F437659

General Info

Members Datasets Scaffolds Average Seq Length
411 231 822 149

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_20250_c1|nmdc:mga0n895_20250_c1_910_1431
Length 173
Sequence MRLDRVDESGRERPGDLLDSQSRIAPMPVDYRFHLAVGSRFENIELVQVVLKDCLQRIGMDDDAQHWVDVAVREALANAIKHGNLQHPEKQVQVDLAVEGEELVIRVEDEGVGFDATQLDDPLAPENRLRPNGRGIFYMRSFMDDITYGSGPGGGTMVTLRKRFAGPKTEPSD

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
155 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
159 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
160 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
163 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
164 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
165 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
166 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.92
Nodule 0
Rhizoplane 4.14
Rhizosphere 91
Stem 0
Stem Tuber 0
Unclassified 17.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_20250_c1 3300050512 Bacteria 6199
2 rootH1_10024418 3300003316 Unclassified 4044
3 rootL2_10158080 3300003322 Bacteria 1490
4 rootH1_10224371 3300003323 Bacteria 3205
5 Ga0065712_10030004 3300005290 Bacteria 1490
6 Ga0065712_10287342 3300005290 Unclassified 884
7 Ga0065715_10157189 3300005293 Unclassified 1665
8 Ga0065715_10216788 3300005293 Bacteria 1289
9 Ga0065715_10531819 3300005293 Bacteria 755
10 Ga0065707_11100662 3300005295 Unclassified 515
11 Ga0070658_10195247 3300005327 Bacteria 1707
12 Ga0070658_10905377 3300005327 Bacteria 767
13 Ga0070676_10006199 3300005328 Bacteria 6386
14 Ga0070683_100199146 3300005329 Bacteria 1902
15 Ga0070690_100019781 3300005330 Bacteria 4094
16 Ga0070670_100325986 3300005331 Bacteria 1346
17 Ga0070670_101360626 3300005331 Bacteria 650
18 Ga0068869_100054366 3300005334 Bacteria 2915
19 Ga0070666_10225166 3300005335 Bacteria 1324
20 Ga0070682_101510756 3300005337 Unclassified 578
21 Ga0068868_100173859 3300005338 Bacteria 1784
22 Ga0070660_100605601 3300005339 Bacteria 916
23 Ga0070660_101248536 3300005339 Bacteria 630
24 Ga0070689_100295030 3300005340 Unclassified 1348
25 Ga0070691_10125348 3300005341 Unclassified 1297
26 Ga0070687_100064530 3300005343 Bacteria 1946
27 Ga0070661_100862249 3300005344 Bacteria 746
28 Ga0070668_100145007 3300005347 Bacteria 1916
29 Ga0070669_100000002 3300005353 Bacteria 506497
30 Ga0070669_100207504 3300005353 Unclassified 1544
31 Ga0070669_101166713 3300005353 Unclassified 665
32 Ga0070675_100540484 3300005354 Unclassified 1053
33 Ga0070675_100858443 3300005354 Bacteria 831
34 Ga0070671_100064851 3300005355 Bacteria 3042
35 Ga0070674_100017695 3300005356 Bacteria 4491
36 Ga0070674_100063022 3300005356 Bacteria 2593
37 Ga0070674_100155290 3300005356 Bacteria 1731
38 Ga0070673_100010452 3300005364 Bacteria 6284
39 Ga0070688_100090423 3300005365 Bacteria 1999
40 Ga0070688_100679604 3300005365 Unclassified 795
41 Ga0070659_100644559 3300005366 Bacteria 913
42 Ga0070667_100039005 3300005367 Bacteria 3982
43 Ga0070667_100067549 3300005367 Bacteria 3040
44 Ga0070667_102219281 3300005367 Bacteria 517
45 Ga0070703_10067636 3300005406 Unclassified 1185
46 Ga0070710_10069734 3300005437 Bacteria 2023
47 Ga0070700_100211693 3300005441 Bacteria 1368
48 Ga0070700_100461988 3300005441 Bacteria 968
49 Ga0070694_100150064 3300005444 Bacteria 1701
50 Ga0070663_100205725 3300005455 Bacteria 1538
51 Ga0070678_100347064 3300005456 Bacteria 1275
52 Ga0070678_100411775 3300005456 Unclassified 1177
53 Ga0070678_100565931 3300005456 Bacteria 1011
54 Ga0070662_100062174 3300005457 Bacteria 2727
55 Ga0068867_100098758 3300005459 Bacteria 2227
56 Ga0068867_100659154 3300005459 Bacteria 919
57 Ga0068867_100789336 3300005459 Unclassified 846
58 Ga0068867_101383687 3300005459 Bacteria 652
59 Ga0070685_10040715 3300005466 Bacteria 2645
60 Ga0070685_10456597 3300005466 Unclassified 896
61 Ga0070706_100465628 3300005467 Bacteria 1176
62 Ga0070698_100059844 3300005471 Bacteria 3846
63 Ga0070698_100114168 3300005471 Unclassified 2666
