F438177

General Info

Members Datasets Scaffolds Average Seq Length
413 159 826 194

Family's Representative Sequence

Representative Sequence 3300049661|Ga0501217_063767|Ga0501217_063767_274_969
Length 231
Sequence MPYTSQKPPLSETSDQLRARIPGWGVDLDPKDRPSVPKEQFDPSGTGAHWDFPERQPEKWPRERSLEHKFLTPVFGTSCPPKGLSGGMRKLAYRRYSEGRAAHWLMLIAADRVDAAESHLRSLATLHPDNPITETGVMTEFRRHGIDSRIGRHRADVVHQTLDSVIVAGPWLLAGCAVFLTMRSLIRSARSKLNPDARQPAPLGAAAMIVTSTSGKRPESLSTIDRRNTSP

Samples

Sample ID Description Type Environment
1 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
11 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
15 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
16 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
17 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
34 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
35 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
36 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
37 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
38 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
39 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
40 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
41 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
42 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
46 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
47 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
48 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
53 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
54 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
55 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
56 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
57 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
58 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
59 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
60 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
61 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
62 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
63 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
64 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
65 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
66 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
67 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
68 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
71 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
72 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
73 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
76 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
77 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
78 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
79 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
80 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
81 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
82 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
83 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
84 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
85 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
99 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
102 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
109 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
110 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
111 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
112 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
113 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
120 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
125 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
126 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
127 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
128 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
129 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
130 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
131 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
132 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
133 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
134 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
135 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
136 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
