F437646

General Info

Members Datasets Scaffolds Average Seq Length
411 287 822 101

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0156101|Ga0501039_0156101_998_1351
Length 117
Sequence MTAFELESKSAPKGTKMKSRKLTTAALSLXXXXGLGSAFAQAATVNGEVKKIDESAGKVTLKHGPVKNLDMEEDGMIMVFRVQNPTMLKQVKVGDKVQFEAERTISGITITKMQKSK

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
138 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
139 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
143 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
148 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
163 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
182 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
183 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
204 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
212 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
213 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
232 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
252 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
255 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
256 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
257 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
258 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
259 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
260 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
261 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
262 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
263 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
264 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
265 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
268 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
269 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
270 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
271 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
272 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
273 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
274 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
275 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
276 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
277 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
278 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
282 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
283 2791355199
284 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
285 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
286 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
287 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 0
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.52
Nodule 1.22
Rhizoplane 3.65
Rhizosphere 69.83
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0156101 3300049575 Bacteria 1793
2 CNAas_1015841 3300000532 Bacteria 533
3 JGI24750J21931_1025427 3300002070 Bacteria 849
4 JGI25406J46586_10000755 3300003203 Bacteria 15112
5 JGI25153J46596_10018070 3300003215 Bacteria 2752
6 rootH2_10023134 3300003320 Bacteria 1387
7 rootL2_10018361 3300003322 Bacteria 2068
8 Ga0065704_10171751 3300005289 Bacteria 1287
9 Ga0070676_10071235 3300005328 Bacteria 2088
10 Ga0070676_11328515 3300005328 Bacteria 550
11 Ga0070690_100334404 3300005330 Bacteria 1095
12 Ga0070670_100812339 3300005331 Bacteria 845
13 Ga0068869_100142935 3300005334 Bacteria 1849
14 Ga0068869_100338103 3300005334 Bacteria 1225
15 Ga0068869_100370545 3300005334 Bacteria 1172
16 Ga0070666_11040836 3300005335 Bacteria 608
17 Ga0068868_100228727 3300005338 Bacteria 1559
18 Ga0068868_101120769 3300005338 Bacteria 725
19 Ga0070689_100599781 3300005340 Bacteria 954
20 Ga0070691_10553029 3300005341 Bacteria 673
21 Ga0070692_10895535 3300005345 Bacteria 613
22 Ga0070668_100038744 3300005347 Bacteria 3645
23 Ga0070668_100251396 3300005347 Bacteria 1467
24 Ga0070669_100261240 3300005353 Bacteria 1382
25 Ga0070671_100103850 3300005355 Bacteria 2385
26 Ga0070674_100270829 3300005356 Bacteria 1342
27 Ga0070674_100325273 3300005356 Bacteria 1234
28 Ga0070673_100685448 3300005364 Bacteria 940
29 Ga0070673_101437065 3300005364 Bacteria 650
30 Ga0070673_101557757 3300005364 Bacteria 624