64 Ga0070684_100412585 3300005535 Bacteria 1246
65 Ga0070697_100415859 3300005536 Bacteria 1168
66 Ga0070672_100043659 3300005543 Bacteria 3458
67 Ga0070672_100443154 3300005543 Bacteria 1118
68 Ga0070686_100040059 3300005544 Bacteria 2922
69 Ga0070686_100169665 3300005544 Bacteria 1542
70 Ga0070686_100180310 3300005544 Bacteria 1500
71 Ga0070686_100586851 3300005544 Bacteria 876
72 Ga0070686_100711934 3300005544 Bacteria 802
73 Ga0070695_100234264 3300005545 Bacteria 1329
74 Ga0070696_101114754 3300005546 Unclassified 664
75 Ga0070693_100005209 3300005547 Bacteria 6222
76 Ga0070665_100000192 3300005548 Bacteria 108722
77 Ga0070665_100365896 3300005548 Bacteria 1448
78 Ga0070704_100096662 3300005549 Bacteria 2215
79 Ga0068854_100486447 3300005578 Bacteria 1037
80 Ga0068854_100669330 3300005578 Bacteria 893
81 Ga0068852_100163300 3300005616 Bacteria 2081
82 Ga0068852_100483996 3300005616 Bacteria 1230
83 Ga0068859_100785124 3300005617 Unclassified 1040
84 Ga0068861_100179809 3300005719 Bacteria 1760
85 Ga0068863_100020569 3300005841 Bacteria 6308
86 Ga0068860_100026375 3300005843 Bacteria 5602
87 Ga0068860_101636377 3300005843 Bacteria 666
88 Ga0068860_102437198 3300005843 Unclassified 543
89 Ga0068862_100001063 3300005844 Bacteria 26294
90 Ga0068862_100174271 3300005844 Archaea 1927
91 Ga0068862_100542422 3300005844 Unclassified 1109
92 Ga0068862_100575972 3300005844 Bacteria 1078
93 Ga0068862_100635823 3300005844 Bacteria 1028
94 Ga0081455_10166949 3300005937 Bacteria 1680
95 Ga0075368_10020730 3300006042 Bacteria 2491
96 Ga0075364_10060837 3300006051 Bacteria 2476
97 Ga0070716_100763650 3300006173 Unclassified 745
98 Ga0075362_10009387 3300006177 Bacteria 3784
99 Ga0075367_10005729 3300006178 Bacteria 6206
100 Ga0075366_10028714 3300006195 Bacteria 3266
101 Ga0075366_10209472 3300006195 Bacteria 1186
102 Ga0097621_100420910 3300006237 Bacteria 1199
103 Ga0075370_10115286 3300006353 Bacteria 1562
104 Ga0068871_100285769 3300006358 Bacteria 1444
105 Ga0068871_100313162 3300006358 Bacteria 1380
106 Ga0068871_101486795 3300006358 Unclassified 640
107 Ga0075428_100062107 3300006844 Bacteria 4091
108 Ga0075430_100003696 3300006846 Bacteria 12853
109 Ga0075430_100627549 3300006846 Bacteria 886
110 Ga0075430_100794784 3300006846 Bacteria 780
111 Ga0075431_100007301 3300006847 Bacteria 11007
112 Ga0075431_100044851 3300006847 Bacteria 4559
113 Ga0075431_100372034 3300006847 Bacteria 1434
114 Ga0075431_100426912 3300006847 Bacteria 1324
115 Ga0075431_100984420 3300006847 Unclassified 811
116 Ga0075433_11074809 3300006852 Bacteria 700
117 Ga0075434_100041613 3300006871 Bacteria 4552
118 Ga0075434_100078655 3300006871 Bacteria 3294
119 Ga0075434_100317436 3300006871 Unclassified 1578
120 Ga0075434_100339058 3300006871 Bacteria 1524
121 Ga0075429_100069787 3300006880 Bacteria 3059
122 Ga0068865_100831446 3300006881 Unclassified 799
123 Ga0075436_100001835 3300006914 Bacteria 14562
124 Ga0075436_100006708 3300006914 Bacteria 7881
125 Ga0097620_100785122 3300006931 Unclassified 1040
126 Ga0075435_100001939 3300007076 Bacteria 13481
127 Ga0075435_100251991 3300007076 Unclassified 1503
128 Ga0075435_100338545 3300007076 Bacteria 1289
129 Ga0111539_10028480 3300009094 Bacteria 6813
130 Ga0111539_10317010 3300009094 Bacteria 1815
131 Ga0111539_10548688 3300009094 Bacteria 1346
132 Ga0105245_10063695 3300009098 Bacteria 3330
133 Ga0105245_10423579 3300009098 Bacteria 1335
134 Ga0114129_10000968 3300009147 Bacteria 37549
135 Ga0114129_10006542 3300009147 Bacteria 16534
136 Ga0114129_10008612 3300009147 Bacteria 14547
137 Ga0114129_10008990 3300009147 Bacteria 14249
138 Ga0114129_11045199 3300009147 Bacteria 1026
139 Ga0114129_11098514 3300009147 Bacteria 996
140 Ga0105241_10090887 3300009174 Bacteria 2408
141 Ga0105248_10058782 3300009177 Bacteria 4318
142 Ga0105248_10762698 3300009177 Unclassified 1092
143 Ga0105248_11167857 3300009177 Bacteria 870
144 Ga0105249_10451162 3300009553 Bacteria 1325
145 Ga0105249_11878691 3300009553 Unclassified 671
