F437553

General Info

Members Datasets Scaffolds Average Seq Length
411 275 822 178

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10028982|Ga0265760_100289822
Length 188
Sequence MNDRAKIDAYGALSEPATLTIQRMLPGPIERVWAYLTESDLRRKWLASGDMEMKVGAPFEFVWRNSELTDPPGKRPEGFGEEHRMESRIIELDPPRKLVFTWGKDDSDVSMVLEPRGEKVLLTVVHRRLPTRGMMVGVSTGWHAHLDMLAARLNGEKSEPFWDRFSRLRAEYDRRIPADSEPPSTNGI

Samples

Sample ID Description Type Environment
1 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
122 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
123 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
124 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
125 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
148 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
149 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
150 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
153 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
154 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
155 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
156 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
195 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
233 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
234 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
235 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
236 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
237 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
238 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
239 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
240 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
241 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
242 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
243 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
244 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
245 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
246 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
247 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
248 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
249 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
250 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
251 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
252 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
253 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
256 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
257 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
258 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
259 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
262 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
263 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
264 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
265 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
266 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 2643221582 Rhizobium sp. Root651 Isolate Unclassified
268 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
269 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
270 2932406140 Serratia sp. 2723 Isolate Rhizosphere
271 2939577877 Serratia sp. 509 Isolate Rhizosphere
272 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
273 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
274 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
275 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.84
Metatranscriptomes 0.97
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.87
Nodule 0.49
Rhizoplane 5.11
Rhizosphere 62.53
Stem 0
Stem Tuber 0
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265760_10028982 3300031090 Bacteria 1626
2 JGI24739J22299_10004373 3300001989 Bacteria 5413
3 JGI24739J22299_10023428 3300001989 Unclassified 2183
4 JGI24739J22299_10060707 3300001989 Bacteria 1196
5 JGI24737J22298_10016874 3300001990 Bacteria 2356
6 JGI24735J21928_10016384 3300002067 Bacteria 2300
7 JGI25153J46596_10000067 3300003215 Bacteria 118869
8 JGI25153J46596_10019227 3300003215 Bacteria 2623
9 rootL2_10060806 3300003322 Bacteria 1925
10 rootL2_10285813 3300003322 Bacteria 1925
11 JGI25404J52841_10004205 3300003659 Bacteria 2897
12 JGI25405J52794_10012510 3300003911 Bacteria 1635