137 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
138 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
139 2858882152 Micromonospora noduli MED15 Isolate Nodule
140 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
141 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
142 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
143 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
144 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
145 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
146 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
147 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
148 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
149 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
150 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
151 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
152 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
153 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
154 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
155 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
156 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
157 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
158 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
159 8054727385 Micromonospora alfalfae MED01 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.56
Metatranscriptomes 0.48
Isolates 8.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0.73
Rhizoplane 6.3
Rhizosphere 85.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501217_063767 3300049661 Bacteria 990
2 LJQas_1001005 3300000549 Bacteria 4331
3 LJQas_1002183 3300000549 Bacteria 2763
4 LJQas_1002316 3300000549 Bacteria 2670
5 LJQas_1011289 3300000549 Bacteria 1063
6 Ga0070683_100042676 3300005329 Bacteria 4177
7 Ga0070683_100171104 3300005329 Bacteria 2062
8 Ga0070659_100793482 3300005366 Bacteria 823
9 Ga0070700_100600490 3300005441 Bacteria 862
10 Ga0070663_100000145 3300005455 Bacteria 34514
11 Ga0070663_101262028 3300005455 Bacteria 651
12 Ga0070664_100186234 3300005564 Bacteria 1847
13 Ga0068857_100083937 3300005577 Bacteria 2846
14 Ga0068852_100663336 3300005616 Bacteria 1051
15 Ga0068851_10151785 3300005834 Bacteria 1267
16 Ga0068851_10416036 3300005834 Bacteria 793
17 Ga0075365_10004789 3300006038 Bacteria 7222
18 Ga0075365_10413381 3300006038 Bacteria 952
19 Ga0075363_100009237 3300006048 Bacteria 4631
20 Ga0075367_10080337 3300006178 Bacteria 1972
21 Ga0075433_10011013 3300006852 Bacteria 7273
22 Ga0075434_100002177 3300006871 Bacteria 17082
23 Ga0075436_100003276 3300006914 Bacteria 11091
24 Ga0075435_100156870 3300007076 Bacteria 1915
25 Ga0105244_10024317 3300009036 Bacteria 3307
26 Ga0111539_10001113 3300009094 Bacteria 35499
27 Ga0105238_10690761 3300009551 Bacteria 1032
28 Ga0157369_10728939 3300013105 Bacteria 1020
29 Ga0163162_10916275 3300013306 Bacteria 989
30 Ga0157372_10324320 3300013307 Bacteria 1793
31 Ga0157372_11403230 3300013307 Bacteria 805
32 Ga0163163_10056311 3300014325 Bacteria 3886
33 Ga0207661_10037327 3300025944 Bacteria 3799
34 Ga0207679_10842295 3300025945 Bacteria 837
35 Ga0207677_10152690 3300026023 Bacteria 1784
36 Ga0207678_10000089 3300026067 Bacteria 75976
37 Ga0207678_10443564 3300026067 Bacteria 1127
38 Ga0207708_10665335 3300026075 Bacteria 887
39 Ga0207702_10587004 3300026078 Bacteria 1092
40 Ga0207674_10102072 3300026116 Bacteria 2848
41 Ga0207698_10605756 3300026142 Bacteria 1080
42 Ga0207428_10010583 3300027907 Bacteria 8232
43 Ga0307513_10008450 3300031456 Bacteria 13171
44 Ga0307408_100005952 3300031548 Bacteria 8123
45 Ga0307408_100009400 3300031548 Bacteria 6443
46 Ga0307408_100020876 3300031548 Bacteria 4425
47 Ga0307408_100031159 3300031548 Bacteria 3711
48 Ga0307408_100105382 3300031548 Bacteria 2155
49 Ga0307408_100179466 3300031548 Bacteria 1697
50 Ga0307408_100179578 3300031548 Bacteria 1696
51 Ga0307408_100312722 3300031548 Bacteria 1320
52 Ga0307408_100343282 3300031548 Bacteria 1264
53 Ga0307408_100360823 3300031548 Bacteria 1236
54 Ga0307408_100415848 3300031548 Bacteria 1158
55 Ga0307408_100450446 3300031548 Bacteria 1116
56 Ga0307408_100702096 3300031548 Bacteria 909
57 Ga0307405_10028058 3300031731 Bacteria 3274
58 Ga0307405_10049816 3300031731 Bacteria 2591
59 Ga0307405_10058361 3300031731 Bacteria 2428