146 Ga0105239_10161873 3300010375 Bacteria 2500
147 Ga0157374_10455881 3300013296 Bacteria 1280
148 Ga0157378_10104679 3300013297 Bacteria 2587
149 Ga0157378_10454861 3300013297 Bacteria 1271
150 Ga0157375_10096362 3300013308 Unclassified 3031
151 Ga0163163_10123109 3300014325 Bacteria 2629
152 Ga0163163_10883364 3300014325 Bacteria 957
153 Ga0157380_10017877 3300014326 Bacteria 5256
154 Ga0157380_10395940 3300014326 Bacteria 1309
155 Ga0157380_10694308 3300014326 Bacteria 1022
156 Ga0157376_11594753 3300014969 Bacteria 687
157 Ga0207673_1029370 3300025290 Bacteria 759
158 Ga0207697_10004140 3300025315 Bacteria 6995
159 Ga0207697_10115526 3300025315 Bacteria 1152
160 Ga0207682_10060344 3300025893 Bacteria 1586
161 Ga0207692_10013765 3300025898 Unclassified 3518
162 Ga0207642_10339222 3300025899 Bacteria 883
163 Ga0207688_10021187 3300025901 Bacteria 3551
164 Ga0207688_10051307 3300025901 Bacteria 2310
165 Ga0207680_10274676 3300025903 Bacteria 1169
166 Ga0207680_10525998 3300025903 Bacteria 843
167 Ga0207647_10136469 3300025904 Bacteria 1439
168 Ga0207645_10010740 3300025907 Bacteria 6277
169 Ga0207705_10081071 3300025909 Bacteria 2365
170 Ga0207684_10976316 3300025910 Bacteria 710
171 Ga0207695_10839497 3300025913 Bacteria 799
172 Ga0207662_10022198 3300025918 Bacteria 3636
173 Ga0207657_10243003 3300025919 Bacteria 1437
174 Ga0207657_10773546 3300025919 Bacteria 743
175 Ga0207649_10709084 3300025920 Bacteria 781
176 Ga0207681_10000009 3300025923 Bacteria 410736
177 Ga0207681_10261189 3300025923 Unclassified 1356
178 Ga0207681_10916212 3300025923 Unclassified 734
179 Ga0207681_11551610 3300025923 Bacteria 555
180 Ga0207650_10319690 3300025925 Bacteria 1271
181 Ga0207650_10791598 3300025925 Bacteria 803
182 Ga0207659_10429702 3300025926 Bacteria 1109
183 Ga0207687_10767275 3300025927 Bacteria 821
184 Ga0207644_10147143 3300025931 Bacteria 1819
185 Ga0207690_10812460 3300025932 Unclassified 773
186 Ga0207709_10025703 3300025935 Bacteria 3373
187 Ga0207709_10900043 3300025935 Bacteria 719
188 Ga0207670_10148770 3300025936 Unclassified 1735
189 Ga0207669_10041104 3300025937 Bacteria 2688
190 Ga0207669_10957731 3300025937 Unclassified 717
191 Ga0207669_11403603 3300025937 Unclassified 595
192 Ga0207665_10213362 3300025939 Bacteria 1411
193 Ga0207665_11412572 3300025939 Bacteria 554
194 Ga0207691_10005426 3300025940 Bacteria 12309
195 Ga0207691_10282940 3300025940 Bacteria 1427
196 Ga0207691_10911490 3300025940 Bacteria 736
197 Ga0207711_10130914 3300025941 Bacteria 2249
198 Ga0207711_10718346 3300025941 Bacteria 932
199 Ga0207689_10025520 3300025942 Bacteria 4952
200 Ga0207651_10005278 3300025960 Bacteria 6609
201 Ga0207651_10236381 3300025960 Unclassified 1487
202 Ga0207651_10697879 3300025960 Unclassified 894
203 Ga0207651_11135916 3300025960 Unclassified 701
204 Ga0207712_10723118 3300025961 Bacteria 870
205 Ga0207668_10151843 3300025972 Unclassified 1794
206 Ga0207668_10270069 3300025972 Bacteria 1390
207 Ga0207640_10072683 3300025981 Bacteria 2321
208 Ga0207640_10692115 3300025981 Bacteria 873
209 Ga0207658_10053957 3300025986 Bacteria 2972
210 Ga0207658_10880284 3300025986 Bacteria 815
211 Ga0207658_11761350 3300025986 Bacteria 565
212 Ga0207677_10727676 3300026023 Bacteria 883
213 Ga0207678_10074071 3300026067 Bacteria 2918
214 Ga0207678_10321487 3300026067 Unclassified 1331
215 Ga0207708_10042500 3300026075 Bacteria 3465
216 Ga0207648_10166857 3300026089 Bacteria 1946
217 Ga0207648_10213396 3300026089 Bacteria 1714
218 Ga0207648_10738451 3300026089 Bacteria 914
219 Ga0207675_100134176 3300026118 Bacteria 2348
220 Ga0207683_10024452 3300026121 Bacteria 5204
221 Ga0207683_10581543 3300026121 Bacteria 1036
222 Ga0207698_10272350 3300026142 Bacteria 1561
223 Ga0209971_1065482 3300027682 Bacteria 880
224 Ga0209974_10082673 3300027876 Bacteria 1107
225 Ga0207428_10229331 3300027907 Bacteria 1390
226 Ga0207428_10434276 3300027907 Bacteria 958
227 Ga0268266_10000298 3300028379 Bacteria 79989
228 Ga0268266_10648819 3300028379 Bacteria 1016