13 Ga0070658_10002345 3300005327 Bacteria 15884
14 Ga0070676_10115585 3300005328 Bacteria 1677
15 Ga0070670_100849842 3300005331 Bacteria 826
16 Ga0068868_100036714 3300005338 Bacteria 3795
17 Ga0070660_100028988 3300005339 Bacteria 4145
18 Ga0070660_100186349 3300005339 Unclassified 1680
19 Ga0070660_100288008 3300005339 Bacteria 1345
20 Ga0070661_100871987 3300005344 Bacteria 742
21 Ga0070668_100018694 3300005347 Bacteria 5203
22 Ga0070671_100003663 3300005355 Bacteria 12038
23 Ga0070671_100165566 3300005355 Bacteria 1869
24 Ga0070659_100416382 3300005366 Bacteria 1136
25 Ga0070667_100893529 3300005367 Bacteria 827
26 Ga0070705_100218732 3300005440 Bacteria 1318
27 Ga0070694_100369590 3300005444 Bacteria 1116
28 Ga0070663_100101331 3300005455 Bacteria 2149
29 Ga0070663_100916599 3300005455 Bacteria 758
30 Ga0070663_101007323 3300005455 Bacteria 724
31 Ga0070678_100168071 3300005456 Bacteria 1783
32 Ga0070678_101035723 3300005456 Bacteria 756
33 Ga0070662_100028897 3300005457 Bacteria 3864
34 Ga0070662_100207060 3300005457 Bacteria 1559
35 Ga0070706_101726667 3300005467 Bacteria 570
36 Ga0068853_100144827 3300005539 Bacteria 2135
37 Ga0068853_100401605 3300005539 Bacteria 1283
38 Ga0070686_100401433 3300005544 Bacteria 1043
39 Ga0070696_100338754 3300005546 Bacteria 1162
40 Ga0070693_100057823 3300005547 Bacteria 2243
41 Ga0070665_100024005 3300005548 Bacteria 6140
42 Ga0070665_100156412 3300005548 Bacteria 2281
43 Ga0070665_101337009 3300005548 Bacteria 726
44 Ga0068855_100010086 3300005563 Bacteria 11386
45 Ga0068855_100046398 3300005563 Bacteria 5137
46 Ga0070664_100184458 3300005564 Bacteria 1856
47 Ga0068857_100022544 3300005577 Bacteria 5540
48 Ga0068854_100567449 3300005578 Bacteria 965
49 Ga0068856_100013112 3300005614 Bacteria 8029
50 Ga0068856_100029657 3300005614 Bacteria 5344
51 Ga0068856_100754074 3300005614 Bacteria 993
52 Ga0068859_100527507 3300005617 Bacteria 1276
53 Ga0068870_10327256 3300005840 Bacteria 976
54 Ga0068858_100103465 3300005842 Bacteria 2656
55 Ga0068860_100343193 3300005843 Bacteria 1469
56 Ga0068862_100028532 3300005844 Bacteria 4700
57 Ga0068862_100474252 3300005844 Bacteria 1183
58 Ga0081455_10001642 3300005937 Bacteria 27218
59 Ga0081455_10487943 3300005937 Bacteria 831
60 Ga0081455_10581431 3300005937 Bacteria 734
61 Ga0081538_10134382 3300005981 Bacteria 1155
62 Ga0081540_1000430 3300005983 Bacteria 41337
63 Ga0081540_1001476 3300005983 Bacteria 20290
64 Ga0081540_1105682 3300005983 Bacteria 1202
65 Ga0081539_10032300 3300005985 Bacteria 3208
66 Ga0070717_10101799 3300006028 Bacteria 2440
67 Ga0075365_10108764 3300006038 Bacteria 1904
68 Ga0075365_10212668 3300006038 Bacteria 1356
69 Ga0075365_10236690 3300006038 Bacteria 1282
70 Ga0075365_10361396 3300006038 Bacteria 1023
71 Ga0075363_100097527 3300006048 Bacteria 1624
72 Ga0075363_100134137 3300006048 Bacteria 1390
73 Ga0075364_10010761 3300006051 Bacteria 5534
74 Ga0075364_10097780 3300006051 Bacteria 1952
75 Ga0075364_10563558 3300006051 Bacteria 779
76 Ga0070712_100702724 3300006175 Bacteria 862
77 Ga0075362_10062944 3300006177 Bacteria 1682
78 Ga0075362_10097759 3300006177 Bacteria 1369
79 Ga0075367_10211871 3300006178 Unclassified 1212
80 Ga0075369_10000052 3300006186 Bacteria 29737
81 Ga0075369_10004585 3300006186 Bacteria 5124
82 Ga0075427_10029673 3300006194 Bacteria 895
83 Ga0075366_10156470 3300006195 Bacteria 1380
84 Ga0097621_100199661 3300006237 Bacteria 1736
85 Ga0075370_10025011 3300006353 Bacteria 3300
86 Ga0068871_100266058 3300006358 Bacteria 1497
87 Ga0075431_101421897 3300006847 Bacteria 653
88 Ga0075434_100112037 3300006871 Bacteria 2740
89 Ga0097620_100527499 3300006931 Bacteria 1276
90 Ga0105240_10008997 3300009093 Bacteria 14190
91 Ga0105240_10211086 3300009093 Bacteria 2269
92 Ga0105240_10443800 3300009093 Bacteria 1453
93 Ga0105240_10895217 3300009093 Bacteria 955
94 Ga0111539_10476304 3300009094 Bacteria 1454
95 Ga0105245_10088425 3300009098 Bacteria 2846
96 Ga0114129_10035967 3300009147 Bacteria 6993
97 Ga0105241_10455067 3300009174 Bacteria 1133
98 Ga0105242_10129927 3300009176 Bacteria 2173
99 Ga0105242_10480590 3300009176 Bacteria 1177
100 Ga0105248_10001438 3300009177 Bacteria 26535
101 Ga0105248_10025755 3300009177 Bacteria 6543