60 Ga0307405_10085725 3300031731 Bacteria 2071
61 Ga0307405_10133310 3300031731 Bacteria 1720
62 Ga0307405_10146653 3300031731 Bacteria 1654
63 Ga0307405_10165712 3300031731 Bacteria 1570
64 Ga0307405_10443981 3300031731 Bacteria 1027
65 Ga0307405_10461643 3300031731 Bacteria 1009
66 Ga0307405_10493729 3300031731 Bacteria 980
67 Ga0307405_10545576 3300031731 Bacteria 937
68 Ga0307405_10548336 3300031731 Bacteria 935
69 Ga0307405_10899602 3300031731 Bacteria 748
70 Ga0307405_11061451 3300031731 Bacteria 694
71 Ga0307413_10004087 3300031824 Bacteria 6278
72 Ga0307413_10018510 3300031824 Bacteria 3657
73 Ga0307413_10056344 3300031824 Bacteria 2397
74 Ga0307413_10109526 3300031824 Bacteria 1846
75 Ga0307413_10204534 3300031824 Bacteria 1429
76 Ga0307413_10716391 3300031824 Bacteria 833
77 Ga0307410_10011011 3300031852 Bacteria 5153
78 Ga0307410_10030856 3300031852 Bacteria 3430
79 Ga0307410_10032239 3300031852 Bacteria 3369
80 Ga0307410_10044470 3300031852 Bacteria 2950
81 Ga0307410_10047296 3300031852 Bacteria 2874
82 Ga0307410_10061718 3300031852 Bacteria 2566
83 Ga0307410_10081103 3300031852 Bacteria 2278
84 Ga0307410_10097562 3300031852 Bacteria 2100
85 Ga0307410_10141019 3300031852 Bacteria 1783
86 Ga0307410_10149210 3300031852 Bacteria 1739
87 Ga0307410_10171827 3300031852 Bacteria 1634
88 Ga0307410_10285302 3300031852 Bacteria 1297
89 Ga0307410_10340491 3300031852 Bacteria 1195
90 Ga0307410_10440540 3300031852 Bacteria 1061
91 Ga0307410_10449134 3300031852 Bacteria 1051
92 Ga0307410_10498552 3300031852 Bacteria 1002
93 Ga0307410_10511506 3300031852 Bacteria 989
94 Ga0326468_10000411 3300031889 Bacteria 4541
95 Ga0307406_10032663 3300031901 Bacteria 3179
96 Ga0307406_10054819 3300031901 Bacteria 2546
97 Ga0307406_10060318 3300031901 Bacteria 2445
98 Ga0307406_10067632 3300031901 Bacteria 2330
99 Ga0307406_10184464 3300031901 Bacteria 1522
100 Ga0307406_10201194 3300031901 Bacteria 1466
101 Ga0307407_10005728 3300031903 Bacteria 5428
102 Ga0307407_10017732 3300031903 Bacteria 3581
103 Ga0307407_10023999 3300031903 Bacteria 3190
104 Ga0307407_10044057 3300031903 Bacteria 2512
105 Ga0307407_10047935 3300031903 Bacteria 2428
106 Ga0307407_10059254 3300031903 Bacteria 2229
107 Ga0307407_10117185 3300031903 Bacteria 1682
108 Ga0307407_10239237 3300031903 Bacteria 1237
109 Ga0307407_10253823 3300031903 Bacteria 1206
110 Ga0307407_10456241 3300031903 Bacteria 929
111 Ga0307407_10456896 3300031903 Bacteria 928
112 Ga0307412_10001782 3300031911 Bacteria 11900
113 Ga0307412_10019640 3300031911 Bacteria 4097
114 Ga0307412_10028281 3300031911 Bacteria 3505
115 Ga0307412_10030966 3300031911 Bacteria 3374
116 Ga0307412_10058271 3300031911 Bacteria 2583
117 Ga0307412_10076203 3300031911 Bacteria 2303
118 Ga0307412_10143744 3300031911 Bacteria 1751
119 Ga0307412_10172154 3300031911 Bacteria 1620
120 Ga0307412_10272702 3300031911 Bacteria 1324
121 Ga0307412_10662567 3300031911 Bacteria 891
122 Ga0307412_10679288 3300031911 Bacteria 881
123 Ga0307409_100004988 3300031995 Bacteria 7556
124 Ga0307409_100008502 3300031995 Bacteria 6235
125 Ga0307409_100009071 3300031995 Bacteria 6087
126 Ga0307409_100014699 3300031995 Bacteria 5104
127 Ga0307409_100043540 3300031995 Bacteria 3372
128 Ga0307409_100062809 3300031995 Bacteria 2909
129 Ga0307409_100088832 3300031995 Bacteria 2524
130 Ga0307409_100105230 3300031995 Bacteria 2352
131 Ga0307409_100136093 3300031995 Bacteria 2108
132 Ga0307409_100136895 3300031995 Bacteria 2103
133 Ga0307409_100166816 3300031995 Bacteria 1933
134 Ga0307409_100257600 3300031995 Bacteria 1599
135 Ga0307409_100264514 3300031995 Bacteria 1580
136 Ga0307409_100353596 3300031995 Bacteria 1387
137 Ga0307409_100477902 3300031995 Bacteria 1208
138 Ga0307409_100583212 3300031995 Bacteria 1102
139 Ga0307409_100784618 3300031995 Bacteria 959
140 Ga0307409_101006643 3300031995 Bacteria 852
141 Ga0307416_100001791 3300032002 Bacteria 11929
142 Ga0307416_100002713 3300032002 Bacteria 10259
143 Ga0307416_100016082 3300032002 Bacteria 5187
144 Ga0307416_100021741 3300032002 Bacteria 4613
145 Ga0307416_100036968 3300032002 Bacteria 3752
146 Ga0307416_100043890 3300032002 Bacteria 3506
147 Ga0307416_100050699 3300032002 Bacteria 3310
148 Ga0307416_100062595 3300032002 Bacteria 3043
149 Ga0307416_100096547 3300032002 Bacteria 2556