229 Ga0268265_10002426 3300028380 Bacteria 14077
230 Ga0268265_10177999 3300028380 Bacteria 1825
231 Ga0268265_10224240 3300028380 Bacteria 1647
232 Ga0268265_10575838 3300028380 Unclassified 1072
233 Ga0268265_10946939 3300028380 Unclassified 848
234 Ga0268264_10008495 3300028381 Bacteria 8533
235 Ga0268264_10330568 3300028381 Bacteria 1444
236 Ga0307508_10004869 3300031616 Bacteria 12920
237 Ga0265314_10381747 3300031711 Bacteria 767
238 Ga0307405_10437537 3300031731 Unclassified 1033
239 Ga0307413_10009371 3300031824 Bacteria 4682
240 Ga0307410_10121429 3300031852 Bacteria 1906
241 Ga0307412_11121126 3300031911 Unclassified 701
242 Ga0307409_100260809 3300031995 Bacteria 1590
243 Ga0307409_100732491 3300031995 Bacteria 991
244 Ga0307416_100518790 3300032002 Bacteria 1259
245 Ga0307411_10132514 3300032005 Bacteria 1824
246 Ga0373929_0000013 3300035085 Bacteria 159542
247 Ga0373936_0129331 3300035113 Bacteria 1084
248 Ga0373943_0186410 3300035170 Unclassified 1143
249 Ga0373961_0000425 3300035241 Bacteria 17488
250 Ga0373935_0006494 3300035692 Bacteria 6986
251 Ga0373937_0221708 3300036401 Bacteria 1780
252 Ga0373925_0255294 3300037068 Bacteria 1407
253 Ga0395905_0731135 3300037471 Bacteria 892
254 Ga0451789_1331690 3300041443 Bacteria 1269
255 Ga0451797_1151507 3300041453 Bacteria 1420
256 Ga0451802_1559874 3300041460 Unclassified 764
257 Ga0451807_1628516 3300041486 Bacteria 729
258 Ga0451807_1899612 3300041486 Bacteria 2017
259 Ga0451837_1739076 3300041494 Bacteria 3033
260 Ga0451849_0781086 3300041505 Bacteria 2628
261 Ga0451843_1057974 3300041509 Unclassified 720
262 Ga0451853_0916079 3300041512 Unclassified 1270
263 Ga0439431_0256944 3300041997 Bacteria 519
264 Ga0439441_039880 3300042001 Bacteria 938
265 Ga0439451_055989 3300042009 Bacteria 789
266 Ga0439456_028434 3300042013 Bacteria 1193
267 Ga0439460_0012499 3300042461 Bacteria 2205
268 Ga0439460_0033405 3300042461 Bacteria 1477
269 Ga0451577_0463742 3300042876 Bacteria 1150
270 Ga0453684_0044176 3300044712 Bacteria 5970
271 Ga0451576_0497289 3300045051 Unclassified 1281
272 Ga0495603_0025640 3300046455 Unclassified 3565
273 Ga0495653_0463080 3300046463 Bacteria 796
274 Ga0495621_0546953 3300046539 Unclassified 503
275 Ga0495656_0221898 3300046615 Unclassified 945
276 Ga0495634_0093089 3300046642 Bacteria 1955
277 Ga0495647_0412077 3300046681 Unclassified 622
278 Ga0495658_0301724 3300046683 Bacteria 1013
279 Ga0495615_0023632 3300048090 Bacteria 1410
280 Ga0496100_0228225 3300048903 Bacteria 1369
281 Ga0496102_0058161 3300048905 Bacteria 3532
282 Ga0496105_0208830 3300048908 Bacteria 1592
283 Ga0496106_0108619 3300048909 Bacteria 2158
284 Ga0496108_0321604 3300048911 Bacteria 1349
285 Ga0496110_0397608 3300048913 Bacteria 1256
286 Ga0496110_0676504 3300048913 Bacteria 933
287 Ga0496111_0077901 3300048914 Bacteria 2417
288 Ga0496111_0246213 3300048914 Bacteria 1327
289 Ga0496113_0699241 3300048916 Bacteria 809
290 Ga0496113_0986366 3300048916 Bacteria 664
291 Ga0496114_0000073 3300048917 Bacteria 71711
292 Ga0501034_0007959 3300049571 Bacteria 11259
293 Ga0501036_0015234 3300049572 Bacteria 6421
294 Ga0501036_0044882 3300049572 Bacteria 3745
295 Ga0501038_0295089 3300049574 Bacteria 1273
296 Ga0501038_0391820 3300049574 Bacteria 1076
297 Ga0501038_1272906 3300049574 Unclassified 532
298 Ga0501039_0154905 3300049575 Bacteria 1800
299 Ga0501039_0197607 3300049575 Bacteria 1581
300 Ga0501039_0456812 3300049575 Bacteria 1003
301 Ga0501040_0010868 3300049576 Bacteria 5951
302 Ga0501040_0043022 3300049576 Bacteria 3078
303 Ga0501041_0112887 3300049577 Bacteria 1686
304 Ga0501041_0161004 3300049577 Bacteria 1403
305 Ga0501041_0536384 3300049577 Bacteria 745
306 Ga0501041_0626274 3300049577 Unclassified 687
307 Ga0501042_0020062 3300049578 Bacteria 4650
308 Ga0501043_0909419 3300049579 Bacteria 631
309 Ga0501046_0062507 3300049580 Bacteria 2909
310 Ga0501046_0752741 3300049580 Bacteria 684
311 Ga0501048_0012859 3300049582 Bacteria 6218
312 Ga0501068_0064370 3300049584 Bacteria 2232