102 Ga0105248_10916449 3300009177 Bacteria 990
103 Ga0105237_10127067 3300009545 Bacteria 2543
104 Ga0105237_10198020 3300009545 Bacteria 2008
105 Ga0105237_10372364 3300009545 Bacteria 1433
106 Ga0105238_10048100 3300009551 Bacteria 4299
107 Ga0105238_10234774 3300009551 Bacteria 1811
108 Ga0105238_10376440 3300009551 Bacteria 1411
109 Ga0105239_10024398 3300010375 Bacteria 6663
110 Ga0105239_10039135 3300010375 Bacteria 5195
111 Ga0105239_10162341 3300010375 Bacteria 2497
112 Ga0105246_10008855 3300011119 Bacteria 6193
113 Ga0105246_10154435 3300011119 Bacteria 1741
114 Ga0157373_10072365 3300013100 Bacteria 2433
115 Ga0157373_10117433 3300013100 Bacteria 1870
116 Ga0157371_10391117 3300013102 Bacteria 1016
117 Ga0157371_10631212 3300013102 Unclassified 798
118 Ga0157370_10075725 3300013104 Bacteria 3171
119 Ga0157369_10096251 3300013105 Bacteria 3159
120 Ga0157374_10239706 3300013296 Bacteria 1783
121 Ga0163162_11347121 3300013306 Bacteria 811
122 Ga0157375_11273580 3300013308 Bacteria 864
123 Ga0163163_10095344 3300014325 Bacteria 2995
124 Ga0163163_10131604 3300014325 Bacteria 2542
125 Ga0182008_10052893 3300014497 Bacteria 2012
126 Ga0157377_10216690 3300014745 Bacteria 1223
127 Ga0157376_10009148 3300014969 Bacteria 7183
128 Ga0213876_10025907 3300021384 Bacteria 3093
129 Ga0224712_10156215 3300022467 Bacteria 1014
130 Ga0228598_1022196 3300024227 Bacteria 1249
131 Ga0209758_1000284 3300025297 Bacteria 100315
132 Ga0209758_1019098 3300025297 Bacteria 3326
133 Ga0209758_1029808 3300025297 Bacteria 2272
134 Ga0209758_1033187 3300025297 Bacteria 2079
135 Ga0209758_1092576 3300025297 Bacteria 881
136 Ga0207680_10239398 3300025903 Bacteria 1250
137 Ga0207647_10001242 3300025904 Bacteria 19628
138 Ga0207647_10007619 3300025904 Bacteria 7800
139 Ga0207643_10078127 3300025908 Bacteria 1914
140 Ga0207705_10000347 3300025909 Bacteria 41820
141 Ga0207705_10206758 3300025909 Bacteria 1488
142 Ga0207707_10949011 3300025912 Bacteria 708
143 Ga0207695_10052692 3300025913 Bacteria 4260
144 Ga0207695_10070276 3300025913 Bacteria 3580
145 Ga0207695_10337942 3300025913 Bacteria 1394
146 Ga0207671_10139641 3300025914 Bacteria 1866
147 Ga0207671_10176191 3300025914 Bacteria 1662
148 Ga0207671_10211105 3300025914 Bacteria 1519
149 Ga0207693_10423906 3300025915 Bacteria 1040
150 Ga0207662_10091401 3300025918 Bacteria 1873
151 Ga0207657_10009837 3300025919 Bacteria 9577
152 Ga0207657_10034945 3300025919 Bacteria 4512
153 Ga0207657_10068603 3300025919 Bacteria 3012
154 Ga0207657_10167110 3300025919 Bacteria 1784
155 Ga0207694_10050523 3300025924 Bacteria 3221
156 Ga0207694_10242788 3300025924 Bacteria 1472
157 Ga0207659_10385499 3300025926 Bacteria 1169
158 Ga0207644_10026156 3300025931 Bacteria 4019
159 Ga0207644_10077871 3300025931 Bacteria 2443
160 Ga0207690_10084534 3300025932 Bacteria 2225
161 Ga0207706_10024253 3300025933 Bacteria 5437
162 Ga0207706_10027406 3300025933 Bacteria 5094
163 Ga0207706_10196927 3300025933 Bacteria 1767
164 Ga0207706_10934609 3300025933 Unclassified 731
165 Ga0207686_10221641 3300025934 Bacteria 1366
166 Ga0207711_10655056 3300025941 Bacteria 980
167 Ga0207689_10104808 3300025942 Bacteria 2324
168 Ga0207679_10154354 3300025945 Bacteria 1873
169 Ga0207667_10289216 3300025949 Bacteria 1674
170 Ga0207667_10319672 3300025949 Bacteria 1585
171 Ga0207668_10012300 3300025972 Bacteria 5233
172 Ga0207658_11139378 3300025986 Bacteria 713
173 Ga0207677_10152221 3300026023 Bacteria 1786
174 Ga0207703_10974392 3300026035 Bacteria 813
175 Ga0207639_10033598 3300026041 Bacteria 3785
176 Ga0207678_10080608 3300026067 Bacteria 2786
177 Ga0207678_10142173 3300026067 Bacteria 2048
178 Ga0207678_10977441 3300026067 Bacteria 749
179 Ga0207702_11238713 3300026078 Bacteria 740
180 Ga0207674_10001872 3300026116 Bacteria 26801
181 Ga0207674_10105823 3300026116 Bacteria 2791
182 Ga0207674_10799090 3300026116 Bacteria 910
183 Ga0207675_100234510 3300026118 Bacteria 1771
184 Ga0207683_10250207 3300026121 Bacteria 1617
185 Ga0207683_10808570 3300026121 Bacteria 870
186 Ga0207698_11738933 3300026142 Bacteria 639
187 Ga0209970_1000085 3300027614 Bacteria 13000
188 Ga0268266_10000189 3300028379 Bacteria 109217
189 Ga0268266_10191732 3300028379 Bacteria 1866
190 Ga0268266_11188068 3300028379 Bacteria 738
