F437316

General Info

Members Datasets Scaffolds Average Seq Length
410 233 820 86

Family's Representative Sequence

Representative Sequence 3300041459|Ga0451800_0460611|Ga0451800_0460611_150_458
Length 102
Sequence MAHKKGLGSSRNGRDSAAQRLGVKIFAGQVVTGGEIIVRQRGTRFKPGEGVGIGRDDTLFARAAGTVQFAEGRRGRVVSVLVRSTRVFTVRRSRPVIRATSA

Samples

Sample ID Description Type Environment
1 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
63 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
79 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.15
Metatranscriptomes 5.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.07
Rhizosphere 89.51
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451800_0460611 3300041459 Bacteria 644
2 LJQas_1012401 3300000549 Bacteria 1009
3 JGI25404J52841_10066694 3300003659 Bacteria 753
4 Ga0058863_11862084 3300004799 Bacteria 828
5 Ga0070658_10237675 3300005327 Bacteria 1543
6 Ga0070658_10379189 3300005327 Bacteria 1213
7 Ga0070676_10159556 3300005328 Bacteria 1450
8 Ga0070683_100318782 3300005329 Bacteria 1479
9 Ga0070670_102185191 3300005331 Bacteria 510
10 Ga0070680_100486200 3300005336 Bacteria 1055
11 Ga0070682_100071844 3300005337 Bacteria 2216
12 Ga0068868_100181002 3300005338 Bacteria 1749
13 Ga0070660_100059718 3300005339 Bacteria 2957
14 Ga0070660_100949873 3300005339 Bacteria 726
15 Ga0070660_101827853 3300005339 Bacteria 518
16 Ga0070691_10283348 3300005341 Bacteria 900
17 Ga0070691_10365535 3300005341 Bacteria 805
18 Ga0070687_100148158 3300005343 Bacteria 1374
19 Ga0070668_100051487 3300005347 Bacteria 3173
20 Ga0070668_100428988 3300005347 Bacteria 1133
21 Ga0070688_100256601 3300005365 Bacteria 1247
22 Ga0070659_100095531 3300005366 Bacteria 2387
23 Ga0070714_100024650 3300005435 Bacteria 4956
24 Ga0070714_100066724 3300005435 Bacteria 3101
25 Ga0070714_101840704 3300005435 Bacteria 591
26 Ga0070713_100007509 3300005436 Bacteria 7660
27 Ga0070711_101604514 3300005439 Bacteria 569
28 Ga0070700_100021909 3300005441 Bacteria 3720
29 Ga0070663_101009217 3300005455 Bacteria 724
30 Ga0070663_101347274 3300005455 Bacteria 631
31 Ga0070663_101440192 3300005455 Bacteria 611
32 Ga0070662_100017424 3300005457 Bacteria 4843
33 Ga0070662_100862016 3300005457 Bacteria 772
34 Ga0070662_101246016 3300005457 Bacteria 640
35 Ga0070681_10165345 3300005458 Bacteria 2135
36 Ga0068867_100522296 3300005459 Bacteria 1024
37 Ga0070685_10292447 3300005466 Bacteria 1095
38 Ga0070679_100272834 3300005530 Bacteria 1645
39 Ga0070679_100360809 3300005530 Bacteria 1400
40 Ga0070684_100078251 3300005535 Bacteria 2921
41 Ga0070684_101180881 3300005535 Bacteria 720
42 Ga0070684_101488092 3300005535 Bacteria 638
43 Ga0068853_100660005 3300005539 Bacteria 996
44 Ga0068853_101531853 3300005539 Bacteria 646
45 Ga0070696_100007245 3300005546 Bacteria 7407
46 Ga0070693_100291925 3300005547 Bacteria 1096
47 Ga0070665_101362224 3300005548 Bacteria 719
48 Ga0070664_100560850 3300005564 Bacteria 1057