313 Ga0501068_0075542 3300049584 Bacteria 2061
314 Ga0501069_0856326 3300049585 Bacteria 552
315 Ga0501070_1324212 3300049586 Bacteria 549
316 Ga0501071_0008245 3300049587 Bacteria 6878
317 Ga0501071_0044570 3300049587 Bacteria 3182
318 Ga0501071_0044950 3300049587 Bacteria 3169
319 Ga0501071_0106689 3300049587 Bacteria 2068
320 Ga0501071_0813276 3300049587 Unclassified 721
321 Ga0501072_0035491 3300049588 Bacteria 3905
322 Ga0501072_0151067 3300049588 Bacteria 1852
323 Ga0501072_0168011 3300049588 Bacteria 1750
324 Ga0501072_0586112 3300049588 Bacteria 880
325 Ga0501072_0883635 3300049588 Unclassified 698
326 Ga0501074_0349702 3300049590 Bacteria 1049
327 Ga0501074_0463298 3300049590 Unclassified 898
328 Ga0501075_0017488 3300049591 Bacteria 5180
329 Ga0501075_0023937 3300049591 Bacteria 4473
330 Ga0501075_0024012 3300049591 Bacteria 4465
331 Ga0501075_0147701 3300049591 Bacteria 1792
332 Ga0501075_0297397 3300049591 Bacteria 1230
333 Ga0501076_0002651 3300049592 Bacteria 12349
334 Ga0501076_0009856 3300049592 Bacteria 7063
335 Ga0501076_0089907 3300049592 Bacteria 2469
336 Ga0501076_0302261 3300049592 Bacteria 1312
337 Ga0501076_0654463 3300049592 Unclassified 867
338 Ga0501077_0000385 3300049593 Bacteria 26425
339 Ga0501077_0078517 3300049593 Bacteria 2092
340 Ga0501077_0255741 3300049593 Bacteria 1114
341 Ga0501257_151396 3300049686 Unclassified 640
342 Ga0501079_0021210 3300049741 Bacteria 4968
343 Ga0501079_0079502 3300049741 Bacteria 2536
344 Ga0501079_0174549 3300049741 Bacteria 1676
345 Ga0501079_0193151 3300049741 Bacteria 1589
346 Ga0501079_0549076 3300049741 Bacteria 909
347 Ga0501080_0051174 3300049742 Bacteria 3843
348 Ga0501080_0199961 3300049742 Bacteria 1835
349 Ga0501080_0225086 3300049742 Bacteria 1716
350 Ga0501080_0241681 3300049742 Bacteria 1648
351 Ga0501080_0369517 3300049742 Bacteria 1293
352 Ga0501081_0014395 3300049743 Bacteria 5218
353 Ga0501081_0463096 3300049743 Bacteria 942
354 Ga0501081_0470986 3300049743 Bacteria 934
355 Ga0501081_0619781 3300049743 Bacteria 810
356 Ga0501081_1007070 3300049743 Bacteria 630
357 Ga0501083_0000344 3300049744 Bacteria 29353
358 Ga0501268_037467 3300049765 Unclassified 902
359 Ga0501045_0015103 3300049824 Bacteria 5481
360 Ga0501045_0118729 3300049824 Bacteria 1963
361 nmdc:mga03683_2263_c1 3300050489 Bacteria 5939
362 nmdc:mga00v17_12599_c1 3300050491 Bacteria 4669
363 nmdc:mga0k408_15252_c1 3300050493 Bacteria 4246
364 nmdc:mga0k408_32992_c1 3300050493 Bacteria 2959
365 nmdc:mga06z11_7997_c1 3300050494 Bacteria 4383
366 nmdc:mga05p37_1031412_c1 3300050507 Bacteria 870
367 nmdc:mga05p37_259_c1 3300050507 Bacteria 54716
368 nmdc:mga05p37_48100_c1 3300050507 Bacteria 5246
369 nmdc:mga05p37_5732_c1 3300050507 Bacteria 14605
370 nmdc:mga09592_122312_c1 3300050508 Unclassified 2236
371 nmdc:mga09592_217297_c1 3300050508 Bacteria 1656
372 nmdc:mga09592_69741_c1 3300050508 Bacteria 2982
373 nmdc:mga09592_908247_c1 3300050508 Unclassified 740
374 nmdc:mga0qj67_416889_c1 3300050509 Unclassified 1083
375 nmdc:mga0qj67_76296_c1 3300050509 Bacteria 2681
376 nmdc:mga0qj67_99623_c1 3300050509 Unclassified 2342
377 nmdc:mga06r32_1578992_c1 3300050510 Unclassified 595
378 nmdc:mga06r32_180475_c1 3300050510 Unclassified 2097
379 nmdc:mga06r32_241722_c1 3300050510 Bacteria 1793
380 nmdc:mga06r32_373284_c1 3300050510 Bacteria 1409
381 nmdc:mga06r32_40444_c1 3300050510 Bacteria 4427
382 nmdc:mga06r32_66312_c2 3300050510 Unclassified 1109
383 nmdc:mga08y16_1140045_c1 3300050511 Bacteria 753
384 nmdc:mga08y16_252693_c1 3300050511 Unclassified 1821
385 nmdc:mga08y16_94645_c1 3300050511 Bacteria 3112
386 nmdc:mga0n895_20310_c1 3300050512 Bacteria 6192
387 nmdc:mga0n895_321327_c1 3300050512 Bacteria 1569
388 nmdc:mga0n895_62443_c1 3300050512 Bacteria 3682
389 nmdc:mga0n895_767831_c1 3300050512 Unclassified 956
390 nmdc:mga0rr50_5856_c1 3300050513 Bacteria 7392
391 nmdc:mga08x19_19148_c1 3300050514 Bacteria 4198
392 nmdc:mga08x19_4565_c1 3300050514 Bacteria 8219