191 Ga0268265_10006430 3300028380 Bacteria 7964
192 Ga0268265_10278946 3300028380 Bacteria 1494
193 Ga0307517_10000249 3300028786 Bacteria 91911
194 Ga0307511_10274805 3300030521 Bacteria 785
195 Ga0307512_10071190 3300030522 Bacteria 2583
196 Ga0316176_1219576 3300030732 Bacteria 965
197 Ga0314311_1184013 3300030733 Bacteria 1747
198 Ga0265771_1016320 3300031010 Bacteria 605
199 Ga0307513_10349817 3300031456 Bacteria 1226
200 Ga0307509_10252654 3300031507 Bacteria 1545
201 Ga0307408_100295451 3300031548 Bacteria 1355
202 Ga0307408_100785892 3300031548 Bacteria 863
203 Ga0307516_10326227 3300031730 Bacteria 1205
204 Ga0307413_10005346 3300031824 Bacteria 5719
205 Ga0307413_10010772 3300031824 Bacteria 4456
206 Ga0307414_10046516 3300032004 Bacteria 2979
207 Ga0307414_10109227 3300032004 Bacteria 2100
208 Ga0307414_10174654 3300032004 Bacteria 1721
209 Ga0307414_10415915 3300032004 Bacteria 1171
210 Ga0307510_10002529 3300033180 Bacteria 20856
211 Ga0307510_10412589 3300033180 Bacteria 793
212 Ga0373958_0051781 3300034819 Bacteria 869
213 Ga0373931_0316954 3300035691 Bacteria 967
214 Ga0373927_0226819 3300035695 Unclassified 1227
215 Ga0373933_0633138 3300035724 Bacteria 703
216 Ga0373925_0143510 3300037068 Bacteria 1870
217 Ga0395899_0105056 3300037312 Bacteria 2035
218 Ga0395898_0103602 3300037466 Bacteria 2730
219 Ga0395905_0323010 3300037471 Bacteria 1433
220 Ga0395901_0046793 3300038443 Bacteria 4494
221 Ga0436365_1852354 3300039437 Bacteria 2945
222 Ga0436360_0375562 3300039438 Bacteria 2033
223 Ga0436363_0604216 3300039450 Bacteria 541
224 Ga0436362_1192436 3300039453 Bacteria 766
225 Ga0439465_0001525 3300041413 Bacteria 7525
226 Ga0439465_0171775 3300041413 Bacteria 781
227 Ga0451791_0211390 3300041451 Bacteria 1653
228 Ga0451791_0894170 3300041451 Bacteria 2204
229 Ga0451797_1240477 3300041453 Bacteria 889
230 Ga0451795_0330423 3300041456 Bacteria 1682
231 Ga0451802_1661923 3300041460 Bacteria 801
232 Ga0451807_0531900 3300041486 Bacteria 5819
233 Ga0451837_1480462 3300041494 Bacteria 3843
234 Ga0439441_052551 3300042001 Unclassified 843
235 Ga0439448_0004732 3300042005 Bacteria 3853
236 Ga0439448_0052080 3300042005 Bacteria 1341
237 Ga0439455_0006320 3300042012 Bacteria 2454
238 Ga0439458_0000554 3300042157 Bacteria 9623
239 Ga0495592_0074845 3300046454 Bacteria 2460
240 Ga0495603_0002761 3300046455 Bacteria 10347
241 Ga0495603_0029791 3300046455 Bacteria 3290
242 Ga0495638_0235742 3300046460 Bacteria 1015
243 Ga0495641_0015935 3300046461 Bacteria 3982
244 Ga0495651_0186148 3300046462 Bacteria 1465
245 Ga0495639_0148175 3300046475 Bacteria 1131
246 Ga0495662_0014856 3300046476 Bacteria 3783
247 Ga0495584_0101639 3300046491 Bacteria 1453
248 Ga0495584_0225974 3300046491 Bacteria 951
249 Ga0495584_0498759 3300046491 Bacteria 620
250 Ga0495585_0132084 3300046492 Bacteria 1313
251 Ga0495594_0097627 3300046499 Bacteria 1651
252 Ga0495594_0160734 3300046499 Bacteria 1277
253 Ga0495583_0239941 3300046506 Bacteria 729
254 Ga0495606_0036537 3300046507 Bacteria 3345
255 Ga0495618_0275649 3300046514 Bacteria 1050
256 Ga0495637_0169593 3300046520 Bacteria 815
257 Ga0495644_0006937 3300046523 Bacteria 4385
258 Ga0495648_0225383 3300046524 Bacteria 921
259 Ga0495663_0022143 3300046525 Bacteria 1834
260 Ga0495587_0318219 3300046536 Bacteria 869
261 Ga0495598_0240296 3300046537 Bacteria 667
262 Ga0495609_0018493 3300046538 Bacteria 3228
263 Ga0495622_0015642 3300046557 Bacteria 3526
264 Ga0495622_0106396 3300046557 Bacteria 1285
265 Ga0495633_0042590 3300046558 Bacteria 2155
266 Ga0495656_0003808 3300046615 Bacteria 5128
267 Ga0495656_0129081 3300046615 Bacteria 1201
268 Ga0495668_0068815 3300046616 Bacteria 1947
269 Ga0495611_0182551 3300046648 Bacteria 980
270 Ga0495659_0070413 3300046664 Bacteria 1309
271 Ga0495588_0008879 3300046674 Bacteria 4625
272 Ga0495657_0029173 3300046675 Bacteria 3872
273 Ga0495669_0037134 3300046684 Bacteria 2155
274 Ga0495671_0452153 3300046692 Bacteria 614
275 Ga0495589_0155591 3300046794 Bacteria 1090
276 Ga0495581_0107930 3300047315 Bacteria 1618
277 Ga0495604_0260246 3300047317 Bacteria 1179
278 Ga0495636_0080734 3300047318 Bacteria 1400
279 Ga0495636_0167010 3300047318 Bacteria 994
280 Ga0495672_0278362 3300047320 Bacteria 801