31 Ga0070688_100403035 3300005365 Bacteria 1013
32 Ga0070688_100724519 3300005365 Bacteria 772
33 Ga0070667_100030847 3300005367 Bacteria 4470
34 Ga0070667_100157031 3300005367 Bacteria 2001
35 Ga0070667_101568384 3300005367 Bacteria 619
36 Ga0070701_10045898 3300005438 Bacteria 2244
37 Ga0070700_100182939 3300005441 Bacteria 1460
38 Ga0070700_101805932 3300005441 Bacteria 527
39 Ga0070694_100297868 3300005444 Bacteria 1235
40 Ga0070663_102078005 3300005455 Bacteria 512
41 Ga0070678_100099661 3300005456 Bacteria 2248
42 Ga0070678_100236067 3300005456 Bacteria 1526
43 Ga0070678_100896009 3300005456 Bacteria 811
44 Ga0068867_100868092 3300005459 Bacteria 810
45 Ga0070685_10650538 3300005466 Bacteria 764
46 Ga0070698_100264639 3300005471 Bacteria 1651
47 Ga0070698_100888453 3300005471 Unclassified 836
48 Ga0070699_101696139 3300005518 Bacteria 579
49 Ga0070697_101509694 3300005536 Unclassified 600
50 Ga0068853_100391817 3300005539 Bacteria 1299
51 Ga0070672_100231970 3300005543 Bacteria 1551
52 Ga0070672_100291525 3300005543 Bacteria 1382
53 Ga0070672_100558251 3300005543 Bacteria 995
54 Ga0070686_101013166 3300005544 Bacteria 682
55 Ga0070695_100387752 3300005545 Bacteria 1056
56 Ga0070696_100046364 3300005546 Bacteria 3014
57 Ga0070665_100015331 3300005548 Bacteria 7695
58 Ga0070704_100304273 3300005549 Bacteria 1330
59 Ga0068855_101837825 3300005563 Bacteria 615
60 Ga0070664_101782799 3300005564 Bacteria 584
61 Ga0068857_100943047 3300005577 Bacteria 829
62 Ga0068856_100531725 3300005614 Bacteria 1197
63 Ga0068859_100060529 3300005617 Bacteria 3815
64 Ga0068859_100185710 3300005617 Bacteria 2163
65 Ga0068864_100446935 3300005618 Bacteria 1236
66 Ga0068864_100727783 3300005618 Bacteria 971
67 Ga0068866_10288341 3300005718 Bacteria 1020
68 Ga0068866_10383817 3300005718 Bacteria 901
69 Ga0068861_100020091 3300005719 Bacteria 4778
70 Ga0068861_100180538 3300005719 Bacteria 1757
71 Ga0068861_100866843 3300005719 Bacteria 853
72 Ga0068851_10877460 3300005834 Bacteria 561
73 Ga0068863_100857211 3300005841 Bacteria 907
74 Ga0068858_100129256 3300005842 Bacteria 2367
75 Ga0068860_100009962 3300005843 Bacteria 9418
76 Ga0068860_100596487 3300005843 Bacteria 1110
77 Ga0068862_100070594 3300005844 Bacteria 3015
78 Ga0068862_100094167 3300005844 Bacteria 2612
79 Ga0081455_10008952 3300005937 Bacteria 10344
80 Ga0081455_10042206 3300005937 Bacteria 4004
81 Ga0081455_10136686 3300005937 Bacteria 1909
82 Ga0081540_1035600 3300005983 Bacteria 2667
83 Ga0081539_10000258 3300005985 Bacteria 122213
84 Ga0081539_10015306 3300005985 Bacteria 5585
85 Ga0075365_10039301 3300006038 Bacteria 3080
86 Ga0075365_10341403 3300006038 Bacteria 1055
87 Ga0075368_10112721 3300006042 Bacteria 1122
88 Ga0075363_100647537 3300006048 Bacteria 636
89 Ga0075363_100761696 3300006048 Bacteria 587
90 Ga0075364_10144417 3300006051 Bacteria 1602
91 Ga0075362_10225920 3300006177 Bacteria 916
92 Ga0075367_10120155 3300006178 Bacteria 1619
93 Ga0075367_10124541 3300006178 Bacteria 1590
94 Ga0075367_10160772 3300006178 Bacteria 1396
95 Ga0075367_10268346 3300006178 Bacteria 1072
96 Ga0075369_10059514 3300006186 Bacteria 1664
97 Ga0075369_10343993 3300006186 Bacteria 699
98 Ga0075366_10205963 3300006195 Bacteria 1197
99 Ga0075366_10397800 3300006195 Bacteria 848
100 Ga0075366_10627477 3300006195 Bacteria 666
101 Ga0075370_10116604 3300006353 Bacteria 1552
102 Ga0075370_10126839 3300006353 Bacteria 1488
103 Ga0075428_100206556 3300006844 Bacteria 2123
104 Ga0075431_101794176 3300006847 Bacteria 570
105 Ga0075434_102587691 3300006871 Bacteria 508
106 Ga0068865_100895034 3300006881 Bacteria 771
107 Ga0097620_100060528 3300006931 Bacteria 3815
108 Ga0097620_100185717 3300006931 Bacteria 2163
109 Ga0099795_10130024 3300007788 Bacteria 1015
110 Ga0105251_10345283 3300009011 Bacteria 679
111 Ga0105250_10011219 3300009092 Bacteria 3719
112 Ga0105240_11365465 3300009093 Bacteria 746
113 Ga0111539_10201587 3300009094 Bacteria 2320
114 Ga0111539_12454905 3300009094 Bacteria 605
115 Ga0105245_10506460 3300009098 Bacteria 1224
116 Ga0105247_10635308 3300009101 Bacteria 796
117 Ga0114129_10097158 3300009147 Bacteria 4077