393 nmdc:mga0a205_59900_c1 3300050515 Bacteria 3677
394 nmdc:mga0a205_93398_c1 3300050515 Bacteria 2907
395 Ga0501084_0046627 3300054114 Bacteria 3631
396 Ga0501084_0256812 3300054114 Bacteria 1475
397 Ga0501084_0259469 3300054114 Bacteria 1467
398 Ga0501084_0287328 3300054114 Bacteria 1389
399 Ga0501084_1164892 3300054114 Bacteria 647
400 Ga0590071_000290 3300059421 Bacteria 14640
401 Ga0590074_001491 3300059423 Bacteria 3775
402 Ga0590075_000267 3300059424 Bacteria 14741
403 Ga0590077_002306 3300059426 Bacteria 4123
404 Ga0501082_0000638 3300060353 Bacteria 30956
405 Ga0501082_0152590 3300060353 Bacteria 2007
406 Ga0501082_0158699 3300060353 Unclassified 1965
407 Ga0501082_0541498 3300060353 Bacteria 1018
408 Ga0530510_0053181 3300061734 Bacteria 2927
409 Ga0530510_0127311 3300061734 Bacteria 1873
410 Ga0530510_0164966 3300061734 Bacteria 1639
411 Ga0530510_0274502 3300061734 Bacteria 1258
412 nmdc:mga0n895_20250_c1
413 rootH1_10024418
414 rootL2_10158080
415 rootH1_10224371
416 Ga0065712_10030004
417 Ga0065712_10287342
418 Ga0065715_10157189
419 Ga0065715_10216788
420 Ga0065715_10531819
421 Ga0065707_11100662
422 Ga0070658_10195247
423 Ga0070658_10905377
424 Ga0070676_10006199
425 Ga0070683_100199146
426 Ga0070690_100019781
427 Ga0070670_100325986
428 Ga0070670_101360626
429 Ga0068869_100054366
430 Ga0070666_10225166
431 Ga0070682_101510756
432 Ga0068868_100173859
433 Ga0070660_100605601
434 Ga0070660_101248536
435 Ga0070689_100295030
436 Ga0070691_10125348
437 Ga0070687_100064530
438 Ga0070661_100862249
439 Ga0070668_100145007
440 Ga0070669_100000002
441 Ga0070669_100207504
442 Ga0070669_101166713
443 Ga0070675_100540484
444 Ga0070675_100858443
445 Ga0070671_100064851
446 Ga0070674_100017695
447 Ga0070674_100063022
448 Ga0070674_100155290
449 Ga0070673_100010452
450 Ga0070688_100090423
451 Ga0070688_100679604
452 Ga0070659_100644559
453 Ga0070667_100039005
454 Ga0070667_100067549
455 Ga0070667_102219281
456 Ga0070703_10067636
457 Ga0070710_10069734
458 Ga0070700_100211693
459 Ga0070700_100461988
460 Ga0070694_100150064
461 Ga0070663_100205725
462 Ga0070678_100347064
463 Ga0070678_100411775
464 Ga0070678_100565931
465 Ga0070662_100062174
466 Ga0068867_100098758
467 Ga0068867_100659154
468 Ga0068867_100789336
469 Ga0068867_101383687
470 Ga0070685_10040715
471 Ga0070685_10456597
472 Ga0070706_100465628
473 Ga0070698_100059844
474 Ga0070698_100114168
475 Ga0070684_100412585
476 Ga0070697_100415859
477 Ga0070672_100043659
478 Ga0070672_100443154
479 Ga0070686_100040059
480 Ga0070686_100169665
481 Ga0070686_100180310
482 Ga0070686_100586851
483 Ga0070686_100711934
484 Ga0070695_100234264
485 Ga0070696_101114754
486 Ga0070693_100005209
487 Ga0070665_100000192
488 Ga0070665_100365896
489 Ga0070704_100096662
490 Ga0068854_100486447
491 Ga0068854_100669330
492 Ga0068852_100163300
493 Ga0068852_100483996
494 Ga0068859_100785124
495 Ga0068861_100179809
496 Ga0068863_100020569
497 Ga0068860_100026375
498 Ga0068860_101636377
499 Ga0068860_102437198
500 Ga0068862_100001063
501 Ga0068862_100174271
502 Ga0068862_100542422
503 Ga0068862_100575972
504 Ga0068862_100635823
505 Ga0081455_10166949
506 Ga0075368_10020730
507 Ga0075364_10060837
508 Ga0070716_100763650
509 Ga0075362_10009387
510 Ga0075367_10005729
511 Ga0075366_10028714
512 Ga0075366_10209472
513 Ga0097621_100420910
514 Ga0075370_10115286
515 Ga0068871_100285769
516 Ga0068871_100313162
517 Ga0068871_101486795
518 Ga0075428_100062107
519 Ga0075430_100003696
520 Ga0075430_100627549
521 Ga0075430_100794784
522 Ga0075431_100007301
523 Ga0075431_100044851
524 Ga0075431_100372034
525 Ga0075431_100426912
526 Ga0075431_100984420
527 Ga0075433_11074809
528 Ga0075434_100041613
529 Ga0075434_100078655
530 Ga0075434_100317436
531 Ga0075434_100339058
532 Ga0075429_100069787
533 Ga0068865_100831446
534 Ga0075436_100001835
535 Ga0075436_100006708
536 Ga0097620_100785122
537 Ga0075435_100001939
538 Ga0075435_100251991
539 Ga0075435_100338545
540 Ga0111539_10028480
541 Ga0111539_10317010
542 Ga0111539_10548688
543 Ga0105245_10063695