49 Ga0070664_100610659 3300005564 Bacteria 1012
50 Ga0068857_101315093 3300005577 Bacteria 702
51 Ga0068854_100130082 3300005578 Bacteria 1921
52 Ga0068854_100250656 3300005578 Bacteria 1413
53 Ga0068854_100285798 3300005578 Bacteria 1330
54 Ga0068856_100015429 3300005614 Bacteria 7383
55 Ga0068856_100027096 3300005614 Bacteria 5590
56 Ga0068856_100773652 3300005614 Bacteria 980
57 Ga0070702_100051219 3300005615 Bacteria 2363
58 Ga0068852_100001278 3300005616 Bacteria 16796
59 Ga0068859_100166862 3300005617 Bacteria 2282
60 Ga0068859_100754791 3300005617 Bacteria 1062
61 Ga0068864_100339315 3300005618 Bacteria 1415
62 Ga0068861_100163769 3300005719 Bacteria 1837
63 Ga0068861_100334726 3300005719 Bacteria 1323
64 Ga0068861_100370098 3300005719 Bacteria 1263
65 Ga0068862_101864690 3300005844 Bacteria 611
66 Ga0081455_10016062 3300005937 Bacteria 7243
67 Ga0081455_10130087 3300005937 Bacteria 1970
68 Ga0081455_10228849 3300005937 Bacteria 1373
69 Ga0081540_1000943 3300005983 Bacteria 26189
70 Ga0081539_10002674 3300005985 Bacteria 24249
71 Ga0081539_10005347 3300005985 Bacteria 13158
72 Ga0070717_10073462 3300006028 Bacteria 2858
73 Ga0070717_10086511 3300006028 Bacteria 2638
74 Ga0070717_10298204 3300006028 Bacteria 1432
75 Ga0070717_11939099 3300006028 Unclassified 531
76 Ga0075428_101115650 3300006844 Bacteria 833
77 Ga0075430_100006271 3300006846 Bacteria 10029
78 Ga0075430_100162937 3300006846 Bacteria 1856
79 Ga0075431_100072121 3300006847 Bacteria 3563
80 Ga0075431_100757659 3300006847 Bacteria 946
81 Ga0075429_100023605 3300006880 Bacteria 5338
82 Ga0097620_100166854 3300006931 Bacteria 2282
83 Ga0097620_100754672 3300006931 Bacteria 1062
84 Ga0105240_10049867 3300009093 Bacteria 5280
85 Ga0105240_10437184 3300009093 Bacteria 1467
86 Ga0105240_11846383 3300009093 Bacteria 629
87 Ga0105245_10010315 3300009098 Bacteria 8138
88 Ga0105245_10052325 3300009098 Bacteria 3662
89 Ga0105247_10972561 3300009101 Bacteria 661
90 Ga0105247_11119328 3300009101 Bacteria 622
91 Ga0114129_10232722 3300009147 Bacteria 2481
92 Ga0114129_11195711 3300009147 Bacteria 947
93 Ga0105243_10424578 3300009148 Bacteria 1241
94 Ga0105243_11661017 3300009148 Bacteria 667
95 Ga0105242_10988252 3300009176 Bacteria 848
96 Ga0105242_12252983 3300009176 Bacteria 590
97 Ga0105242_12677286 3300009176 Bacteria 548
98 Ga0105237_10195085 3300009545 Bacteria 2024
99 Ga0105238_10033749 3300009551 Bacteria 5207
100 Ga0105238_12764313 3300009551 Bacteria 527
101 Ga0105249_10001947 3300009553 Bacteria 17910
102 Ga0105249_10238938 3300009553 Bacteria 1795
103 Ga0105249_12682118 3300009553 Bacteria 570
104 Ga0105239_10553266 3300010375 Bacteria 1310
105 Ga0105239_10807747 3300010375 Bacteria 1075
106 Ga0105239_11739492 3300010375 Bacteria 722
107 Ga0157335_1039011 3300012492 Bacteria 529
108 Ga0157316_1007907 3300012510 Bacteria 917
109 Ga0157371_10305279 3300013102 Bacteria 1153