118 Ga0105243_10134427 3300009148 Bacteria 2102
119 Ga0105242_12685201 3300009176 Bacteria 548
120 Ga0105248_10742731 3300009177 Bacteria 1107
121 Ga0105237_10087650 3300009545 Bacteria 3102
122 Ga0105238_10393023 3300009551 Bacteria 1379
123 Ga0105238_11362036 3300009551 Bacteria 736
124 Ga0105249_10034081 3300009553 Bacteria 4612
125 Ga0105249_11024642 3300009553 Bacteria 895
126 Ga0105239_10041258 3300010375 Bacteria 5057
127 Ga0105239_11251242 3300010375 Bacteria 856
128 Ga0105246_10060672 3300011119 Bacteria 2629
129 Ga0105246_12406118 3300011119 Bacteria 517
130 Ga0157378_10769503 3300013297 Bacteria 987
131 Ga0157375_10344637 3300013308 Bacteria 1655
132 Ga0157375_10894778 3300013308 Bacteria 1032
133 Ga0163163_10760261 3300014325 Bacteria 1032
134 Ga0163163_11696790 3300014325 Bacteria 692
135 Ga0157380_10128402 3300014326 Bacteria 2159
136 Ga0157380_10214045 3300014326 Bacteria 1719
137 Ga0157377_10320081 3300014745 Bacteria 1030
138 Ga0157377_10493622 3300014745 Bacteria 854
139 Ga0157379_10600091 3300014968 Bacteria 1028
140 Ga0157379_11395542 3300014968 Bacteria 679
141 Ga0157379_11956110 3300014968 Bacteria 579
142 Ga0163161_10185584 3300017792 Bacteria 1596
143 Ga0163161_10366773 3300017792 Bacteria 1148
144 Ga0209233_1060701 3300025261 Bacteria 731
145 Ga0209455_1011612 3300025272 Bacteria 2157
146 Ga0209758_1004806 3300025297 Bacteria 10912
147 Ga0207642_10141777 3300025899 Bacteria 1268
148 Ga0207710_10064241 3300025900 Bacteria 1671
149 Ga0207688_10065471 3300025901 Bacteria 2054
150 Ga0207680_10214679 3300025903 Bacteria 1317
151 Ga0207680_10414686 3300025903 Bacteria 953
152 Ga0207645_10147751 3300025907 Bacteria 1533
153 Ga0207645_10373108 3300025907 Bacteria 957
154 Ga0207671_10132216 3300025914 Bacteria 1916
155 Ga0207650_10336005 3300025925 Bacteria 1240
156 Ga0207650_10439138 3300025925 Bacteria 1085
157 Ga0207659_10167515 3300025926 Bacteria 1730
158 Ga0207687_10552324 3300025927 Bacteria 966
159 Ga0207644_10300239 3300025931 Bacteria 1294
160 Ga0207690_10994864 3300025932 Bacteria 697
161 Ga0207706_10658357 3300025933 Bacteria 896
162 Ga0207686_10651842 3300025934 Bacteria 833
163 Ga0207709_10104731 3300025935 Bacteria 1878
164 Ga0207670_10100516 3300025936 Bacteria 2065
165 Ga0207670_10831397 3300025936 Bacteria 771
166 Ga0207669_10227813 3300025937 Bacteria 1373
167 Ga0207669_11330339 3300025937 Bacteria 611
168 Ga0207669_11518416 3300025937 Bacteria 571
169 Ga0207704_10185674 3300025938 Bacteria 1507
170 Ga0207704_11158109 3300025938 Bacteria 658
171 Ga0207691_10151167 3300025940 Bacteria 2041
172 Ga0207711_11000272 3300025941 Bacteria 776
173 Ga0207689_10015143 3300025942 Bacteria 6537
174 Ga0207689_10016897 3300025942 Bacteria 6174
175 Ga0207689_10877985 3300025942 Bacteria 757
176 Ga0207667_10507968 3300025949 Bacteria 1222
177 Ga0207651_10853129 3300025960 Bacteria 809
178 Ga0207651_11721775 3300025960 Bacteria 564
179 Ga0207712_10079222 3300025961 Bacteria 2386
180 Ga0207712_10980625 3300025961 Bacteria 749
181 Ga0207668_10014605 3300025972 Bacteria 4861
182 Ga0207668_10017167 3300025972 Bacteria 4530
183 Ga0207668_10150409 3300025972 Bacteria 1801
184 Ga0207668_10408457 3300025972 Bacteria 1150
185 Ga0207668_10834368 3300025972 Bacteria 817
186 Ga0207658_10021317 3300025986 Bacteria 4497
187 Ga0207677_10162040 3300026023 Bacteria 1739
188 Ga0207677_10638350 3300026023 Bacteria 938
189 Ga0207677_10870998 3300026023 Bacteria 810
190 Ga0207703_10203549 3300026035 Bacteria 1760
191 Ga0207703_10555275 3300026035 Bacteria 1083
192 Ga0207703_12352933 3300026035 Bacteria 508
193 Ga0207639_10191519 3300026041 Bacteria 1747
194 Ga0207639_10404731 3300026041 Bacteria 1230
195 Ga0207678_10133759 3300026067 Bacteria 2116
196 Ga0207678_10556937 3300026067 Bacteria 1003
197 Ga0207708_10063199 3300026075 Bacteria 2828
198 Ga0207708_11543811 3300026075 Bacteria 583
199 Ga0207702_11006244 3300026078 Bacteria 827
200 Ga0207641_10121394 3300026088 Bacteria 2333
201 Ga0207676_10634915 3300026095 Bacteria 1029
202 Ga0207674_10379982 3300026116 Bacteria 1366
203 Ga0207675_100022544 3300026118 Bacteria 5864
204 Ga0207675_100155049 3300026118 Bacteria 2182
205 Ga0207675_100262850 3300026118 Bacteria 1673
