 Ga0207671_1000083020 351
158 3300025924 Ga0207694_10000934 Ga0207694_1000093415 351
159 3300025925 Ga0207650_10002624 Ga0207650_1000262410 351
160 3300025931 Ga0207644_10002255 Ga0207644_100022557 351
161 3300025942 Ga0207689_10000163 Ga0207689_1000016319 351
162 3300026078 Ga0207702_10000782 Ga0207702_1000078212 351
163 3300026088 Ga0207641_10000457 Ga0207641_1000045718 351
164 3300026095 Ga0207676_10002880 Ga0207676_1000288010 351
165 3300028381 Ga0268264_10000795 Ga0268264_100007957 351
166 3300049569 Ga0501032_0052331 Ga0501032_0052331_1297_2736 351
167 3300044684 Ga0466966_0075255 Ga0466966_0075255_146_1639 353
168 3300046663 Ga0495635_0102404 Ga0495635_0102404_54_1508 353
169 3300009174 Ga0105241_10064197 Ga0105241_100641972 355
170 3300013105 Ga0157369_10134238 Ga0157369_101342382 355
171 3300025913 Ga0207695_10106413 Ga0207695_101064132 355
172 3300041413 Ga0439465_0002904 Ga0439465_0002904_490_1899 355
173 3300042004 Ga0439445_0013860 Ga0439445_0013860_72_1481 355
174 3300044656 Ga0466969_0032861 Ga0466969_0032861_796_2214 355
175 3300044684 Ga0466966_0001105 Ga0466966_0001105_14143_15561 355
176 3300044693 Ga0466961_0001949 Ga0466961_0001949_6433_7851 355
177 3300044765 Ga0466970_0035880 Ga0466970_0035880_236_1654 355
178 3300044842 Ga0466957_0000981 Ga0466957_0000981_2725_4143 355
179 3300044901 Ga0466960_0000959 Ga0466960_0000959_7385_8812 355
180 3300045049 Ga0466959_0000774 Ga0466959_0000774_14799_16217 355
181 3300045836 Ga0466958_0001942 Ga0466958_0001942_6913_8331 355
182 3300045976 Ga0466967_0050522 Ga0466967_0050522_1274_2701 355
183 3300046460 Ga0495638_0021955 Ga0495638_0021955_820_2253 355
184 3300046460 Ga0495638_0102356 Ga0495638_0102356_265_1665 355
185 3300050494 nmdc:mga06z11_67686_c1 nmdc:mga06z11_67686_c1_394_1800 355
186 3300041509 Ga0451843_0145349 Ga0451843_0145349_92_1558 356
187 3300044658 Ga0466972_0002574 Ga0466972_0002574_6700_8139 356
188 3300044683 Ga0466965_0000697 Ga0466965_0000697_9826_11265 356
189 3300044735 Ga0466968_0001521 Ga0466968_0001521_2146_3585 356
190 3300044842 Ga0466957_0003667 Ga0466957_0003667_4518_5957 356
191 3300044901 Ga0466960_0002911 Ga0466960_0002911_4830_6269 356
192 3300045049 Ga0466959_0043428 Ga0466959_0043428_1294_2733 356
193 3300005563 Ga0068855_100008957 Ga0068855_1000089576 358
194 3300005614 Ga0068856_100001256 Ga0068856_1000012568 358
195 3300005616 Ga0068852_100000028 Ga0068852_10000002842 358
196 3300009093 Ga0105240_10014173 Ga0105240_1001417310 358
197 3300009174 Ga0105241_10000413 Ga0105241_1000041310 358
198 3300009545 Ga0105237_10003582 Ga0105237_100035828 358
199 3300009551 Ga0105238_10000811 Ga0105238_1000081122 358
200 3300010375 Ga0105239_10001400 Ga0105239_1000140010 358
201 3300013105 Ga0157369_10001886 Ga0157369_100018868 358
202 3300025911 Ga0207654_10000599 Ga0207654_1000059911 358
203 3300025913 Ga0207695_10000998 Ga0207695_1000099811 358
204 3300025914 Ga0207671_10000238 Ga0207671_1000023870 358
205 3300025920 Ga0207649_10000650 Ga0207649_1000065010 358
206 3300025924 Ga0207694_10000089 Ga0207694_1000008922 358
207 3300025949 Ga0207667_10001714 Ga0207667_1000171420 358