281 Ga0495683_0127764 3300047323 Bacteria 1201
282 Ga0495683_0143655 3300047323 Bacteria 1116
283 Ga0495677_0076687 3300047445 Bacteria 1250
284 Ga0495679_101922 3300047446 Bacteria 797
285 Ga0495673_0127066 3300047469 Bacteria 1005
286 Ga0495681_0224834 3300047470 Bacteria 751
287 Ga0496100_0637849 3300048903 Bacteria 829
288 Ga0496100_1126503 3300048903 Bacteria 619
289 Ga0496101_0175786 3300048904 Bacteria 1647
290 Ga0496102_0176157 3300048905 Bacteria 2014
291 Ga0496104_0510427 3300048907 Bacteria 1113
292 Ga0496104_0764209 3300048907 Bacteria 873
293 Ga0496105_0321249 3300048908 Bacteria 1241
294 Ga0496105_0573329 3300048908 Bacteria 879
295 Ga0496106_0392084 3300048909 Bacteria 1116
296 Ga0496108_0349205 3300048911 Bacteria 1291
297 Ga0496110_0410287 3300048913 Bacteria 1235
298 Ga0496111_0131801 3300048914 Bacteria 1850
299 Ga0496112_0102557 3300048915 Bacteria 2831
300 Ga0496112_0443113 3300048915 Bacteria 1237
301 Ga0496115_0011603 3300048918 Bacteria 6609
302 Ga0496117_0076308 3300048920 Bacteria 2223
303 Ga0496117_0096075 3300048920 Bacteria 1891
304 Ga0496118_0026344 3300048921 Bacteria 4956
305 Ga0496118_0059047 3300048921 Bacteria 2860
306 Ga0496119_0010429 3300048922 Bacteria 7819
307 Ga0496119_0015008 3300048922 Bacteria 6007
308 Ga0496119_0067015 3300048922 Bacteria 2118
309 Ga0496119_0215060 3300048922 Bacteria 987
310 Ga0496120_0084451 3300048923 Bacteria 1711
311 Ga0496121_0003807 3300048924 Bacteria 21025
312 Ga0496121_0041924 3300048924 Bacteria 3991
313 Ga0496121_0248335 3300048924 Bacteria 1235
314 Ga0496121_0269140 3300048924 Bacteria 1172
315 Ga0496122_0004560 3300048925 Bacteria 17079
316 Ga0496124_0337412 3300048927 Bacteria 1072
317 Ga0496125_0133959 3300048928 Bacteria 1737
318 Ga0496125_0475172 3300048928 Bacteria 710
319 Ga0496126_0290568 3300048929 Bacteria 1352
320 Ga0496126_0358159 3300048929 Bacteria 1192
321 Ga0501039_0242550 3300049575 Bacteria 1417
322 Ga0501067_0212561 3300049583 Bacteria 1077
323 Ga0501067_0405136 3300049583 Bacteria 761
324 Ga0501069_0145828 3300049585 Bacteria 1359
325 nmdc:mga03683_6029_c2 3300050489 Bacteria 2825
326 nmdc:mga03n38_58781_c1 3300050490 Bacteria 1743
327 nmdc:mga03n38_67150_c1 3300050490 Bacteria 1649
328 nmdc:mga00v17_177555_c1 3300050491 Bacteria 1374
329 nmdc:mga00v17_272825_c1 3300050491 Bacteria 1098
330 nmdc:mga00v17_59875_c1 3300050491 Bacteria 2338
331 nmdc:mga0yw44_153987_c1 3300050492 Bacteria 1501
332 nmdc:mga0yw44_3203_c1 3300050492 Bacteria 7203
333 nmdc:mga0yw44_518895_c1 3300050492 Bacteria 808
334 nmdc:mga06z11_109135_c1 3300050494 Bacteria 1530
335 nmdc:mga06z11_77859_c1 3300050494 Bacteria 1771
336 nmdc:mga07m45_2555_c2 3300050496 Bacteria 4576
337 nmdc:mga07m45_53265_c2 3300050496 Bacteria 2009
338 nmdc:mga05p37_45509_c1 3300050507 Bacteria 5396
339 nmdc:mga06r32_1207772_c1 3300050510 Bacteria 702
340 nmdc:mga0n895_194344_c1 3300050512 Bacteria 2060
341 nmdc:mga0sz30_23500_c1 3300050516 Bacteria 2509
342 nmdc:mga0sz30_894_c1 3300050516 Bacteria 10753
343 Ga0495655_0142262 3300053083 Bacteria 748
344 Ga0495619_0155549 3300053085 Bacteria 1578
345 Ga0495619_0265145 3300053085 Bacteria 1190
346 Ga0500578_0118437 3300053086 Bacteria 1666
347 Ga0500643_016865 3300053087 Bacteria 2462
348 Ga0500643_100350 3300053087 Bacteria 785
349 Ga0500644_0040354 3300053088 Bacteria 1544
350 Ga0500583_0030644 3300053092 Bacteria 2357
351 Ga0500651_0009559 3300053093 Bacteria 5772
352 Ga0500651_0045354 3300053093 Bacteria 2766
353 Ga0500641_0022113 3300053096 Bacteria 2432
354 Ga0500641_0132390 3300053096 Bacteria 1076
355 Ga0500641_0286251 3300053096 Bacteria 681
356 Ga0500650_0194183 3300053098 Bacteria 926
357 Ga0500654_122610 3300053099 Bacteria 1016
358 Ga0500555_001273 3300053103 Bacteria 8063
359 Ga0500556_0177925 3300053104 Bacteria 840
360 Ga0500560_000131 3300053107 Bacteria 8079
361 Ga0500569_096262 3300053109 Bacteria 965
362 Ga0500592_002450 3300053116 Bacteria 2991
363 Ga0500594_0054908 3300053118 Bacteria 1132
364 Ga0500595_000605 3300053119 Bacteria 21403
365 Ga0500595_045505 3300053119 Bacteria 1386
366 Ga0500607_114131 3300053121 Bacteria 1319
367 Ga0500614_136801 3300053123 Bacteria 731
368 Ga0500642_0005810 3300053130 Bacteria 4013