206 Ga0207683_10064868 3300026121 Bacteria 3219
207 Ga0207683_10475496 3300026121 Bacteria 1153
208 Ga0207683_10814428 3300026121 Bacteria 867
209 Ga0268266_10000544 3300028379 Bacteria 52629
210 Ga0268265_10024218 3300028380 Bacteria 4291
211 Ga0268265_10084607 3300028380 Bacteria 2514
212 Ga0268265_10173929 3300028380 Bacteria 1843
213 Ga0268265_10538491 3300028380 Bacteria 1106
214 Ga0268264_10037322 3300028381 Bacteria 4006
215 Ga0265337_1002332 3300028556 Bacteria 8801
216 Ga0265326_10004448 3300028558 Bacteria 4489
217 Ga0265319_1002877 3300028563 Bacteria 9195
218 Ga0265334_10000311 3300028573 Bacteria 26888
219 Ga0265318_10004701 3300028577 Bacteria 6549
220 Ga0265323_10000051 3300028653 Bacteria 64400
221 Ga0265322_10002426 3300028654 Bacteria 5749
222 Ga0265336_10000026 3300028666 Bacteria 182259
223 Ga0307515_10533358 3300028794 Bacteria 783
224 Ga0307515_10889025 3300028794 Bacteria 521
225 Ga0265338_10000018 3300028800 Bacteria 338910
226 Ga0265324_10000143 3300029957 Bacteria 55192
227 Ga0307512_10296314 3300030522 Bacteria 758
228 Ga0307513_10165233 3300031456 Bacteria 2099
229 Ga0307509_10208169 3300031507 Bacteria 1784
230 Ga0307508_10012934 3300031616 Bacteria 7631
231 Ga0307516_10022534 3300031730 Bacteria 6464
232 Ga0307516_10085188 3300031730 Bacteria 2998
233 Ga0307507_10451442 3300033179 Bacteria 710
234 Ga0307510_10004428 3300033180 Bacteria 16533
235 Ga0307510_10023861 3300033180 Bacteria 7080
236 Ga0373953_0213703 3300035117 Bacteria 835
237 Ga0373927_1149780 3300035695 Bacteria 512
238 Ga0373933_0180381 3300035724 Bacteria 1347
239 Ga0373937_0388680 3300036401 Bacteria 1323
240 Ga0373925_1044087 3300037068 Bacteria 673
241 Ga0395905_0658655 3300037471 Bacteria 949
242 Ga0395901_1876008 3300038443 Bacteria 547
243 Ga0451789_0023864 3300041443 Bacteria 832
244 Ga0451797_0760442 3300041453 Bacteria 754
245 Ga0451807_1671844 3300041486 Bacteria 593
246 Ga0451853_3369087 3300041512 Bacteria 738
247 Ga0495617_203287 3300046452 Bacteria 619
248 Ga0495603_0014166 3300046455 Bacteria 4824
249 Ga0495603_0275045 3300046455 Bacteria 968
250 Ga0495590_0073907 3300046457 Bacteria 1198
251 Ga0495629_0128695 3300046459 Bacteria 1764
252 Ga0495629_0928469 3300046459 Bacteria 569
253 Ga0495638_0138147 3300046460 Bacteria 1425
254 Ga0495638_0239080 3300046460 Bacteria 1006
255 Ga0495651_0016990 3300046462 Bacteria 5637
256 Ga0495650_0236242 3300046471 Bacteria 626
257 Ga0495580_0324517 3300046472 Bacteria 1046
258 Ga0495605_0041315 3300046474 Bacteria 2297
259 Ga0495639_0057383 3300046475 Bacteria 1779
260 Ga0495585_0040289 3300046492 Bacteria 2623
261 Ga0495585_0167897 3300046492 Bacteria 1135
262 Ga0495585_0330740 3300046492 Bacteria 743
263 Ga0495594_0503575 3300046499 Bacteria 688
264 Ga0495596_0047129 3300046500 Bacteria 1691
265 Ga0495607_0326209 3300046501 Bacteria 715
266 Ga0495610_0089787 3300046512 Bacteria 1395
267 Ga0495631_0032924 3300046518 Bacteria 2332
268 Ga0495632_0190783 3300046519 Bacteria 936
269 Ga0495644_0176357 3300046523 Bacteria 821
270 Ga0495642_0153800 3300046528 Bacteria 996
271 Ga0495642_0402975 3300046528 Bacteria 603
272 Ga0495654_0067862 3300046530 Bacteria 1697
273 Ga0495598_0053720 3300046537 Bacteria 1221
274 Ga0495598_0142095 3300046537 Bacteria 831
275 Ga0495609_0105849 3300046538 Bacteria 1216
276 Ga0495609_0174178 3300046538 Bacteria 907
277 Ga0495621_0480262 3300046539 Bacteria 535
278 Ga0495597_0203546 3300046542 Bacteria 792
279 Ga0495622_0208407 3300046557 Bacteria 869
280 Ga0495633_0086493 3300046558 Bacteria 1458
281 Ga0495667_0969494 3300046559 Bacteria 519
282 Ga0495656_0009036 3300046615 Bacteria 3576
283 Ga0495656_0009374 3300046615 Bacteria 3518
284 Ga0495668_0644753 3300046616 Bacteria 585
285 Ga0495625_0191447 3300046660 Bacteria 1355
286 Ga0495635_0612967 3300046663 Bacteria 710
287 Ga0495659_0024303 3300046664 Bacteria 2066
288 Ga0495659_0107660 3300046664 Bacteria 1086
289 Ga0495669_0194840 3300046684 Bacteria 967
290 Ga0495670_0056441 3300046691 Bacteria 1970
291 Ga0495670_0340725 3300046691 Bacteria 806
292 Ga0495671_0466001 3300046692 Bacteria 603
293 Ga0495589_0332314 3300046794 Bacteria 701
294 Ga0495600_0507864 3300046809 Bacteria 740