208 3300026041 Ga0207639_10000103 Ga0207639_1000010318 358
209 3300026078 Ga0207702_10001505 Ga0207702_100015058 358
210 3300026142 Ga0207698_10000160 Ga0207698_100001608 358
211 3300049568 Ga0501031_0003795 Ga0501031_0003795_7001_8389 358
212 3300049568 Ga0501031_0088893 Ga0501031_0088893_49_1437 358
213 3300049570 Ga0501033_0043947 Ga0501033_0043947_523_1911 358
214 3300049572 Ga0501036_0001413 Ga0501036_0001413_16454_17842 358
215 3300049572 Ga0501036_0088459 Ga0501036_0088459_1099_2487 358
216 3300049572 Ga0501036_0264805 Ga0501036_0264805_35_1423 358
217 3300049574 Ga0501038_0009321 Ga0501038_0009321_535_1995 358
218 3300049574 Ga0501038_0037308 Ga0501038_0037308_958_2346 358
219 3300049575 Ga0501039_0004683 Ga0501039_0004683_293_1681 358
220 3300049575 Ga0501039_0165606 Ga0501039_0165606_317_1705 358
221 3300049576 Ga0501040_0013259 Ga0501040_0013259_2462_3850 358
222 3300049576 Ga0501040_0029784 Ga0501040_0029784_448_1836 358
223 3300049576 Ga0501040_0042962 Ga0501040_0042962_1534_2922 358
224 3300049577 Ga0501041_0001342 Ga0501041_0001342_11057_12445 358
225 3300049577 Ga0501041_0010307 Ga0501041_0010307_1539_2927 358
226 3300049577 Ga0501041_0051221 Ga0501041_0051221_129_1517 358
227 3300049578 Ga0501042_0015362 Ga0501042_0015362_1516_2904 358
228 3300049578 Ga0501042_0137348 Ga0501042_0137348_117_1505 358
229 3300049579 Ga0501043_0077253 Ga0501043_0077253_132_1520 358
230 3300049580 Ga0501046_0026960 Ga0501046_0026960_2021_3409 358
231 3300049581 Ga0501047_0011332 Ga0501047_0011332_4977_6464 358
232 3300049582 Ga0501048_0001694 Ga0501048_0001694_8170_9558 358
233 3300049582 Ga0501048_0117637 Ga0501048_0117637_396_1784 358
234 3300049584 Ga0501068_0014766 Ga0501068_0014766_2036_3424 358
235 3300049584 Ga0501068_0057268 Ga0501068_0057268_926_2314 358
236 3300049587 Ga0501071_0001347 Ga0501071_0001347_9226_10614 358
237 3300049587 Ga0501071_0007797 Ga0501071_0007797_1425_2813 358
238 3300049587 Ga0501071_0042642 Ga0501071_0042642_1176_2564 358
239 3300049587 Ga0501071_0065267 Ga0501071_0065267_785_2173 358
240 3300049588 Ga0501072_0001073 Ga0501072_0001073_9468_10856 358
241 3300049588 Ga0501072_0004896 Ga0501072_0004896_2277_3665 358
242 3300049588 Ga0501072_0006049 Ga0501072_0006049_6820_8208 358
243 3300049588 Ga0501072_0056876 Ga0501072_0056876_27_1415 358
244 3300049588 Ga0501072_0112423 Ga0501072_0112423_416_1804 358
245 3300049590 Ga0501074_0001828 Ga0501074_0001828_6542_7930 358
246 3300049591 Ga0501075_0007876 Ga0501075_0007876_2019_3407 358
247 3300049591 Ga0501075_0011017 Ga0501075_0011017_3340_4728 358
248 3300049591 Ga0501075_0012090 Ga0501075_0012090_2044_3432 358
249 3300049591 Ga0501075_0059978 Ga0501075_0059978_791_2179 358
250 3300049592 Ga0501076_0019047 Ga0501076_0019047_2362_3750 358
251 3300049593 Ga0501077_0032460 Ga0501077_0032460_1349_2737 358
252 3300049593 Ga0501077_0093252 Ga0501077_0093252_150_1538 358
253 3300049593 Ga0501077_0105763 Ga0501077_0105763_44_1432 358
254 3300049741 Ga0501079_0004833 Ga0501079_0004833_673_2061 358
255 3300049741 Ga0501079_0019952 Ga0501079_0019952_1511_2899 358
256 3300049741 Ga0501079_0087335 Ga0501079_0087335_97_1485 358