369 Ga0500642_0019157 3300053130 Bacteria 2663
370 Ga0500652_206996 3300053131 Bacteria 794
371 Ga0500655_030659 3300053133 Bacteria 1035
372 Ga0500658_0037304 3300053134 Bacteria 1933
373 Ga0500658_0056777 3300053134 Bacteria 1616
374 Ga0500658_0061387 3300053134 Bacteria 1563
375 Ga0500658_0072426 3300053134 Bacteria 1457
376 Ga0500658_0157629 3300053134 Unclassified 1026
377 Ga0500658_0233331 3300053134 Bacteria 844
378 Ga0500658_0407552 3300053134 Unclassified 622
379 Ga0500559_0582578 3300053136 Bacteria 508
380 Ga0500568_0001303 3300053139 Bacteria 16379
381 Ga0500568_0017269 3300053139 Bacteria 3189
382 Ga0500568_0066271 3300053139 Bacteria 1389
383 Ga0500568_0079715 3300053139 Bacteria 1244
384 Ga0500568_0163029 3300053139 Unclassified 822
385 Ga0500577_0000672 3300053142 Bacteria 8759
386 Ga0500577_0095015 3300053142 Bacteria 1211
387 Ga0500577_0132340 3300053142 Bacteria 1046
388 Ga0500588_0014220 3300053146 Bacteria 2012
389 Ga0500589_037194 3300053147 Bacteria 2273
390 Ga0500589_228306 3300053147 Bacteria 697
391 Ga0500590_000618 3300053148 Bacteria 12625
392 Ga0500604_0000515 3300053151 Bacteria 10703
393 Ga0500604_0095236 3300053151 Bacteria 976
394 Ga0500616_0002003 3300053153 Bacteria 18051
395 Ga0500616_0097863 3300053153 Bacteria 1440
396 Ga0500624_001076 3300053157 Bacteria 5231
397 Ga0500634_0051557 3300053161 Bacteria 2213
398 Ga0500636_0063949 3300053177 Bacteria 2144
399 Ga0500611_011854 3300053727 Bacteria 1455
400 Ga0500609_003653 3300053731 Bacteria 2145
401 Ga0500609_015019 3300053731 Bacteria 1048
402 Ga0587114_024251 3300059655 Bacteria 881
403 2643920411 2643221582 Bacteria 5804683
404 2876809109 2876808645 Bacteria 8824342
405 2879110241 2879110137 Bacteria 8907982
406 2932408081 2932406140 Bacteria 5134491
407 2939578538 2939577877 Bacteria 5132791
408 2953997807 2953994433 Bacteria 4303959
409 2996336553 2996336353 Bacteria 5511628
410 8003571555 8003570095 Bacteria 5747666
411 8056673650 8056673599 Bacteria 7871253
412 Ga0265760_10028982
413 JGI24739J22299_10004373
414 JGI24739J22299_10023428
415 JGI24739J22299_10060707
416 JGI24737J22298_10016874
417 JGI24735J21928_10016384
418 JGI25153J46596_10000067
419 JGI25153J46596_10019227
420 rootL2_10060806
421 rootL2_10285813
422 JGI25404J52841_10004205
423 JGI25405J52794_10012510
424 Ga0070658_10002345
425 Ga0070676_10115585
426 Ga0070670_100849842
427 Ga0068868_100036714
428 Ga0070660_100028988
429 Ga0070660_100186349
430 Ga0070660_100288008
431 Ga0070661_100871987
432 Ga0070668_100018694
433 Ga0070671_100003663
434 Ga0070671_100165566
435 Ga0070659_100416382
436 Ga0070667_100893529
437 Ga0070705_100218732
438 Ga0070694_100369590
439 Ga0070663_100101331
440 Ga0070663_100916599
441 Ga0070663_101007323
442 Ga0070678_100168071
443 Ga0070678_101035723
444 Ga0070662_100028897
445 Ga0070662_100207060
446 Ga0070706_101726667
447 Ga0068853_100144827
448 Ga0068853_100401605
449 Ga0070686_100401433
450 Ga0070696_100338754
451 Ga0070693_100057823
452 Ga0070665_100024005
453 Ga0070665_100156412
454 Ga0070665_101337009
455 Ga0068855_100010086
456 Ga0068855_100046398
457 Ga0070664_100184458
458 Ga0068857_100022544
459 Ga0068854_100567449
460 Ga0068856_100013112
461 Ga0068856_100029657
462 Ga0068856_100754074
463 Ga0068859_100527507
464 Ga0068870_10327256
465 Ga0068858_100103465
466 Ga0068860_100343193
467 Ga0068862_100028532
468 Ga0068862_100474252
469 Ga0081455_10001642
470 Ga0081455_10487943
471 Ga0081455_10581431
472 Ga0081538_10134382
473 Ga0081540_1000430
474 Ga0081540_1001476
475 Ga0081540_1105682
476 Ga0081539_10032300
477 Ga0070717_10101799
478 Ga0075365_10108764
479 Ga0075365_10212668
480 Ga0075365_10236690
481 Ga0075365_10361396
482 Ga0075363_100097527
483 Ga0075363_100134137
484 Ga0075364_10010761
485 Ga0075364_10097780
486 Ga0075364_10563558
487 Ga0070712_100702724
488 Ga0075362_10062944
489 Ga0075362_10097759
490 Ga0075367_10211871
491 Ga0075369_10000052
492 Ga0075369_10004585
493 Ga0075427_10029673
494 Ga0075366_10156470
495 Ga0097621_100199661
496 Ga0075370_10025011
497 Ga0068871_100266058
498 Ga0075431_101421897
499 Ga0075434_100112037
500 Ga0097620_100527499
501 Ga0105240_10008997
502 Ga0105240_10211086
503 Ga0105240_10443800
504 Ga0105240_10895217
505 Ga0111539_10476304