295 Ga0495660_0161825 3300046810 Bacteria 1097
296 Ga0495636_0062502 3300047318 Bacteria 1576
297 Ga0495636_0370207 3300047318 Bacteria 679
298 Ga0495672_0011884 3300047320 Bacteria 6110
299 Ga0495676_0025523 3300047321 Bacteria 5101
300 Ga0495680_0342761 3300047322 Bacteria 1042
301 Ga0495683_0037129 3300047323 Bacteria 2471
302 Ga0495675_0310210 3300047444 Bacteria 935
303 Ga0495685_046900 3300047447 Bacteria 1470
304 Ga0495673_0263060 3300047469 Bacteria 627
305 Ga0495673_0354875 3300047469 Bacteria 517
306 Ga0495615_0057343 3300048090 Bacteria 1019
307 Ga0495626_0125718 3300048091 Bacteria 1099
308 Ga0496100_1095025 3300048903 Bacteria 628
309 Ga0496102_0268556 3300048905 Bacteria 1608
310 Ga0496103_0169237 3300048906 Bacteria 1402
311 Ga0496104_0425502 3300048907 Bacteria 1240
312 Ga0496106_0951980 3300048909 Bacteria 677
313 Ga0496108_0076893 3300048911 Bacteria 2822
314 Ga0496110_0153279 3300048913 Bacteria 2087
315 Ga0496111_0249394 3300048914 Bacteria 1318
316 Ga0496111_1218885 3300048914 Bacteria 533
317 Ga0496114_0464297 3300048917 Bacteria 1121
318 Ga0496114_1166944 3300048917 Bacteria 656
319 Ga0496115_1177107 3300048918 Bacteria 577
320 Ga0496117_0140322 3300048920 Bacteria 1449
321 Ga0496118_0242979 3300048921 Bacteria 1029
322 Ga0496119_0045221 3300048922 Bacteria 2763
323 Ga0496121_0015817 3300048924 Bacteria 7853
324 Ga0496121_0160067 3300048924 Bacteria 1647
325 Ga0496121_0175994 3300048924 Bacteria 1549
326 Ga0496121_0647671 3300048924 Bacteria 644
327 Ga0496124_0071711 3300048927 Bacteria 2870
328 Ga0496124_0145349 3300048927 Bacteria 1867
329 Ga0496124_0193291 3300048927 Bacteria 1555
330 Ga0496125_0056895 3300048928 Bacteria 3172
331 Ga0496126_0002447 3300048929 Bacteria 25067
332 Ga0496126_0139919 3300048929 Bacteria 2084
333 Ga0496126_0369753 3300048929 Bacteria 1169
334 Ga0496126_0428392 3300048929 Bacteria 1068
335 Ga0496126_0900313 3300048929 Bacteria 671
336 Ga0495678_031146 3300049459 Bacteria 2227
337 Ga0495682_0186263 3300049460 Bacteria 737
338 Ga0501032_0633427 3300049569 Bacteria 679
339 Ga0501033_0089625 3300049570 Bacteria 2250
340 Ga0501034_0312796 3300049571 Bacteria 1505
341 Ga0501041_0504301 3300049577 Bacteria 770
342 Ga0501043_0049613 3300049579 Bacteria 3300
343 Ga0501047_0630090 3300049581 Bacteria 893
344 Ga0501048_1077641 3300049582 Bacteria 578
345 Ga0501067_0152211 3300049583 Bacteria 1289
346 Ga0501067_0212311 3300049583 Bacteria 1078
347 Ga0501069_0822960 3300049585 Bacteria 563
348 nmdc:mga03683_10673_c1 3300050489 Bacteria 3300
349 nmdc:mga03683_189683_c1 3300050489 Bacteria 940
350 nmdc:mga03683_469793_c1 3300050489 Bacteria 607
351 nmdc:mga03n38_62700_c1 3300050490 Bacteria 1697
352 nmdc:mga0yw44_228894_c1 3300050492 Bacteria 1234
353 nmdc:mga0k408_644572_c1 3300050493 Bacteria 623
354 nmdc:mga0k408_704100_c1 3300050493 Bacteria 592
355 nmdc:mga06z11_226209_c1 3300050494 Unclassified 1095
356 nmdc:mga06z11_453351_c1 3300050494 Bacteria 775
357 nmdc:mga06z11_480896_c1 3300050494 Bacteria 752
358 nmdc:mga06z11_587403_c1 3300050494 Bacteria 677
359 nmdc:mga06z11_60546_c1 3300050494 Bacteria 1971
360 nmdc:mga07m45_283198_c1 3300050496 Bacteria 964
361 nmdc:mga07m45_3901_c1 3300050496 Bacteria 7244
362 nmdc:mga07m45_436579_c1 3300050496 Bacteria 759
363 nmdc:mga05p37_116256_c1 3300050507 Bacteria 3287
364 nmdc:mga08y16_401152_c1 3300050511 Bacteria 1403
365 nmdc:mga0sz30_221605_c1 3300050516 Bacteria 841
366 nmdc:mga0sz30_373276_c1 3300050516 Bacteria 638
367 nmdc:mga0sz30_502556_c1 3300050516 Bacteria 545
368 nmdc:mga0sz30_85913_c1 3300050516 Bacteria 1365
369 Ga0500610_0305808 3300053079 Bacteria 698
370 Ga0495655_0245402 3300053083 Bacteria 601
371 Ga0495619_0071251 3300053085 Bacteria 2326
372 Ga0500578_0537530 3300053086 Bacteria 652
373 Ga0500644_0390352 3300053088 Bacteria 606
374 Ga0500581_185137 3300053089 Bacteria 941
375 Ga0500646_0072040 3300053090 Bacteria 1038
376 Ga0500651_0101277 3300053093 Bacteria 1765
377 Ga0500650_0242224 3300053098 Bacteria 811
378 Ga0500650_0361770 3300053098 Bacteria 633
379 Ga0500562_072829 3300053108 Bacteria 927
380 Ga0500592_060238 3300053116 Bacteria 621
381 Ga0500594_0203229 3300053118 Bacteria 651