150 Ga0307416_100112503 3300032002 Bacteria 2403
151 Ga0307416_100126602 3300032002 Bacteria 2289
152 Ga0307416_100151837 3300032002 Bacteria 2125
153 Ga0307416_100250475 3300032002 Bacteria 1723
154 Ga0307416_100292006 3300032002 Bacteria 1614
155 Ga0307416_100352910 3300032002 Bacteria 1489
156 Ga0307416_100409722 3300032002 Bacteria 1396
157 Ga0307416_100656042 3300032002 Bacteria 1134
158 Ga0307416_100743604 3300032002 Bacteria 1073
159 Ga0307416_100773042 3300032002 Bacteria 1054
160 Ga0307416_100785326 3300032002 Bacteria 1047
161 Ga0307416_100852148 3300032002 Bacteria 1009
162 Ga0307416_101217686 3300032002 Bacteria 858
163 Ga0307416_101814315 3300032002 Bacteria 714
164 Ga0307414_10015033 3300032004 Bacteria 4662
165 Ga0307414_10091708 3300032004 Bacteria 2259
166 Ga0307414_10233281 3300032004 Bacteria 1519
167 Ga0307414_10529014 3300032004 Bacteria 1047
168 Ga0307414_11065005 3300032004 Bacteria 746
169 Ga0307414_11330330 3300032004 Bacteria 667
170 Ga0307411_10026402 3300032005 Bacteria 3497
171 Ga0307411_10076532 3300032005 Bacteria 2288
172 Ga0307411_10190526 3300032005 Bacteria 1565
173 Ga0307411_10202508 3300032005 Bacteria 1526
174 Ga0307411_10221163 3300032005 Bacteria 1469
175 Ga0307411_10955182 3300032005 Bacteria 765
176 Ga0307415_100001308 3300032126 Bacteria 11777
177 Ga0307415_100004549 3300032126 Bacteria 7225
178 Ga0307415_100012000 3300032126 Bacteria 4990
179 Ga0307415_100015504 3300032126 Bacteria 4515
180 Ga0307415_100026601 3300032126 Bacteria 3652
181 Ga0307415_100046531 3300032126 Bacteria 2915
182 Ga0307415_100048954 3300032126 Bacteria 2854
183 Ga0307415_100109901 3300032126 Bacteria 2043
184 Ga0307415_100226211 3300032126 Bacteria 1503
185 Ga0307415_100238993 3300032126 Bacteria 1468
186 Ga0307415_100250753 3300032126 Bacteria 1438
187 Ga0307415_100347060 3300032126 Bacteria 1248
188 Ga0307415_100639130 3300032126 Bacteria 952
189 Ga0307415_100800157 3300032126 Bacteria 860
190 Ga0307415_101093745 3300032126 Bacteria 746
191 Ga0395899_0013109 3300037312 Bacteria 6340
192 Ga0395899_0324173 3300037312 Bacteria 1037
193 Ga0395900_0029715 3300037418 Bacteria 5608
194 Ga0395900_0064034 3300037418 Bacteria 3780
195 Ga0395900_0191566 3300037418 Bacteria 2074
196 Ga0395900_0570599 3300037418 Bacteria 1074
197 Ga0395898_0002305 3300037466 Bacteria 22880
198 Ga0395898_0056098 3300037466 Bacteria 3842
199 Ga0395898_0069042 3300037466 Bacteria 3420
200 Ga0395898_0160627 3300037466 Bacteria 2149
201 Ga0395901_0006063 3300038443 Bacteria 12250
202 Ga0395901_0329233 3300038443 Bacteria 1579
203 Ga0395901_0377371 3300038443 Bacteria 1460
204 Ga0395901_0514928 3300038443 Bacteria 1216
205 Ga0395901_0596438 3300038443 Bacteria 1114
206 Ga0395901_0930220 3300038443 Bacteria 849
207 Ga0436365_0842797 3300039437 Bacteria 11472
208 Ga0436363_1083345 3300039450 Bacteria 778
209 Ga0436362_0614489 3300039453 Bacteria 1296
210 Ga0439465_0119880 3300041413 Bacteria 922
211 Ga0439442_000842 3300042002 Bacteria 6306
212 Ga0439448_0047538 3300042005 Bacteria 1400
213 Ga0439463_009705 3300042016 Bacteria 2366
214 Ga0439460_0172002 3300042461 Bacteria 730
215 Ga0466969_0097902 3300044656 Bacteria 1383
216 Ga0466969_0147082 3300044656 Bacteria 1087
217 Ga0466969_0157383 3300044656 Bacteria 1045
218 Ga0466972_0052527 3300044658 Bacteria 1963
219 Ga0466972_0069720 3300044658 Bacteria 1678
220 Ga0466972_0083832 3300044658 Bacteria 1516
221 Ga0466972_0114812 3300044658 Bacteria 1271
222 Ga0466972_0128215 3300044658 Bacteria 1195
223 Ga0466965_0000272 3300044683 Bacteria 16977
224 Ga0466965_0025361 3300044683 Bacteria 2869
225 Ga0466965_0031985 3300044683 Bacteria 2569
226 Ga0466965_0066888 3300044683 Bacteria 1803
227 Ga0466965_0113456 3300044683 Bacteria 1394
228 Ga0466965_0377556 3300044683 Bacteria 780
229 Ga0466966_0052494 3300044684 Bacteria 2589
230 Ga0466966_0053142 3300044684 Bacteria 2570
231 Ga0466966_0376628 3300044684 Bacteria 853
232 Ga0466966_0517339 3300044684 Bacteria 718
233 Ga0466961_0056260 3300044693 Bacteria 2506
234 Ga0466961_0186626 3300044693 Bacteria 1286
235 Ga0466961_0188148 3300044693 Bacteria 1280
236 Ga0466961_0224547 3300044693 Bacteria 1157
237 Ga0466961_0256620 3300044693 Bacteria 1073
238 Ga0466963_0001730 3300044694 Bacteria 11882
239 Ga0466963_0003836 3300044694 Bacteria 8671