257 3300049742 Ga0501080_0025779 Ga0501080_0025779_3133_4521 358
258 3300049742 Ga0501080_0108483 Ga0501080_0108483_138_1526 358
259 3300049743 Ga0501081_0002359 Ga0501081_0002359_9488_10876 358
260 3300049743 Ga0501081_0100848 Ga0501081_0100848_559_1947 358
261 3300049743 Ga0501081_0137995 Ga0501081_0137995_252_1640 358
262 3300049744 Ga0501083_0158195 Ga0501083_0158195_44_1432 358
263 3300049822 Ga0501035_0000497 Ga0501035_0000497_12658_14145 358
264 3300049822 Ga0501035_0013669 Ga0501035_0013669_1387_2775 358
265 3300049823 Ga0501044_0007277 Ga0501044_0007277_6545_8032 358
266 3300049824 Ga0501045_0000930 Ga0501045_0000930_9455_10843 358
267 3300054114 Ga0501084_0113323 Ga0501084_0113323_247_1635 358
268 3300054114 Ga0501084_0121113 Ga0501084_0121113_213_1601 358
269 3300060353 Ga0501082_0039974 Ga0501082_0039974_2399_3787 358
270 3300060353 Ga0501082_0097214 Ga0501082_0097214_1022_2410 358
271 3300061734 Ga0530510_0008961 Ga0530510_0008961_2038_3426 358
272 3300061734 Ga0530510_0017209 Ga0530510_0017209_139_1527 358
273 3300061734 Ga0530510_0019727 Ga0530510_0019727_40_1428 358
274 3300061734 Ga0530510_0130373 Ga0530510_0130373_242_1630 358
275 3300061734 Ga0530510_0173752 Ga0530510_0173752_80_1468 358
276 iso_pu_bacteria 2831905167 2831907859 358
277 iso_pu_bacteria 2939615513 2939616126 358
278 3300048903 Ga0496100_0027262 Ga0496100_0027262_1840_3291 359
279 3300048904 Ga0496101_0067642 Ga0496101_0067642_944_2395 359
280 3300048916 Ga0496113_0003931 Ga0496113_0003931_2460_3911 359
281 3300048925 Ga0496122_0071484 Ga0496122_0071484_585_2036 359
282 3300025303 Ga0209051_1027756 Ga0209051_10277563 360
283 3300045049 Ga0466959_0107650 Ga0466959_0107650_440_1885 361
284 3300045836 Ga0466958_0001131 Ga0466958_0001131_542_1987 361
285 3300049823 Ga0501044_0042930 Ga0501044_0042930_1250_2722 361
286 3300053131 Ga0500652_008367 Ga0500652_008367_1912_3381 361
287 3300005327 Ga0070658_10068213 Ga0070658_100682131 363
288 3300005577 Ga0068857_100001491 Ga0068857_1000014918 363
289 3300005616 Ga0068852_100040010 Ga0068852_1000400101 363
290 3300005618 Ga0068864_100001146 Ga0068864_1000011465 363
291 3300005842 Ga0068858_100003222 Ga0068858_10000322212 363
292 3300009093 Ga0105240_10000130 Ga0105240_100001309 363
293 3300009098 Ga0105245_10000513 Ga0105245_100005139 363
294 3300009101 Ga0105247_10000593 Ga0105247_1000059315 363
295 3300009174 Ga0105241_10002059 Ga0105241_100020599 363
296 3300009545 Ga0105237_10002531 Ga0105237_1000253113 363
297 3300009551 Ga0105238_10001260 Ga0105238_100012609 363
298 3300011119 Ga0105246_10000107 Ga0105246_1000010720 363
299 3300013296 Ga0157374_10004223 Ga0157374_100042231 363
300 3300013297 Ga0157378_10002169 Ga0157378_100021699 363
301 3300013308 Ga0157375_10000409 Ga0157375_1000040926 363
302 3300014968 Ga0157379_10000269 Ga0157379_100002692 363
303 3300014969 Ga0157376_10000550 Ga0157376_100005509 363
304 3300025900 Ga0207710_10000588 Ga0207710_1000058812 363
305 3300025909 Ga0207705_10054293 Ga0207705_100542932 363
306 3300025911 Ga0207654_10000359 Ga0207654_1000035918 363
307 3300025913 Ga0207695_10000292 Ga0207695_100002929 363