382 Ga0500595_010510 3300053119 Bacteria 3675
383 Ga0500595_024116 3300053119 Bacteria 2127
384 Ga0500642_0071978 3300053130 Bacteria 1575
385 Ga0500655_016453 3300053133 Bacteria 1362
386 Ga0500658_0042074 3300053134 Bacteria 1835
387 Ga0500658_0088044 3300053134 Bacteria 1338
388 Ga0500568_0059654 3300053139 Bacteria 1480
389 Ga0500577_0158807 3300053142 Bacteria 962
390 Ga0500589_203480 3300053147 Bacteria 758
391 Ga0500590_013608 3300053148 Bacteria 4180
392 Ga0500604_0055844 3300053151 Bacteria 1229
393 Ga0500622_0153569 3300053156 Bacteria 1086
394 Ga0500622_0409079 3300053156 Bacteria 549
395 Ga0500634_0256057 3300053161 Bacteria 723
396 Ga0500638_190608 3300053162 Bacteria 876
397 Ga0500638_356679 3300053162 Bacteria 540
398 Ga0500636_0444153 3300053177 Bacteria 588
399 Ga0500611_006561 3300053727 Bacteria 1702
400 Ga0500645_148974 3300053730 Bacteria 644
401 Ga0500609_008592 3300053731 Bacteria 1378
402 Ga0501084_0779976 3300054114 Bacteria 805
403 Ga0501082_0000506 3300060353 Bacteria 34564
404 Ga0501082_0484892 3300060353 Bacteria 1081
405 2513693545 2513237101 Bacteria 7952346
406 2723848437 2721755755 Bacteria 8322773
407 2793080993
408 2874609220 2874604998 Bacteria 7834745
409 2889037106 2889033259 Bacteria 9099371
410 2922363625 2922361189 Bacteria 7436256
411 2922396058 2922393267 Bacteria 8285685
412 Ga0501039_0156101
413 CNAas_1015841
414 JGI24750J21931_1025427
415 JGI25406J46586_10000755
416 JGI25153J46596_10018070
417 rootH2_10023134
418 rootL2_10018361
419 Ga0065704_10171751
420 Ga0070676_10071235
421 Ga0070676_11328515
422 Ga0070690_100334404
423 Ga0070670_100812339
424 Ga0068869_100142935
425 Ga0068869_100338103
426 Ga0068869_100370545
427 Ga0070666_11040836
428 Ga0068868_100228727
429 Ga0068868_101120769
430 Ga0070689_100599781
431 Ga0070691_10553029
432 Ga0070692_10895535
433 Ga0070668_100038744
434 Ga0070668_100251396
435 Ga0070669_100261240
436 Ga0070671_100103850
437 Ga0070674_100270829
438 Ga0070674_100325273
439 Ga0070673_100685448
440 Ga0070673_101437065
441 Ga0070673_101557757
442 Ga0070688_100403035
443 Ga0070688_100724519
444 Ga0070667_100030847
445 Ga0070667_100157031
446 Ga0070667_101568384
447 Ga0070701_10045898
448 Ga0070700_100182939
449 Ga0070700_101805932
450 Ga0070694_100297868
451 Ga0070663_102078005
452 Ga0070678_100099661
453 Ga0070678_100236067
454 Ga0070678_100896009
455 Ga0068867_100868092
456 Ga0070685_10650538
457 Ga0070698_100264639
458 Ga0070698_100888453
459 Ga0070699_101696139
460 Ga0070697_101509694
461 Ga0068853_100391817
462 Ga0070672_100231970
463 Ga0070672_100291525
464 Ga0070672_100558251
465 Ga0070686_101013166
466 Ga0070695_100387752
467 Ga0070696_100046364
468 Ga0070665_100015331
469 Ga0070704_100304273
470 Ga0068855_101837825
471 Ga0070664_101782799
472 Ga0068857_100943047
473 Ga0068856_100531725
474 Ga0068859_100060529
475 Ga0068859_100185710
476 Ga0068864_100446935
477 Ga0068864_100727783
478 Ga0068866_10288341
479 Ga0068866_10383817
480 Ga0068861_100020091
481 Ga0068861_100180538
482 Ga0068861_100866843
483 Ga0068851_10877460
484 Ga0068863_100857211
485 Ga0068858_100129256
486 Ga0068860_100009962
487 Ga0068860_100596487
488 Ga0068862_100070594
489 Ga0068862_100094167
490 Ga0081455_10008952
491 Ga0081455_10042206
492 Ga0081455_10136686
493 Ga0081540_1035600
494 Ga0081539_10000258
495 Ga0081539_10015306
496 Ga0075365_10039301
497 Ga0075365_10341403
498 Ga0075368_10112721
499 Ga0075363_100647537
500 Ga0075363_100761696
501 Ga0075364_10144417
502 Ga0075362_10225920
503 Ga0075367_10120155
504 Ga0075367_10124541
505 Ga0075367_10160772
506 Ga0075367_10268346
507 Ga0075369_10059514
508 Ga0075369_10343993
509 Ga0075366_10205963
510 Ga0075366_10397800
511 Ga0075366_10627477
512 Ga0075370_10116604
513 Ga0075370_10126839
514 Ga0075428_100206556
515 Ga0075431_101794176
516 Ga0075434_102587691
517 Ga0068865_100895034
518 Ga0097620_100060528
519 Ga0097620_100185717
520 Ga0099795_10130024
521 Ga0105251_10345283
522 Ga0105250_10011219
523 Ga0105240_11365465
524 Ga0111539_10201587
525 Ga0111539_12454905
526 Ga0105245_10506460
527 Ga0105247_10635308
528 Ga0114129_10097158
529 Ga0105243_10134427
530 Ga0105242_12685201
531 Ga0105248_10742731
532 Ga0105237_10087650