506 Ga0105245_10088425
507 Ga0114129_10035967
508 Ga0105241_10455067
509 Ga0105242_10129927
510 Ga0105242_10480590
511 Ga0105248_10001438
512 Ga0105248_10025755
513 Ga0105248_10916449
514 Ga0105237_10127067
515 Ga0105237_10198020
516 Ga0105237_10372364
517 Ga0105238_10048100
518 Ga0105238_10234774
519 Ga0105238_10376440
520 Ga0105239_10024398
521 Ga0105239_10039135
522 Ga0105239_10162341
523 Ga0105246_10008855
524 Ga0105246_10154435
525 Ga0157373_10072365
526 Ga0157373_10117433
527 Ga0157371_10391117
528 Ga0157371_10631212
529 Ga0157370_10075725
530 Ga0157369_10096251
531 Ga0157374_10239706
532 Ga0163162_11347121
533 Ga0157375_11273580
534 Ga0163163_10095344
535 Ga0163163_10131604
536 Ga0182008_10052893
537 Ga0157377_10216690
538 Ga0157376_10009148
539 Ga0213876_10025907
540 Ga0224712_10156215
541 Ga0228598_1022196
542 Ga0209758_1000284
543 Ga0209758_1019098
544 Ga0209758_1029808
545 Ga0209758_1033187
546 Ga0209758_1092576
547 Ga0207680_10239398
548 Ga0207647_10001242
549 Ga0207647_10007619
550 Ga0207643_10078127
551 Ga0207705_10000347
552 Ga0207705_10206758
553 Ga0207707_10949011
554 Ga0207695_10052692
555 Ga0207695_10070276
556 Ga0207695_10337942
557 Ga0207671_10139641
558 Ga0207671_10176191
559 Ga0207671_10211105
560 Ga0207693_10423906
561 Ga0207662_10091401
562 Ga0207657_10009837
563 Ga0207657_10034945
564 Ga0207657_10068603
565 Ga0207657_10167110
566 Ga0207694_10050523
567 Ga0207694_10242788
568 Ga0207659_10385499
569 Ga0207644_10026156
570 Ga0207644_10077871
571 Ga0207690_10084534
572 Ga0207706_10024253
573 Ga0207706_10027406
574 Ga0207706_10196927
575 Ga0207706_10934609
576 Ga0207686_10221641
577 Ga0207711_10655056
578 Ga0207689_10104808
579 Ga0207679_10154354
580 Ga0207667_10289216
581 Ga0207667_10319672
582 Ga0207668_10012300
583 Ga0207658_11139378
584 Ga0207677_10152221
585 Ga0207703_10974392
586 Ga0207639_10033598
587 Ga0207678_10080608
588 Ga0207678_10142173
589 Ga0207678_10977441
590 Ga0207702_11238713
591 Ga0207674_10001872
592 Ga0207674_10105823
593 Ga0207674_10799090
594 Ga0207675_100234510
595 Ga0207683_10250207
596 Ga0207683_10808570
597 Ga0207698_11738933
598 Ga0209970_1000085
599 Ga0268266_10000189
600 Ga0268266_10191732
601 Ga0268266_11188068
602 Ga0268265_10006430
603 Ga0268265_10278946
604 Ga0307517_10000249
605 Ga0307511_10274805
606 Ga0307512_10071190
607 Ga0316176_1219576
608 Ga0314311_1184013
609 Ga0265771_1016320
610 Ga0307513_10349817
611 Ga0307509_10252654
612 Ga0307408_100295451
613 Ga0307408_100785892
614 Ga0307516_10326227
615 Ga0307413_10005346
616 Ga0307413_10010772
617 Ga0307414_10046516
618 Ga0307414_10109227
619 Ga0307414_10174654
620 Ga0307414_10415915
621 Ga0307510_10002529
622 Ga0307510_10412589
623 Ga0373958_0051781
624 Ga0373931_0316954
625 Ga0373927_0226819
626 Ga0373933_0633138
627 Ga0373925_0143510
628 Ga0395899_0105056
629 Ga0395898_0103602
630 Ga0395905_0323010
631 Ga0395901_0046793
632 Ga0436365_1852354
633 Ga0436360_0375562
634 Ga0436363_0604216
635 Ga0436362_1192436
636 Ga0439465_0001525
637 Ga0439465_0171775
638 Ga0451791_0211390
639 Ga0451791_0894170
640 Ga0451797_1240477
641 Ga0451795_0330423
642 Ga0451802_1661923
643 Ga0451807_0531900
644 Ga0451837_1480462
645 Ga0439441_052551
646 Ga0439448_0004732
647 Ga0439448_0052080
648 Ga0439455_0006320
649 Ga0439458_0000554
650 Ga0495592_0074845
651 Ga0495603_0002761
652 Ga0495603_0029791
653 Ga0495638_0235742
654 Ga0495641_0015935
655 Ga0495651_0186148
656 Ga0495639_0148175
657 Ga0495662_0014856
658 Ga0495584_0101639
659 Ga0495584_0225974
660 Ga0495584_0498759
661 Ga0495585_0132084
662 Ga0495594_0097627
663 Ga0495594_0160734
664 Ga0495583_0239941
665 Ga0495606_0036537
666 Ga0495618_0275649
667 Ga0495637_0169593
668 Ga0495644_0006937
669 Ga0495648_0225383
670 Ga0495663_0022143
671 Ga0495587_0318219
672 Ga0495598_0240296
673 Ga0495609_0018493
674 Ga0495622_0015642
675 Ga0495622_0106396
676 Ga0495633_0042590
677 Ga0495656_0003808
678 Ga0495656_0129081
679 Ga0495668_0068815
680 Ga0495611_0182551
681 Ga0495659_0070413
682 Ga0495588_0008879
683 Ga0495657_0029173
684 Ga0495669_0037134
685 Ga0495671_0452153
686 Ga0495589_0155591
687 Ga0495581_0107930
688 Ga0495604_0260246
689 Ga0495636_0080734
690 Ga0495636_0167010
691 Ga0495672_0278362
692 Ga0495683_0127764
693 Ga0495683_0143655