240 Ga0466963_0028044 3300044694 Bacteria 3611
241 Ga0466963_0171556 3300044694 Bacteria 1512
242 Ga0466964_0000567 3300044706 Bacteria 11606
243 Ga0466964_0008269 3300044706 Bacteria 3904
244 Ga0466964_0018209 3300044706 Bacteria 2693
245 Ga0466964_0022945 3300044706 Bacteria 2424
246 Ga0466964_0071369 3300044706 Bacteria 1469
247 Ga0466971_0003414 3300044719 Bacteria 6789
248 Ga0466971_0057658 3300044719 Bacteria 1752
249 Ga0466971_0130398 3300044719 Bacteria 1167
250 Ga0466968_0032306 3300044735 Bacteria 2176
251 Ga0466968_0109445 3300044735 Bacteria 1241
252 Ga0466970_0006832 3300044765 Bacteria 5710
253 Ga0466970_0018449 3300044765 Bacteria 3611
254 Ga0466970_0063264 3300044765 Bacteria 1984
255 Ga0466970_0067090 3300044765 Bacteria 1926
256 Ga0466970_0167141 3300044765 Bacteria 1218
257 Ga0466957_0002884 3300044842 Bacteria 9315
258 Ga0466957_0019371 3300044842 Bacteria 4002
259 Ga0466957_0025601 3300044842 Bacteria 3497
260 Ga0466957_0138331 3300044842 Bacteria 1567
261 Ga0466957_0177701 3300044842 Bacteria 1389
262 Ga0466957_0237897 3300044842 Bacteria 1207
263 Ga0466957_0498187 3300044842 Bacteria 844
264 Ga0466957_0996486 3300044842 Bacteria 602
265 Ga0466960_0004004 3300044901 Bacteria 5731
266 Ga0466960_0004407 3300044901 Bacteria 5501
267 Ga0466960_0004609 3300044901 Bacteria 5403
268 Ga0466960_0004683 3300044901 Bacteria 5365
269 Ga0466960_0004939 3300044901 Bacteria 5248
270 Ga0466960_0006308 3300044901 Bacteria 4752
271 Ga0466960_0018807 3300044901 Bacteria 3033
272 Ga0466960_0029040 3300044901 Bacteria 2535
273 Ga0466960_0035607 3300044901 Bacteria 2327
274 Ga0466960_0038678 3300044901 Bacteria 2245
275 Ga0466960_0044153 3300044901 Bacteria 2124
276 Ga0466960_0050540 3300044901 Bacteria 2005
277 Ga0466960_0055405 3300044901 Bacteria 1928
278 Ga0466960_0078316 3300044901 Bacteria 1659
279 Ga0466960_0084892 3300044901 Bacteria 1603
280 Ga0466960_0136506 3300044901 Bacteria 1299
281 Ga0466960_0174532 3300044901 Bacteria 1162
282 Ga0466960_0185915 3300044901 Bacteria 1128
283 Ga0466960_0313440 3300044901 Bacteria 887
284 Ga0466959_0011510 3300045049 Bacteria 6360
285 Ga0466959_0047736 3300045049 Bacteria 3149
286 Ga0466959_0074642 3300045049 Bacteria 2452
287 Ga0466959_0094456 3300045049 Bacteria 2145
288 Ga0466959_0289627 3300045049 Bacteria 1123
289 Ga0466958_0017508 3300045836 Bacteria 4144
290 Ga0466958_0021179 3300045836 Bacteria 3796
291 Ga0466958_0049857 3300045836 Bacteria 2534
292 Ga0466958_0051992 3300045836 Bacteria 2482
293 Ga0466958_0320584 3300045836 Bacteria 996
294 Ga0466958_0354596 3300045836 Bacteria 945
295 Ga0466967_0000431 3300045976 Bacteria 19986
296 Ga0466967_0005484 3300045976 Bacteria 8798
297 Ga0466967_0019182 3300045976 Bacteria 5492
298 Ga0466967_0028217 3300045976 Bacteria 4683
299 Ga0466967_0065098 3300045976 Bacteria 3244
300 Ga0466967_0101245 3300045976 Bacteria 2633
301 Ga0466967_0109360 3300045976 Bacteria 2538
302 Ga0466967_0528563 3300045976 Bacteria 1160
303 Ga0466967_1273802 3300045976 Bacteria 732
304 Ga0495638_0139130 3300046460 Bacteria 1419
305 Ga0495610_0234473 3300046512 Bacteria 735
306 Ga0495642_0110701 3300046528 Bacteria 1174
307 Ga0495609_0171955 3300046538 Bacteria 915
308 Ga0495656_0143113 3300046615 Bacteria 1149
309 Ga0495656_0378258 3300046615 Bacteria 738
310 Ga0495668_0414273 3300046616 Bacteria 741
311 Ga0495588_0022529 3300046674 Bacteria 3114
312 Ga0495588_0084663 3300046674 Bacteria 1657
313 Ga0495670_0011090 3300046691 Bacteria 4432
314 Ga0495677_0307324 3300047445 Bacteria 624
315 Ga0495677_0321721 3300047445 Bacteria 609
316 Ga0496100_0031388 3300048903 Bacteria 3303
317 Ga0496100_0075429 3300048903 Bacteria 2261
318 Ga0496101_0005350 3300048904 Bacteria 8179
319 Ga0496101_0040671 3300048904 Bacteria 3311
320 Ga0496102_0364885 3300048905 Bacteria 1359
321 Ga0496102_1060016 3300048905 Bacteria 731
322 Ga0496103_0013959 3300048906 Bacteria 4767
323 Ga0496103_0519858 3300048906 Bacteria 761
324 Ga0496104_0324993 3300048907 Bacteria 1451
325 Ga0496105_0057592 3300048908 Bacteria 3208
326 Ga0496106_0028514 3300048909 Bacteria 4158
327 Ga0496106_0189560 3300048909 Bacteria 1634
328 Ga0496107_0031876 3300048910 Bacteria 3763
329 Ga0496108_0088080 3300048911 Bacteria 2637
330 Ga0496108_0424035 3300048911 Bacteria 1162
331 Ga0496108_0473107 3300048911 Bacteria 1095