533 Ga0105238_10393023
534 Ga0105238_11362036
535 Ga0105249_10034081
536 Ga0105249_11024642
537 Ga0105239_10041258
538 Ga0105239_11251242
539 Ga0105246_10060672
540 Ga0105246_12406118
541 Ga0157378_10769503
542 Ga0157375_10344637
543 Ga0157375_10894778
544 Ga0163163_10760261
545 Ga0163163_11696790
546 Ga0157380_10128402
547 Ga0157380_10214045
548 Ga0157377_10320081
549 Ga0157377_10493622
550 Ga0157379_10600091
551 Ga0157379_11395542
552 Ga0157379_11956110
553 Ga0163161_10185584
554 Ga0163161_10366773
555 Ga0209233_1060701
556 Ga0209455_1011612
557 Ga0209758_1004806
558 Ga0207642_10141777
559 Ga0207710_10064241
560 Ga0207688_10065471
561 Ga0207680_10214679
562 Ga0207680_10414686
563 Ga0207645_10147751
564 Ga0207645_10373108
565 Ga0207671_10132216
566 Ga0207650_10336005
567 Ga0207650_10439138
568 Ga0207659_10167515
569 Ga0207687_10552324
570 Ga0207644_10300239
571 Ga0207690_10994864
572 Ga0207706_10658357
573 Ga0207686_10651842
574 Ga0207709_10104731
575 Ga0207670_10100516
576 Ga0207670_10831397
577 Ga0207669_10227813
578 Ga0207669_11330339
579 Ga0207669_11518416
580 Ga0207704_10185674
581 Ga0207704_11158109
582 Ga0207691_10151167
583 Ga0207711_11000272
584 Ga0207689_10015143
585 Ga0207689_10016897
586 Ga0207689_10877985
587 Ga0207667_10507968
588 Ga0207651_10853129
589 Ga0207651_11721775
590 Ga0207712_10079222
591 Ga0207712_10980625
592 Ga0207668_10014605
593 Ga0207668_10017167
594 Ga0207668_10150409
595 Ga0207668_10408457
596 Ga0207668_10834368
597 Ga0207658_10021317
598 Ga0207677_10162040
599 Ga0207677_10638350
600 Ga0207677_10870998
601 Ga0207703_10203549
602 Ga0207703_10555275
603 Ga0207703_12352933
604 Ga0207639_10191519
605 Ga0207639_10404731
606 Ga0207678_10133759
607 Ga0207678_10556937
608 Ga0207708_10063199
609 Ga0207708_11543811
610 Ga0207702_11006244
611 Ga0207641_10121394
612 Ga0207676_10634915
613 Ga0207674_10379982
614 Ga0207675_100022544
615 Ga0207675_100155049
616 Ga0207675_100262850
617 Ga0207683_10064868
618 Ga0207683_10475496
619 Ga0207683_10814428
620 Ga0268266_10000544
621 Ga0268265_10024218
622 Ga0268265_10084607
623 Ga0268265_10173929
624 Ga0268265_10538491
625 Ga0268264_10037322
626 Ga0265337_1002332
627 Ga0265326_10004448
628 Ga0265319_1002877
629 Ga0265334_10000311
630 Ga0265318_10004701
631 Ga0265323_10000051
632 Ga0265322_10002426
633 Ga0265336_10000026
634 Ga0307515_10533358
635 Ga0307515_10889025
636 Ga0265338_10000018
637 Ga0265324_10000143
638 Ga0307512_10296314
639 Ga0307513_10165233
640 Ga0307509_10208169
641 Ga0307508_10012934
642 Ga0307516_10022534
643 Ga0307516_10085188
644 Ga0307507_10451442
645 Ga0307510_10004428
646 Ga0307510_10023861
647 Ga0373953_0213703
648 Ga0373927_1149780
649 Ga0373933_0180381
650 Ga0373937_0388680
651 Ga0373925_1044087
652 Ga0395905_0658655
653 Ga0395901_1876008
654 Ga0451789_0023864
655 Ga0451797_0760442
656 Ga0451807_1671844
657 Ga0451853_3369087
658 Ga0495617_203287
659 Ga0495603_0014166
660 Ga0495603_0275045
661 Ga0495590_0073907
662 Ga0495629_0128695
663 Ga0495629_0928469
664 Ga0495638_0138147
665 Ga0495638_0239080
666 Ga0495651_0016990
667 Ga0495650_0236242
668 Ga0495580_0324517
669 Ga0495605_0041315
670 Ga0495639_0057383
671 Ga0495585_0040289
672 Ga0495585_0167897
673 Ga0495585_0330740
674 Ga0495594_0503575
675 Ga0495596_0047129
676 Ga0495607_0326209
677 Ga0495610_0089787
678 Ga0495631_0032924
679 Ga0495632_0190783
680 Ga0495644_0176357
681 Ga0495642_0153800
682 Ga0495642_0402975
683 Ga0495654_0067862
684 Ga0495598_0053720
685 Ga0495598_0142095
686 Ga0495609_0105849
687 Ga0495609_0174178
688 Ga0495621_0480262
689 Ga0495597_0203546
690 Ga0495622_0208407
691 Ga0495633_0086493
692 Ga0495667_0969494
693 Ga0495656_0009036
694 Ga0495656_0009374
695 Ga0495668_0644753
696 Ga0495625_0191447
697 Ga0495635_0612967
698 Ga0495659_0024303
699 Ga0495659_0107660
700 Ga0495669_0194840
701 Ga0495670_0056441
702 Ga0495670_0340725
703 Ga0495671_0466001
704 Ga0495589_0332314
705 Ga0495600_0507864
706 Ga0495660_0161825
707 Ga0495636_0062502
708 Ga0495636_0370207
709 Ga0495672_0011884
710 Ga0495676_0025523
711 Ga0495680_0342761
712 Ga0495683_0037129
713 Ga0495675_0310210
714 Ga0495685_046900
715 Ga0495673_0263060
716 Ga0495673_0354875
717 Ga0495615_0057343