110 Ga0157370_10236007 3300013104 Bacteria 1692
111 Ga0157369_10199656 3300013105 Bacteria 2100
112 Ga0157369_11623952 3300013105 Bacteria 657
113 Ga0157369_12227646 3300013105 Bacteria 555
114 Ga0157374_12435204 3300013296 Bacteria 551
115 Ga0157378_12513859 3300013297 Bacteria 567
116 Ga0163162_10195338 3300013306 Bacteria 2152
117 Ga0157372_10774736 3300013307 Bacteria 1115
118 Ga0157372_10810243 3300013307 Bacteria 1088
119 Ga0157372_12606231 3300013307 Bacteria 580
120 Ga0157380_10296492 3300014326 Bacteria 1487
121 Ga0157380_11544876 3300014326 Bacteria 718
122 Ga0157380_12699217 3300014326 Bacteria 563
123 Ga0182008_10164241 3300014497 Bacteria 1119
124 Ga0157377_10329995 3300014745 Bacteria 1017
125 Ga0157377_11133495 3300014745 Bacteria 601
126 Ga0157376_12381382 3300014969 Bacteria 569
127 Ga0163161_10020184 3300017792 Bacteria 4674
128 Ga0163161_11016500 3300017792 Bacteria 708
129 Ga0163161_12101010 3300017792 Bacteria 502
130 Ga0197907_10363273 3300020069 Bacteria 876
131 Ga0197907_10438105 3300020069 Bacteria 1029
132 Ga0197907_10912341 3300020069 Bacteria 859
133 Ga0206356_10884603 3300020070 Bacteria 526
134 Ga0206355_1032230 3300020076 Bacteria 1077
135 Ga0206355_1359819 3300020076 Bacteria 765
136 Ga0206355_1495325 3300020076 Bacteria 783
137 Ga0206351_10007671 3300020077 Bacteria 809
138 Ga0206352_10674016 3300020078 Bacteria 752
139 Ga0206352_10746788 3300020078 Bacteria 635
140 Ga0206352_10919818 3300020078 Bacteria 725
141 Ga0206350_11440425 3300020080 Bacteria 727
142 Ga0206354_10658999 3300020081 Bacteria 2011
143 Ga0206353_10671731 3300020082 Bacteria 5685
144 Ga0154015_1037672 3300020610 Bacteria 1160
145 Ga0154015_1230873 3300020610 Bacteria 819
146 Ga0213876_10502035 3300021384 Unclassified 645
147 Ga0224712_10157784 3300022467 Bacteria 1010
148 Ga0224712_10163932 3300022467 Bacteria 993
149 Ga0224712_10268419 3300022467 Bacteria 792
150 Ga0224712_10275073 3300022467 Bacteria 783
151 Ga0224712_10278071 3300022467 Bacteria 779
152 Ga0224712_10356904 3300022467 Bacteria 691
153 Ga0207692_11200659 3300025898 Bacteria 504
154 Ga0207688_10242527 3300025901 Bacteria 1090
155 Ga0207705_10288826 3300025909 Bacteria 1256
156 Ga0207707_10006730 3300025912 Bacteria 10035
157 Ga0207671_10189903 3300025914 Bacteria 1602
158 Ga0207693_10505981 3300025915 Bacteria 943
159 Ga0207660_10265305 3300025917 Bacteria 1359
160 Ga0207662_10150392 3300025918 Bacteria 1480
161 Ga0207657_10064033 3300025919 Bacteria 3140
162 Ga0207657_10195420 3300025919 Bacteria 1630
163 Ga0207652_10037495 3300025921 Bacteria 4103
164 Ga0207652_10243086 3300025921 Bacteria 1623
165 Ga0207694_10277795 3300025924 Bacteria 1375
166 Ga0207650_11729361 3300025925 Bacteria 530
167 Ga0207687_10038798 3300025927 Bacteria 3257
168 Ga0207687_10582666 3300025927 Bacteria 941
169 Ga0207700_10227942 3300025928 Bacteria 1583
170 Ga0207700_10383421 3300025928 Bacteria 1229
171 Ga0207664_10002520 3300025929 Bacteria 12114