544 Ga0105245_10423579
545 Ga0114129_10000968
546 Ga0114129_10006542
547 Ga0114129_10008612
548 Ga0114129_10008990
549 Ga0114129_11045199
550 Ga0114129_11098514
551 Ga0105241_10090887
552 Ga0105248_10058782
553 Ga0105248_10762698
554 Ga0105248_11167857
555 Ga0105249_10451162
556 Ga0105249_11878691
557 Ga0105239_10161873
558 Ga0157374_10455881
559 Ga0157378_10104679
560 Ga0157378_10454861
561 Ga0157375_10096362
562 Ga0163163_10123109
563 Ga0163163_10883364
564 Ga0157380_10017877
565 Ga0157380_10395940
566 Ga0157380_10694308
567 Ga0157376_11594753
568 Ga0207673_1029370
569 Ga0207697_10004140
570 Ga0207697_10115526
571 Ga0207682_10060344
572 Ga0207692_10013765
573 Ga0207642_10339222
574 Ga0207688_10021187
575 Ga0207688_10051307
576 Ga0207680_10274676
577 Ga0207680_10525998
578 Ga0207647_10136469
579 Ga0207645_10010740
580 Ga0207705_10081071
581 Ga0207684_10976316
582 Ga0207695_10839497
583 Ga0207662_10022198
584 Ga0207657_10243003
585 Ga0207657_10773546
586 Ga0207649_10709084
587 Ga0207681_10000009
588 Ga0207681_10261189
589 Ga0207681_10916212
590 Ga0207681_11551610
591 Ga0207650_10319690
592 Ga0207650_10791598
593 Ga0207659_10429702
594 Ga0207687_10767275
595 Ga0207644_10147143
596 Ga0207690_10812460
597 Ga0207709_10025703
598 Ga0207709_10900043
599 Ga0207670_10148770
600 Ga0207669_10041104
601 Ga0207669_10957731
602 Ga0207669_11403603
603 Ga0207665_10213362
604 Ga0207665_11412572
605 Ga0207691_10005426
606 Ga0207691_10282940
607 Ga0207691_10911490
608 Ga0207711_10130914
609 Ga0207711_10718346
610 Ga0207689_10025520
611 Ga0207651_10005278
612 Ga0207651_10236381
613 Ga0207651_10697879
614 Ga0207651_11135916
615 Ga0207712_10723118
616 Ga0207668_10151843
617 Ga0207668_10270069
618 Ga0207640_10072683
619 Ga0207640_10692115
620 Ga0207658_10053957
621 Ga0207658_10880284
622 Ga0207658_11761350
623 Ga0207677_10727676
624 Ga0207678_10074071
625 Ga0207678_10321487
626 Ga0207708_10042500
627 Ga0207648_10166857
628 Ga0207648_10213396
629 Ga0207648_10738451
630 Ga0207675_100134176
631 Ga0207683_10024452
632 Ga0207683_10581543
633 Ga0207698_10272350
634 Ga0209971_1065482
635 Ga0209974_10082673
636 Ga0207428_10229331
637 Ga0207428_10434276
638 Ga0268266_10000298
639 Ga0268266_10648819
640 Ga0268265_10002426
641 Ga0268265_10177999
642 Ga0268265_10224240
643 Ga0268265_10575838
644 Ga0268265_10946939
645 Ga0268264_10008495
646 Ga0268264_10330568
647 Ga0307508_10004869
648 Ga0265314_10381747
649 Ga0307405_10437537
650 Ga0307413_10009371
651 Ga0307410_10121429
652 Ga0307412_11121126
653 Ga0307409_100260809
654 Ga0307409_100732491
655 Ga0307416_100518790
656 Ga0307411_10132514
657 Ga0373929_0000013
658 Ga0373936_0129331
659 Ga0373943_0186410
660 Ga0373961_0000425
661 Ga0373935_0006494
662 Ga0373937_0221708
663 Ga0373925_0255294
664 Ga0395905_0731135
665 Ga0451789_1331690
666 Ga0451797_1151507
667 Ga0451802_1559874
668 Ga0451807_1628516
669 Ga0451807_1899612
670 Ga0451837_1739076
671 Ga0451849_0781086
672 Ga0451843_1057974
673 Ga0451853_0916079
674 Ga0439431_0256944
675 Ga0439441_039880
676 Ga0439451_055989
677 Ga0439456_028434
678 Ga0439460_0012499
679 Ga0439460_0033405
680 Ga0451577_0463742
681 Ga0453684_0044176
682 Ga0451576_0497289
683 Ga0495603_0025640
684 Ga0495653_0463080
685 Ga0495621_0546953
686 Ga0495656_0221898
687 Ga0495634_0093089
688 Ga0495647_0412077
689 Ga0495658_0301724
690 Ga0495615_0023632
691 Ga0496100_0228225
692 Ga0496102_0058161
693 Ga0496105_0208830
694 Ga0496106_0108619
695 Ga0496108_0321604
696 Ga0496110_0397608
697 Ga0496110_0676504
698 Ga0496111_0077901
699 Ga0496111_0246213
700 Ga0496113_0699241
701 Ga0496113_0986366
702 Ga0496114_0000073
703 Ga0501034_0007959
704 Ga0501036_0015234
705 Ga0501036_0044882
706 Ga0501038_0295089
707 Ga0501038_0391820
708 Ga0501038_1272906
709 Ga0501039_0154905
710 Ga0501039_0197607
711 Ga0501039_0456812
712 Ga0501040_0010868
713 Ga0501040_0043022
714 Ga0501041_0112887
715 Ga0501041_0161004
716 Ga0501041_0536384
717 Ga0501041_0626274
718 Ga0501042_0020062
719 Ga0501043_0909419