332 Ga0496109_0009030 3300048912 Bacteria 8491
333 Ga0496109_0234431 3300048912 Bacteria 1727
334 Ga0496110_0034280 3300048913 Bacteria 4396
335 Ga0496110_0053908 3300048913 Bacteria 3536
336 Ga0496111_0023692 3300048914 Bacteria 4311
337 Ga0496111_0335922 3300048914 Bacteria 1118
338 Ga0496113_0068383 3300048916 Bacteria 2695
339 Ga0496113_0333753 3300048916 Bacteria 1216
340 Ga0496114_0071928 3300048917 Bacteria 2907
341 Ga0496114_0213408 3300048917 Bacteria 1693
342 Ga0496117_0124035 3300048920 Bacteria 1580
343 Ga0496118_0051036 3300048921 Bacteria 3168
344 Ga0496118_0154880 3300048921 Bacteria 1427
345 Ga0496119_0026881 3300048922 Bacteria 3976
346 Ga0496122_0000659 3300048925 Bacteria 69472
347 Ga0496122_0000756 3300048925 Bacteria 62664
348 Ga0496123_0000172 3300048926 Bacteria 130598
349 Ga0496124_0001516 3300048927 Bacteria 33813
350 Ga0501038_0011435 3300049574 Bacteria 8097
351 Ga0501038_0077624 3300049574 Bacteria 2803
352 Ga0501038_0162869 3300049574 Bacteria 1811
353 Ga0501039_0001360 3300049575 Bacteria 17932
354 Ga0501043_0008408 3300049579 Bacteria 8129
355 Ga0501067_0387268 3300049583 Bacteria 779
356 Ga0501069_0292727 3300049585 Bacteria 954
357 Ga0501206_004145 3300049653 Bacteria 1842
358 Ga0501209_051082 3300049656 Bacteria 1128
359 Ga0501235_079502 3300049669 Bacteria 782
360 Ga0501235_097651 3300049669 Bacteria 715
361 nmdc:mga03n38_7974_c1 3300050490 Bacteria 3774
362 nmdc:mga06z11_56128_c1 3300050494 Bacteria 2036
363 nmdc:mga08y16_3691_c1 3300050511 Bacteria 15939
364 nmdc:mga0n895_113_c1 3300050512 Bacteria 47856
365 nmdc:mga0rr50_116553_c1 3300050513 Bacteria 2121
366 nmdc:mga08x19_5066_c1 3300050514 Bacteria 7794
367 nmdc:mga0a205_451_c1 3300050515 Bacteria 31814
368 Ga0495655_0001226 3300053083 Bacteria 3960
369 Ga0500604_0063205 3300053151 Bacteria 1167
370 Ga0500616_0010094 3300053153 Bacteria 5672
371 Ga0587073_0006856 3300059492 Bacteria 1774
372 Ga0587090_023958 3300059510 Bacteria 975
373 Ga0466962_0004987 3300061719 Bacteria 6384
374 Ga0466962_0008169 3300061719 Bacteria 5019
375 Ga0466962_0208167 3300061719 Bacteria 956
376 Ga0466962_0230540 3300061719 Bacteria 908
377 2537898634 2537561592 Bacteria 4348607
378 2731906328 2731639228 Bacteria 4187555
379 2753036822 2751185725 Bacteria 5740550
380 2753324693 2751185792 Bacteria 5739090
381 2791910123 2791354901 Bacteria 8322202
382 2808892530 2808606370 Bacteria 4942454
383 2810365476 2808606700 Bacteria 3482157
384 2819690534 2818991462 Bacteria 4320267
385 2839987697 2839986021 Bacteria 3685650
386 2844854146 2844852863 Bacteria 3849151
387 2855675856 2855670206 Bacteria 7120389
388 2857295199 2857288857 Bacteria 7189066
389 2857731481 2857729791 Bacteria 4040535
390 2857743111 2857740372 Bacteria 4782044
391 2858882960 2858882152 Bacteria 7230291
392 2858901792 2858895516 Bacteria 7378898
393 2869067247 2869061728 Bacteria 7112407
394 2869068864 2869068681 Bacteria 7205615
395 2904497327 2904497146 Bacteria 4731781
396 2905928183 2905926851 Bacteria 4423176
397 2910810564 2910809715 Bacteria 4982797
398 2919035093 2919034639 Bacteria 4763403
399 2919393578 2919391150 Bacteria 4884741
400 2919540027 2919538618 Bacteria 4677069
401 2933420162 2933418574 Bacteria 4476724
402 2939661943 2939660829 Bacteria 3784848
403 2945917101 2945916053 Bacteria 4555517
404 2945922006 2945920336 Bacteria 4501603
405 2945960472 2945956166 Bacteria 5110334
406 2946004592 2946003308 Bacteria 3857229
407 2946005763 2946003308 Bacteria 3857229
408 2946037350 2946037020 Bacteria 4900426
409 2946037744 2946037020 Bacteria 4900426
410 2953999013 2953998280 Bacteria 4812144
411 8003834999 8003830390 Bacteria 6541657
412 8003872699 8003870546 Bacteria 7396674
413 8054734168 8054727385 Bacteria 7558670
414 Ga0501217_063767
415 LJQas_1001005
416 LJQas_1002183
417 LJQas_1002316
418 LJQas_1011289
419 Ga0070683_100042676
420 Ga0070683_100171104
421 Ga0070659_100793482
422 Ga0070700_100600490
423 Ga0070663_100000145
424 Ga0070663_101262028
425 Ga0070664_100186234
426 Ga0068857_100083937
427 Ga0068852_100663336
428 Ga0068851_10151785
429 Ga0068851_10416036
430 Ga0075365_10004789
431 Ga0075365_10413381
432 Ga0075363_100009237
433 Ga0075367_10080337
434 Ga0075433_10011013
435 Ga0075434_100002177
436 Ga0075436_100003276
437 Ga0075435_100156870
438 Ga0105244_10024317