308 3300025914 Ga0207671_10000047 Ga0207671_1000004718 363
309 3300025927 Ga0207687_10000707 Ga0207687_1000070711 363
310 3300025986 Ga0207658_10000076 Ga0207658_1000007615 363
311 3300026023 Ga0207677_10000055 Ga0207677_100000559 363
312 3300026035 Ga0207703_10009922 Ga0207703_100099222 363
313 3300026116 Ga0207674_10003714 Ga0207674_100037148 363
314 3300026142 Ga0207698_10108364 Ga0207698_101083642 363
315 3300044901 Ga0466960_0083212 Ga0466960_0083212_116_1591 363
316 3300026121 Ga0207683_10018755 Ga0207683_100187554 364
317 iso_pu_bacteria 2902799365 2902800579 364
318 3300048929 Ga0496126_0006264 Ga0496126_0006264_4149_5585 365
319 3300021384 Ga0213876_10002110 Ga0213876_100021107 366
320 3300005577 Ga0068857_100000969 Ga0068857_10000096912 367
321 3300005616 Ga0068852_100069815 Ga0068852_1000698152 367
322 3300009093 Ga0105240_10004663 Ga0105240_100046636 367
323 3300009093 Ga0105240_10099140 Ga0105240_100991402 367
324 3300009551 Ga0105238_10089397 Ga0105238_100893972 367
325 3300010375 Ga0105239_10006021 Ga0105239_100060219 367
326 3300010375 Ga0105239_10228958 Ga0105239_102289582 367
327 3300013296 Ga0157374_10002747 Ga0157374_100027479 367
328 3300013297 Ga0157378_10021534 Ga0157378_100215343 367
329 3300013308 Ga0157375_10028258 Ga0157375_100282584 367
330 3300025913 Ga0207695_10039881 Ga0207695_100398811 367
331 3300025924 Ga0207694_10062317 Ga0207694_100623172 367
332 3300025927 Ga0207687_10069959 Ga0207687_100699592 367
333 3300026116 Ga0207674_10000840 Ga0207674_100008409 367
334 iso_pu_bacteria 2902810491 2902814902 367
335 3300044694 Ga0466963_0001937 Ga0466963_0001937_2237_3676 368
336 3300045976 Ga0466967_0056031 Ga0466967_0056031_1347_2786 368
337 3300050492 nmdc:mga0yw44_8245_c1 nmdc:mga0yw44_8245_c1_761_2206 368
338 iso_pu_bacteria 2738543034 2739364875 368
339 iso_pu_bacteria 2904765812 2904766483 368
340 iso_pu_bacteria 2904770941 2904772651 368
341 iso_pu_bacteria 2908811453 2908813675 368
342 iso_pu_bacteria 2919420072 2919421081 368
343 iso_pu_bacteria 2919432681 2919433161 368
344 iso_pu_bacteria 2939582691 2939584656 368
345 3300005535 Ga0070684_100110204 Ga0070684_1001102042 369
346 3300006028 Ga0070717_10104982 Ga0070717_101049821 369
347 3300045976 Ga0466967_0057077 Ga0466967_0057077_29_1510 369
348 3300048905 Ga0496102_0049225 Ga0496102_0049225_1827_3302 369
349 3300048920 Ga0496117_0016250 Ga0496117_0016250_2681_4156 369
350 3300048921 Ga0496118_0001501 Ga0496118_0001501_32321_33796 369
351 3300049569 Ga0501032_0011946 Ga0501032_0011946_3874_5367 369
352 3300049570 Ga0501033_0054614 Ga0501033_0054614_968_2461 369
353 3300049571 Ga0501034_0003863 Ga0501034_0003863_2623_4116 369
354 3300049573 Ga0501037_0004692 Ga0501037_0004692_1674_3167 369
355 3300049579 Ga0501043_0011344 Ga0501043_0011344_64_1557 369
356 3300049580 Ga0501046_0003187 Ga0501046_0003187_1787_3280 369
357 3300049581 Ga0501047_0003285 Ga0501047_0003285_2734_4227 369
358 3300049582 Ga0501048_0007416 Ga0501048_0007416_2357_3850 369
359 3300049586 Ga0501070_0003402 Ga0501070_0003402_2007_3500 369
360 3300049744 Ga0501083_0114251 Ga0501083_0114251_173_1666 369
361 3300049822 Ga0501035_0102581 Ga0501035_0102581_541_2034 369