172 Ga0207664_10071031 3300025929 Bacteria 2803
173 Ga0207664_11763115 3300025929 Bacteria 541
174 Ga0207690_10660528 3300025932 Bacteria 857
175 Ga0207706_10003622 3300025933 Bacteria 14766
176 Ga0207706_10305266 3300025933 Bacteria 1386
177 Ga0207706_11468596 3300025933 Bacteria 557
178 Ga0207709_10256119 3300025935 Bacteria 1281
179 Ga0207709_11533234 3300025935 Bacteria 553
180 Ga0207689_10124441 3300025942 Bacteria 2121
181 Ga0207661_10002136 3300025944 Bacteria 13604
182 Ga0207667_10497381 3300025949 Bacteria 1237
183 Ga0207712_10151998 3300025961 Bacteria 1789
184 Ga0207712_10316236 3300025961 Bacteria 1286
185 Ga0207668_10855767 3300025972 Bacteria 807
186 Ga0207640_10180292 3300025981 Bacteria 1583
187 Ga0207640_10786617 3300025981 Bacteria 823
188 Ga0207677_10240361 3300026023 Bacteria 1465
189 Ga0207639_10616493 3300026041 Bacteria 1002
190 Ga0207678_10402259 3300026067 Bacteria 1186
191 Ga0207708_10025481 3300026075 Bacteria 4473
192 Ga0207708_10808627 3300026075 Bacteria 807
193 Ga0207708_11140857 3300026075 Bacteria 680
194 Ga0207702_10230853 3300026078 Bacteria 1729
195 Ga0207702_10718058 3300026078 Bacteria 985
196 Ga0207702_12436282 3300026078 Bacteria 510
197 Ga0207641_11690118 3300026088 Bacteria 635
198 Ga0207648_12159514 3300026089 Bacteria 518
199 Ga0207676_11806008 3300026095 Bacteria 610
200 Ga0207674_10114097 3300026116 Bacteria 2674
201 Ga0207675_100017632 3300026118 Bacteria 6660
202 Ga0207675_100105489 3300026118 Bacteria 2656
203 Ga0207675_100365486 3300026118 Bacteria 1416
204 Ga0207675_102178688 3300026118 Bacteria 570
205 Ga0209998_10188465 3300027717 Bacteria 537
206 Ga0207428_10615873 3300027907 Bacteria 781
207 Ga0268265_12034876 3300028380 Bacteria 581
208 Ga0265766_1006742 3300030863 Bacteria 758
209 Ga0307408_100273698 3300031548 Bacteria 1403
210 Ga0307408_100402114 3300031548 Bacteria 1176
211 Ga0307408_100504832 3300031548 Bacteria 1059
212 Ga0307408_101692903 3300031548 Bacteria 602
213 Ga0307408_101709467 3300031548 Bacteria 600
214 Ga0307405_10026669 3300031731 Bacteria 3337
215 Ga0307405_10224677 3300031731 Bacteria 1380
216 Ga0307405_10227626 3300031731 Bacteria 1372
217 Ga0307405_11884068 3300031731 Bacteria 533
218 Ga0307413_10208751 3300031824 Bacteria 1416
219 Ga0307410_10058647 3300031852 Bacteria 2625
220 Ga0307410_10978834 3300031852 Bacteria 728
221 Ga0307406_10022114 3300031901 Bacteria 3771
222 Ga0307406_11039887 3300031901 Bacteria 704
223 Ga0307406_11641442 3300031901 Bacteria 568
224 Ga0307406_11682307 3300031901 Bacteria 562
225 Ga0307407_10205915 3300031903 Bacteria 1321
226 Ga0307407_10243928 3300031903 Bacteria 1227
227 Ga0307407_10651325 3300031903 Bacteria 789
228 Ga0307407_11450240 3300031903 Bacteria 542
229 Ga0307412_10110219 3300031911 Bacteria 1964
230 Ga0307409_100003689 3300031995 Bacteria 8394
231 Ga0307409_100112652 3300031995 Bacteria 2285
232 Ga0307409_100209445 3300031995 Bacteria 1751