439 Ga0111539_10001113
440 Ga0105238_10690761
441 Ga0157369_10728939
442 Ga0163162_10916275
443 Ga0157372_10324320
444 Ga0157372_11403230
445 Ga0163163_10056311
446 Ga0207661_10037327
447 Ga0207679_10842295
448 Ga0207677_10152690
449 Ga0207678_10000089
450 Ga0207678_10443564
451 Ga0207708_10665335
452 Ga0207702_10587004
453 Ga0207674_10102072
454 Ga0207698_10605756
455 Ga0207428_10010583
456 Ga0307513_10008450
457 Ga0307408_100005952
458 Ga0307408_100009400
459 Ga0307408_100020876
460 Ga0307408_100031159
461 Ga0307408_100105382
462 Ga0307408_100179466
463 Ga0307408_100179578
464 Ga0307408_100312722
465 Ga0307408_100343282
466 Ga0307408_100360823
467 Ga0307408_100415848
468 Ga0307408_100450446
469 Ga0307408_100702096
470 Ga0307405_10028058
471 Ga0307405_10049816
472 Ga0307405_10058361
473 Ga0307405_10085725
474 Ga0307405_10133310
475 Ga0307405_10146653
476 Ga0307405_10165712
477 Ga0307405_10443981
478 Ga0307405_10461643
479 Ga0307405_10493729
480 Ga0307405_10545576
481 Ga0307405_10548336
482 Ga0307405_10899602
483 Ga0307405_11061451
484 Ga0307413_10004087
485 Ga0307413_10018510
486 Ga0307413_10056344
487 Ga0307413_10109526
488 Ga0307413_10204534
489 Ga0307413_10716391
490 Ga0307410_10011011
491 Ga0307410_10030856
492 Ga0307410_10032239
493 Ga0307410_10044470
494 Ga0307410_10047296
495 Ga0307410_10061718
496 Ga0307410_10081103
497 Ga0307410_10097562
498 Ga0307410_10141019
499 Ga0307410_10149210
500 Ga0307410_10171827
501 Ga0307410_10285302
502 Ga0307410_10340491
503 Ga0307410_10440540
504 Ga0307410_10449134
505 Ga0307410_10498552
506 Ga0307410_10511506
507 Ga0326468_10000411
508 Ga0307406_10032663
509 Ga0307406_10054819
510 Ga0307406_10060318
511 Ga0307406_10067632
512 Ga0307406_10184464
513 Ga0307406_10201194
514 Ga0307407_10005728
515 Ga0307407_10017732
516 Ga0307407_10023999
517 Ga0307407_10044057
518 Ga0307407_10047935
519 Ga0307407_10059254
520 Ga0307407_10117185
521 Ga0307407_10239237
522 Ga0307407_10253823
523 Ga0307407_10456241
524 Ga0307407_10456896
525 Ga0307412_10001782
526 Ga0307412_10019640
527 Ga0307412_10028281
528 Ga0307412_10030966
529 Ga0307412_10058271
530 Ga0307412_10076203
531 Ga0307412_10143744
532 Ga0307412_10172154
533 Ga0307412_10272702
534 Ga0307412_10662567
535 Ga0307412_10679288
536 Ga0307409_100004988
537 Ga0307409_100008502
538 Ga0307409_100009071
539 Ga0307409_100014699
540 Ga0307409_100043540
541 Ga0307409_100062809
542 Ga0307409_100088832
543 Ga0307409_100105230
544 Ga0307409_100136093
545 Ga0307409_100136895
546 Ga0307409_100166816
547 Ga0307409_100257600
548 Ga0307409_100264514
549 Ga0307409_100353596
550 Ga0307409_100477902
551 Ga0307409_100583212
552 Ga0307409_100784618
553 Ga0307409_101006643
554 Ga0307416_100001791
555 Ga0307416_100002713
556 Ga0307416_100016082
557 Ga0307416_100021741
558 Ga0307416_100036968
559 Ga0307416_100043890
560 Ga0307416_100050699
561 Ga0307416_100062595
562 Ga0307416_100096547
563 Ga0307416_100112503
564 Ga0307416_100126602
565 Ga0307416_100151837
566 Ga0307416_100250475
567 Ga0307416_100292006
568 Ga0307416_100352910
569 Ga0307416_100409722
570 Ga0307416_100656042
571 Ga0307416_100743604
572 Ga0307416_100773042
573 Ga0307416_100785326
574 Ga0307416_100852148
575 Ga0307416_101217686
576 Ga0307416_101814315
577 Ga0307414_10015033
578 Ga0307414_10091708
579 Ga0307414_10233281
580 Ga0307414_10529014
581 Ga0307414_11065005
582 Ga0307414_11330330
583 Ga0307411_10026402
584 Ga0307411_10076532
585 Ga0307411_10190526
586 Ga0307411_10202508
587 Ga0307411_10221163
588 Ga0307411_10955182
589 Ga0307415_100001308
590 Ga0307415_100004549
591 Ga0307415_100012000
592 Ga0307415_100015504
593 Ga0307415_100026601
594 Ga0307415_100046531
595 Ga0307415_100048954
596 Ga0307415_100109901
597 Ga0307415_100226211
598 Ga0307415_100238993
599 Ga0307415_100250753
600 Ga0307415_100347060
601 Ga0307415_100639130
602 Ga0307415_100800157
603 Ga0307415_101093745
604 Ga0395899_0013109
605 Ga0395899_0324173
606 Ga0395900_0029715
607 Ga0395900_0064034
608 Ga0395900_0191566
609 Ga0395900_0570599
610 Ga0395898_0002305
611 Ga0395898_0056098
612 Ga0395898_0069042
613 Ga0395898_0160627
614 Ga0395901_0006063
615 Ga0395901_0329233
616 Ga0395901_0377371
617 Ga0395901_0514928
618 Ga0395901_0596438
619 Ga0395901_0930220
620 Ga0436365_0842797
621 Ga0436363_1083345
622 Ga0436362_0614489