362 3300049823 Ga0501044_0035022 Ga0501044_0035022_2963_4456 369
363 3300005937 Ga0081455_10038324 Ga0081455_100383244 370
364 3300006844 Ga0075428_100000631 Ga0075428_10000063118 370
365 3300006847 Ga0075431_100014094 Ga0075431_1000140943 370
366 3300009094 Ga0111539_10011076 Ga0111539_1001107614 370
367 3300027907 Ga0207428_10129849 Ga0207428_101298492 370
368 3300031901 Ga0307406_10009897 Ga0307406_100098974 370
369 3300042435 Ga0439434_0004061 Ga0439434_0004061_1199_2686 370
370 3300050507 nmdc:mga05p37_90630_c1 nmdc:mga05p37_90630_c1_679_2151 370
371 3300050508 nmdc:mga09592_2876_c1 nmdc:mga09592_2876_c1_1882_3354 370
372 3300050509 nmdc:mga0qj67_10802_c1 nmdc:mga0qj67_10802_c1_1905_3377 370
373 3300050510 nmdc:mga06r32_332_c1 nmdc:mga06r32_332_c1_37699_39171 370
374 3300050511 nmdc:mga08y16_13049_c1 nmdc:mga08y16_13049_c1_465_1937 370
375 iso_pu_bacteria 2643221687 2644490712 370
376 iso_pu_bacteria 2902792274 2902798712 370
377 iso_pu_bacteria 2902837492 2902838484 370
378 iso_pu_bacteria 2929212328 2929217419 370
379 3300005436 Ga0070713_100055177 Ga0070713_1000551773 371
380 3300006051 Ga0075364_10008782 Ga0075364_100087825 371
381 3300013105 Ga0157369_10117732 Ga0157369_101177322 371
382 iso_pu_bacteria 2842134933 2842139273 372
383 3300006048 Ga0075363_100052419 Ga0075363_1000524192 373
384 3300031251 Ga0265327_10000128 Ga0265327_10000128169 373
385 3300050490 nmdc:mga03n38_15418_c1 nmdc:mga03n38_15418_c1_459_1946 373
386 3300003792 Ga0055540_1004226 Ga0055540_10042267 374
387 3300005347 Ga0070668_100013630 Ga0070668_1000136301 374
388 3300005367 Ga0070667_100055913 Ga0070667_1000559132 374
389 3300006038 Ga0075365_10057850 Ga0075365_100578503 374
390 3300006051 Ga0075364_10001414 Ga0075364_100014147 374
391 3300006186 Ga0075369_10030188 Ga0075369_100301883 374
392 3300025273 Ga0209673_1008342 Ga0209673_10083424 374
393 3300025303 Ga0209051_1001345 Ga0209051_100134515 374
394 3300025303 Ga0209051_1003362 Ga0209051_100336210 374
395 3300025972 Ga0207668_10002892 Ga0207668_100028921 374
396 3300044658 Ga0466972_0021251 Ga0466972_0021251_22_1470 374
397 3300044683 Ga0466965_0014231 Ga0466965_0014231_811_2259 374
398 3300044901 Ga0466960_0000319 Ga0466960_0000319_4419_5867 374
399 3300046524 Ga0495648_0015564 Ga0495648_0015564_3719_5269 374
400 3300047320 Ga0495672_0033632 Ga0495672_0033632_342_1832 374
401 3300047320 Ga0495672_0041421 Ga0495672_0041421_800_2350 374
402 3300047469 Ga0495673_0002945 Ga0495673_0002945_9544_11094 374
403 3300048907 Ga0496104_0237421 Ga0496104_0237421_158_1627 374
404 3300053087 Ga0500643_003561 Ga0500643_003561_5568_7061 374
405 3300053087 Ga0500643_010167 Ga0500643_010167_377_1915 374
406 3300053730 Ga0500645_000490 Ga0500645_000490_14771_16234 374
407 iso_pu_bacteria 2738541274 2738706935 374
408 iso_pu_bacteria 2738543028 2739333640 374
409 3300005435 Ga0070714_100003669 Ga0070714_1000036695 375
410 3300005437 Ga0070710_10034345 Ga0070710_100343451 375
411 iso_pu_bacteria 2643221715 2644636953 375
412 3300048922 Ga0496119_0087245 Ga0496119_0087245_252_1751 376
413 3300003320 rootH2_10026772 rootH2_100267723 377