720 Ga0501046_0062507
721 Ga0501046_0752741
722 Ga0501048_0012859
723 Ga0501068_0064370
724 Ga0501068_0075542
725 Ga0501069_0856326
726 Ga0501070_1324212
727 Ga0501071_0008245
728 Ga0501071_0044570
729 Ga0501071_0044950
730 Ga0501071_0106689
731 Ga0501071_0813276
732 Ga0501072_0035491
733 Ga0501072_0151067
734 Ga0501072_0168011
735 Ga0501072_0586112
736 Ga0501072_0883635
737 Ga0501074_0349702
738 Ga0501074_0463298
739 Ga0501075_0017488
740 Ga0501075_0023937
741 Ga0501075_0024012
742 Ga0501075_0147701
743 Ga0501075_0297397
744 Ga0501076_0002651
745 Ga0501076_0009856
746 Ga0501076_0089907
747 Ga0501076_0302261
748 Ga0501076_0654463
749 Ga0501077_0000385
750 Ga0501077_0078517
751 Ga0501077_0255741
752 Ga0501257_151396
753 Ga0501079_0021210
754 Ga0501079_0079502
755 Ga0501079_0174549
756 Ga0501079_0193151
757 Ga0501079_0549076
758 Ga0501080_0051174
759 Ga0501080_0199961
760 Ga0501080_0225086
761 Ga0501080_0241681
762 Ga0501080_0369517
763 Ga0501081_0014395
764 Ga0501081_0463096
765 Ga0501081_0470986
766 Ga0501081_0619781
767 Ga0501081_1007070
768 Ga0501083_0000344
769 Ga0501268_037467
770 Ga0501045_0015103
771 Ga0501045_0118729
772 nmdc:mga03683_2263_c1
773 nmdc:mga00v17_12599_c1
774 nmdc:mga0k408_15252_c1
775 nmdc:mga0k408_32992_c1
776 nmdc:mga06z11_7997_c1
777 nmdc:mga05p37_1031412_c1
778 nmdc:mga05p37_259_c1
779 nmdc:mga05p37_48100_c1
780 nmdc:mga05p37_5732_c1
781 nmdc:mga09592_122312_c1
782 nmdc:mga09592_217297_c1
783 nmdc:mga09592_69741_c1
784 nmdc:mga09592_908247_c1
785 nmdc:mga0qj67_416889_c1
786 nmdc:mga0qj67_76296_c1
787 nmdc:mga0qj67_99623_c1
788 nmdc:mga06r32_1578992_c1
789 nmdc:mga06r32_180475_c1
790 nmdc:mga06r32_241722_c1
791 nmdc:mga06r32_373284_c1
792 nmdc:mga06r32_40444_c1
793 nmdc:mga06r32_66312_c2
794 nmdc:mga08y16_1140045_c1
795 nmdc:mga08y16_252693_c1
796 nmdc:mga08y16_94645_c1
797 nmdc:mga0n895_20310_c1
798 nmdc:mga0n895_321327_c1
799 nmdc:mga0n895_62443_c1
800 nmdc:mga0n895_767831_c1
801 nmdc:mga0rr50_5856_c1
802 nmdc:mga08x19_19148_c1
803 nmdc:mga08x19_4565_c1
804 nmdc:mga0a205_59900_c1
805 nmdc:mga0a205_93398_c1
806 Ga0501084_0046627
807 Ga0501084_0256812
808 Ga0501084_0259469
809 Ga0501084_0287328
810 Ga0501084_1164892
811 Ga0590071_000290
812 Ga0590074_001491
813 Ga0590075_000267
814 Ga0590077_002306
815 Ga0501082_0000638
816 Ga0501082_0152590
817 Ga0501082_0158699
818 Ga0501082_0541498
819 Ga0530510_0053181
820 Ga0530510_0127311
821 Ga0530510_0164966
822 Ga0530510_0274502

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

37

162

0.95

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

63

166

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m36-assembly2.cif.gz_K the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9445 6 139
6m36-assembly2.cif.gz_O the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.932 7 138
6m36-assembly2.cif.gz_I the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9302 6 139
6m36-assembly2.cif.gz_K the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9269 6 139
6m36-assembly2.cif.gz_O the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.923 7 138
ID Description Score Start End Superfamily
3ke6B02 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8556 1 140 3.30.565.10
af_P9WGX7_40_164_3.90.1100.10 Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; 0.8284 7 139 3.90.1100.10
af_P9WGX7_40_164_3.90.1100.10 Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; 0.8161 7 139 3.90.1100.10
1tidC00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8064 8 136 3.30.565.10
af_P9WLZ7_398_539_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8025 1 148 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A812Q3N9-F1-model_v4 deleted 0.9269 6 89
AF-A0A2V6JRG2-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.902 6 95
AF-A0A1W9WD54-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.9009 6 138
AF-A0A3N9NTF0-F1-model_v4 ATP-binding protein 0.8979 2 138 GO:0004674
GO:0005524
AF-A0A3M1AQH7-F1-model_v4 ATP-binding protein 0.8903 6 139 GO:0004674
GO:0005524

Map