718 Ga0495626_0125718
719 Ga0496100_1095025
720 Ga0496102_0268556
721 Ga0496103_0169237
722 Ga0496104_0425502
723 Ga0496106_0951980
724 Ga0496108_0076893
725 Ga0496110_0153279
726 Ga0496111_0249394
727 Ga0496111_1218885
728 Ga0496114_0464297
729 Ga0496114_1166944
730 Ga0496115_1177107
731 Ga0496117_0140322
732 Ga0496118_0242979
733 Ga0496119_0045221
734 Ga0496121_0015817
735 Ga0496121_0160067
736 Ga0496121_0175994
737 Ga0496121_0647671
738 Ga0496124_0071711
739 Ga0496124_0145349
740 Ga0496124_0193291
741 Ga0496125_0056895
742 Ga0496126_0002447
743 Ga0496126_0139919
744 Ga0496126_0369753
745 Ga0496126_0428392
746 Ga0496126_0900313
747 Ga0495678_031146
748 Ga0495682_0186263
749 Ga0501032_0633427
750 Ga0501033_0089625
751 Ga0501034_0312796
752 Ga0501041_0504301
753 Ga0501043_0049613
754 Ga0501047_0630090
755 Ga0501048_1077641
756 Ga0501067_0152211
757 Ga0501067_0212311
758 Ga0501069_0822960
759 nmdc:mga03683_10673_c1
760 nmdc:mga03683_189683_c1
761 nmdc:mga03683_469793_c1
762 nmdc:mga03n38_62700_c1
763 nmdc:mga0yw44_228894_c1
764 nmdc:mga0k408_644572_c1
765 nmdc:mga0k408_704100_c1
766 nmdc:mga06z11_226209_c1
767 nmdc:mga06z11_453351_c1
768 nmdc:mga06z11_480896_c1
769 nmdc:mga06z11_587403_c1
770 nmdc:mga06z11_60546_c1
771 nmdc:mga07m45_283198_c1
772 nmdc:mga07m45_3901_c1
773 nmdc:mga07m45_436579_c1
774 nmdc:mga05p37_116256_c1
775 nmdc:mga08y16_401152_c1
776 nmdc:mga0sz30_221605_c1
777 nmdc:mga0sz30_373276_c1
778 nmdc:mga0sz30_502556_c1
779 nmdc:mga0sz30_85913_c1
780 Ga0500610_0305808
781 Ga0495655_0245402
782 Ga0495619_0071251
783 Ga0500578_0537530
784 Ga0500644_0390352
785 Ga0500581_185137
786 Ga0500646_0072040
787 Ga0500651_0101277
788 Ga0500650_0242224
789 Ga0500650_0361770
790 Ga0500562_072829
791 Ga0500592_060238
792 Ga0500594_0203229
793 Ga0500595_010510
794 Ga0500595_024116
795 Ga0500642_0071978
796 Ga0500655_016453
797 Ga0500658_0042074
798 Ga0500658_0088044
799 Ga0500568_0059654
800 Ga0500577_0158807
801 Ga0500589_203480
802 Ga0500590_013608
803 Ga0500604_0055844
804 Ga0500622_0153569
805 Ga0500622_0409079
806 Ga0500634_0256057
807 Ga0500638_190608
808 Ga0500638_356679
809 Ga0500636_0444153
810 Ga0500611_006561
811 Ga0500645_148974
812 Ga0500609_008592
813 Ga0501084_0779976
814 Ga0501082_0000506
815 Ga0501082_0484892
816 2513693545
817 2723848437
818 2793080993
819 2874609220
820 2889037106
821 2922363625
822 2922396058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11604

CusF_Ec

Copper binding periplasmic protein CusF

47

115

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qcp-assembly1.cif.gz_X 1.0 a structure of cusf-ag(i) residues 10-88 from escherichia coli 0.8332 28 100
2vb3-assembly1.cif.gz_X crystal structure of ag(i)cusf 0.8297 28 99
3e6z-assembly1.cif.gz_X 1.0 a structure of cusf-w44a-cu(ii) residues 10-88 from escherichia coli 0.8073 28 100
2l55-assembly1.cif.gz_A solution structure of the c-terminal domain of silb from cupriavidus metallidurans 0.8035 27 98
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.7923 27 82
ID Description Score Start End Superfamily
af_A0A168H3E7_36_252_2.70.170.10 Mainly Beta;Distorted Sandwich;Acetylcholine Binding Protein; Chain: A,;Neurotransmitter-gated ion-channel ligand-binding domain 0.8462 31 47 2.70.170.10
2vb2X01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Copper binding periplasmic protein CusF 0.8144 28 100 2.40.50.320
2l55A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Copper binding periplasmic protein CusF 0.8035 27 98 2.40.50.320
2vb2X01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Copper binding periplasmic protein CusF 0.7748 28 100 2.40.50.320
af_G5EG68_31_129_2.40.50.120 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7447 28 95 2.40.50.120
ID Description Score Start End GO Terms
AF-A0A127PF03-F1-model_v4 Copper binding periplasmic CusF family protein 0.9724 29 100
AF-A0A0Q7APJ1-F1-model_v4 Metal transporter 0.9673 27 100
AF-A0A1M7I6Z0-F1-model_v4 Uncharacterized copper-binding protein, cupredoxin-like subfamily 0.9652 25 100 GO:0005507
GO:0009055
GO:0042597
AF-A0A0K8NWE2-F1-model_v4 Cobalt-zinc-cadmium resistance protein CzcA 0.9628 28 100
AF-A0A254TGQ5-F1-model_v4 RND transporter 0.9589 29 100

Map