694 Ga0495677_0076687
695 Ga0495679_101922
696 Ga0495673_0127066
697 Ga0495681_0224834
698 Ga0496100_0637849
699 Ga0496100_1126503
700 Ga0496101_0175786
701 Ga0496102_0176157
702 Ga0496104_0510427
703 Ga0496104_0764209
704 Ga0496105_0321249
705 Ga0496105_0573329
706 Ga0496106_0392084
707 Ga0496108_0349205
708 Ga0496110_0410287
709 Ga0496111_0131801
710 Ga0496112_0102557
711 Ga0496112_0443113
712 Ga0496115_0011603
713 Ga0496117_0076308
714 Ga0496117_0096075
715 Ga0496118_0026344
716 Ga0496118_0059047
717 Ga0496119_0010429
718 Ga0496119_0015008
719 Ga0496119_0067015
720 Ga0496119_0215060
721 Ga0496120_0084451
722 Ga0496121_0003807
723 Ga0496121_0041924
724 Ga0496121_0248335
725 Ga0496121_0269140
726 Ga0496122_0004560
727 Ga0496124_0337412
728 Ga0496125_0133959
729 Ga0496125_0475172
730 Ga0496126_0290568
731 Ga0496126_0358159
732 Ga0501039_0242550
733 Ga0501067_0212561
734 Ga0501067_0405136
735 Ga0501069_0145828
736 nmdc:mga03683_6029_c2
737 nmdc:mga03n38_58781_c1
738 nmdc:mga03n38_67150_c1
739 nmdc:mga00v17_177555_c1
740 nmdc:mga00v17_272825_c1
741 nmdc:mga00v17_59875_c1
742 nmdc:mga0yw44_153987_c1
743 nmdc:mga0yw44_3203_c1
744 nmdc:mga0yw44_518895_c1
745 nmdc:mga06z11_109135_c1
746 nmdc:mga06z11_77859_c1
747 nmdc:mga07m45_2555_c2
748 nmdc:mga07m45_53265_c2
749 nmdc:mga05p37_45509_c1
750 nmdc:mga06r32_1207772_c1
751 nmdc:mga0n895_194344_c1
752 nmdc:mga0sz30_23500_c1
753 nmdc:mga0sz30_894_c1
754 Ga0495655_0142262
755 Ga0495619_0155549
756 Ga0495619_0265145
757 Ga0500578_0118437
758 Ga0500643_016865
759 Ga0500643_100350
760 Ga0500644_0040354
761 Ga0500583_0030644
762 Ga0500651_0009559
763 Ga0500651_0045354
764 Ga0500641_0022113
765 Ga0500641_0132390
766 Ga0500641_0286251
767 Ga0500650_0194183
768 Ga0500654_122610
769 Ga0500555_001273
770 Ga0500556_0177925
771 Ga0500560_000131
772 Ga0500569_096262
773 Ga0500592_002450
774 Ga0500594_0054908
775 Ga0500595_000605
776 Ga0500595_045505
777 Ga0500607_114131
778 Ga0500614_136801
779 Ga0500642_0005810
780 Ga0500642_0019157
781 Ga0500652_206996
782 Ga0500655_030659
783 Ga0500658_0037304
784 Ga0500658_0056777
785 Ga0500658_0061387
786 Ga0500658_0072426
787 Ga0500658_0157629
788 Ga0500658_0233331
789 Ga0500658_0407552
790 Ga0500559_0582578
791 Ga0500568_0001303
792 Ga0500568_0017269
793 Ga0500568_0066271
794 Ga0500568_0079715
795 Ga0500568_0163029
796 Ga0500577_0000672
797 Ga0500577_0095015
798 Ga0500577_0132340
799 Ga0500588_0014220
800 Ga0500589_037194
801 Ga0500589_228306
802 Ga0500590_000618
803 Ga0500604_0000515
804 Ga0500604_0095236
805 Ga0500616_0002003
806 Ga0500616_0097863
807 Ga0500624_001076
808 Ga0500634_0051557
809 Ga0500636_0063949
810 Ga0500611_011854
811 Ga0500609_003653
812 Ga0500609_015019
813 Ga0587114_024251
814 2643920411
815 2876809109
816 2879110241
817 2932408081
818 2939578538
819 2953997807
820 2996336553
821 8003571555
822 8056673650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

26

154

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8574 18 157
2k5g-assembly1.cif.gz_A solution nmr structure of protein encoded by gene bpp1335 from bordetella parapertussis: northeast structural genomics target bpr195 0.8278 7 177
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8208 18 157
2lcg-assembly1.cif.gz_A solution nmr structure of protein rmet_5065 from ralstonia metallidurans, northeast structural genomics consortium target crr115 0.8097 18 153
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8041 18 157
ID Description Score Start End Superfamily
3q6aA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8422 20 157 3.30.530.20
2k5gA01 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8367 10 177 3.30.530.20
af_P91107_262_322_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8254 89 126 2.30.29.30
2k5gA01 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7938 10 177 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7867 20 159 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A285TMY1-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9875 1 176
AF-A0A1M2YLM8-F1-model_v4 deleted 0.9849 1 174
AF-A0A434M5F4-F1-model_v4 ATPase 0.9826 64 177
AF-A0A285TMY1-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.982 1 176
AF-A0A1Q3LSD3-F1-model_v4 ATPase 0.9818 1 166

Map