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00132

Hexapep

Bacterial transferase hexapeptide (six repeats)

399

434

0.96

PF00132

Hexapep

Bacterial transferase hexapeptide (six repeats)

271

306

0.95

PF14602

Hexapep_2

Hexapeptide repeat of succinyl-transferase

399

433

0.94

PF14602

Hexapep_2

Hexapeptide repeat of succinyl-transferase

290

315

0.9

PF00483

NTP_transferase

Nucleotidyl transferase

4

270

0.82

PF12804

NTP_transf_3

MobA-like NTP transferase domain

5

202

0.78

PF01128

IspD

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

3

230

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fxj-assembly1.cif.gz_A crystal structure of n-acetylglucosamine 1-phosphate uridyltransferase 0.8887 8 360
1fxj-assembly1.cif.gz_A crystal structure of n-acetylglucosamine 1-phosphate uridyltransferase 0.8787 8 360
3d98-assembly1.cif.gz_A crystal structure of glmu from mycobacterium tuberculosis, ligand-free form 0.8636 8 360
3dj4-assembly1.cif.gz_A crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine. 0.8515 10 367
3d8v-assembly1.cif.gz_A crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine 0.8474 8 375
ID Description Score Start End Superfamily
af_P9WMN3_2_263_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9719 8 266 3.90.550.10
af_P9WMN3_2_263_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9574 8 266 3.90.550.10
1g97A01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9322 10 266 3.90.550.10
1g97A01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9251 10 266 3.90.550.10
5vmkC01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9238 10 241 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A520ENM4-F1-model_v4 Bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU 0.9753 13 286 GO:0016779
AF-A0A3N9MRE8-F1-model_v4 UDP-N-acetylglucosamine pyrophosphorylase 0.9722 16 257 GO:0016779
AF-A0A357L6M4-F1-model_v4 Bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU 0.9628 6 280 GO:0016779
AF-A0A1X0VB25-F1-model_v4 Bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase 0.9624 9 282 GO:0009058
GO:0016779
AF-X8C3F0-F1-model_v4 deleted 0.9613 23 240

Feature Viewer

pLDDT pTM Quality
91.74 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map