623 Ga0439465_0119880
624 Ga0439442_000842
625 Ga0439448_0047538
626 Ga0439463_009705
627 Ga0439460_0172002
628 Ga0466969_0097902
629 Ga0466969_0147082
630 Ga0466969_0157383
631 Ga0466972_0052527
632 Ga0466972_0069720
633 Ga0466972_0083832
634 Ga0466972_0114812
635 Ga0466972_0128215
636 Ga0466965_0000272
637 Ga0466965_0025361
638 Ga0466965_0031985
639 Ga0466965_0066888
640 Ga0466965_0113456
641 Ga0466965_0377556
642 Ga0466966_0052494
643 Ga0466966_0053142
644 Ga0466966_0376628
645 Ga0466966_0517339
646 Ga0466961_0056260
647 Ga0466961_0186626
648 Ga0466961_0188148
649 Ga0466961_0224547
650 Ga0466961_0256620
651 Ga0466963_0001730
652 Ga0466963_0003836
653 Ga0466963_0028044
654 Ga0466963_0171556
655 Ga0466964_0000567
656 Ga0466964_0008269
657 Ga0466964_0018209
658 Ga0466964_0022945
659 Ga0466964_0071369
660 Ga0466971_0003414
661 Ga0466971_0057658
662 Ga0466971_0130398
663 Ga0466968_0032306
664 Ga0466968_0109445
665 Ga0466970_0006832
666 Ga0466970_0018449
667 Ga0466970_0063264
668 Ga0466970_0067090
669 Ga0466970_0167141
670 Ga0466957_0002884
671 Ga0466957_0019371
672 Ga0466957_0025601
673 Ga0466957_0138331
674 Ga0466957_0177701
675 Ga0466957_0237897
676 Ga0466957_0498187
677 Ga0466957_0996486
678 Ga0466960_0004004
679 Ga0466960_0004407
680 Ga0466960_0004609
681 Ga0466960_0004683
682 Ga0466960_0004939
683 Ga0466960_0006308
684 Ga0466960_0018807
685 Ga0466960_0029040
686 Ga0466960_0035607
687 Ga0466960_0038678
688 Ga0466960_0044153
689 Ga0466960_0050540
690 Ga0466960_0055405
691 Ga0466960_0078316
692 Ga0466960_0084892
693 Ga0466960_0136506
694 Ga0466960_0174532
695 Ga0466960_0185915
696 Ga0466960_0313440
697 Ga0466959_0011510
698 Ga0466959_0047736
699 Ga0466959_0074642
700 Ga0466959_0094456
701 Ga0466959_0289627
702 Ga0466958_0017508
703 Ga0466958_0021179
704 Ga0466958_0049857
705 Ga0466958_0051992
706 Ga0466958_0320584
707 Ga0466958_0354596
708 Ga0466967_0000431
709 Ga0466967_0005484
710 Ga0466967_0019182
711 Ga0466967_0028217
712 Ga0466967_0065098
713 Ga0466967_0101245
714 Ga0466967_0109360
715 Ga0466967_0528563
716 Ga0466967_1273802
717 Ga0495638_0139130
718 Ga0495610_0234473
719 Ga0495642_0110701
720 Ga0495609_0171955
721 Ga0495656_0143113
722 Ga0495656_0378258
723 Ga0495668_0414273
724 Ga0495588_0022529
725 Ga0495588_0084663
726 Ga0495670_0011090
727 Ga0495677_0307324
728 Ga0495677_0321721
729 Ga0496100_0031388
730 Ga0496100_0075429
731 Ga0496101_0005350
732 Ga0496101_0040671
733 Ga0496102_0364885
734 Ga0496102_1060016
735 Ga0496103_0013959
736 Ga0496103_0519858
737 Ga0496104_0324993
738 Ga0496105_0057592
739 Ga0496106_0028514
740 Ga0496106_0189560
741 Ga0496107_0031876
742 Ga0496108_0088080
743 Ga0496108_0424035
744 Ga0496108_0473107
745 Ga0496109_0009030
746 Ga0496109_0234431
747 Ga0496110_0034280
748 Ga0496110_0053908
749 Ga0496111_0023692
750 Ga0496111_0335922
751 Ga0496113_0068383
752 Ga0496113_0333753
753 Ga0496114_0071928
754 Ga0496114_0213408
755 Ga0496117_0124035
756 Ga0496118_0051036
757 Ga0496118_0154880
758 Ga0496119_0026881
759 Ga0496122_0000659
760 Ga0496122_0000756
761 Ga0496123_0000172
762 Ga0496124_0001516
763 Ga0501038_0011435
764 Ga0501038_0077624
765 Ga0501038_0162869
766 Ga0501039_0001360
767 Ga0501043_0008408
768 Ga0501067_0387268
769 Ga0501069_0292727
770 Ga0501206_004145
771 Ga0501209_051082
772 Ga0501235_079502
773 Ga0501235_097651
774 nmdc:mga03n38_7974_c1
775 nmdc:mga06z11_56128_c1
776 nmdc:mga08y16_3691_c1
777 nmdc:mga0n895_113_c1
778 nmdc:mga0rr50_116553_c1
779 nmdc:mga08x19_5066_c1
780 nmdc:mga0a205_451_c1
781 Ga0495655_0001226
782 Ga0500604_0063205
783 Ga0500616_0010094
784 Ga0587073_0006856
785 Ga0587090_023958
786 Ga0466962_0004987
787 Ga0466962_0008169
788 Ga0466962_0208167
789 Ga0466962_0230540
790 2537898634
791 2731906328
792 2753036822
793 2753324693
794 2791910123
795 2808892530
796 2810365476
797 2819690534
798 2839987697
799 2844854146
800 2855675856
801 2857295199
802 2857731481
803 2857743111
804 2858882960
805 2858901792
806 2869067247
807 2869068864
808 2904497327
809 2905928183
810 2910810564
811 2919035093
812 2919393578
813 2919540027
814 2933420162
815 2939661943
816 2945917101
817 2945922006
818 2945960472
819 2946004592
820 2946005763
821 2946037350
822 2946037744
823 2953999013
824 8003834999
825 8003872699
826 8054734168

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map