233 Ga0307409_100455961 3300031995 Bacteria 1235
234 Ga0307409_100744529 3300031995 Bacteria 983
235 Ga0307409_100871829 3300031995 Bacteria 912
236 Ga0307409_100889576 3300031995 Bacteria 903
237 Ga0307416_100073552 3300032002 Bacteria 2850
238 Ga0307416_100198089 3300032002 Bacteria 1902
239 Ga0307416_100300072 3300032002 Bacteria 1596
240 Ga0307416_100346899 3300032002 Bacteria 1500
241 Ga0307416_101116437 3300032002 Bacteria 893
242 Ga0307416_102972926 3300032002 Bacteria 567
243 Ga0307414_10637523 3300032004 Bacteria 959
244 Ga0307411_10080428 3300032005 Bacteria 2241
245 Ga0307415_100032369 3300032126 Bacteria 3380
246 Ga0307415_100188306 3300032126 Bacteria 1626
247 Ga0307415_100692703 3300032126 Bacteria 918
248 Ga0307415_100888535 3300032126 Bacteria 820
249 Ga0307415_100994991 3300032126 Bacteria 779
250 Ga0307415_101114829 3300032126 Bacteria 739
251 Ga0373945_0085680 3300035116 Bacteria 1213
252 Ga0373943_0280388 3300035170 Bacteria 942
253 Ga0373943_0995007 3300035170 Bacteria 503
254 Ga0373947_0161258 3300035725 Bacteria 1450
255 Ga0373937_0625267 3300036401 Bacteria 1022
256 Ga0373925_0192457 3300037068 Bacteria 1619
257 Ga0373925_0288397 3300037068 Bacteria 1323
258 Ga0395898_0364498 3300037466 Bacteria 1378
259 Ga0395898_1388028 3300037466 Bacteria 630
260 Ga0436364_0374849 3300037853 Bacteria 1171
261 Ga0395901_0100576 3300038443 Bacteria 3033
262 Ga0436365_0503174 3300039437 Bacteria 746
263 Ga0436365_1114241 3300039437 Bacteria 886
264 Ga0436365_1312538 3300039437 Bacteria 878
265 Ga0436365_1685731 3300039437 Bacteria 1370
266 Ga0436365_1772586 3300039437 Bacteria 3712
267 Ga0436360_0355654 3300039438 Unclassified 505
268 Ga0436361_0456292 3300039447 Bacteria 565
269 Ga0436363_0939426 3300039450 Bacteria 770
270 Ga0436363_1481315 3300039450 Bacteria 2002
271 Ga0436362_0611355 3300039453 Bacteria 676
272 Ga0451847_0593125 3300041503 Bacteria 604
273 Ga0451853_2227801 3300041512 Bacteria 607
274 Ga0451853_4016279 3300041512 Bacteria 611
275 Ga0439448_0265856 3300042005 Bacteria 607
276 Ga0439444_0201689 3300042437 Bacteria 502
277 Ga0466965_0305929 3300044683 Bacteria 863
278 Ga0466966_0054774 3300044684 Bacteria 2526
279 Ga0466961_0644922 3300044693 Unclassified 636
280 Ga0466963_0015205 3300044694 Bacteria 4760
281 Ga0466963_0295528 3300044694 Bacteria 1139
282 Ga0466971_0193593 3300044719 Bacteria 958
283 Ga0466968_0041929 3300044735 Bacteria 1934
284 Ga0466968_0391048 3300044735 Bacteria 680
285 Ga0466968_0462267 3300044735 Bacteria 628
286 Ga0466957_0129518 3300044842 Bacteria 1615
287 Ga0466960_0021703 3300044901 Bacteria 2863
288 Ga0466960_0538343 3300044901 Bacteria 688
289 Ga0466960_0630201 3300044901 Bacteria 639
290 Ga0466959_0080369 3300045049 Bacteria 2350
291 Ga0466959_0345870 3300045049 Bacteria 1014
292 Ga0466959_0874614 3300045049 Bacteria 600
293 Ga0466958_0005965 3300045836 Bacteria 6592
294 Ga0466967_0019264 3300045976 Bacteria 5483
295 Ga0466967_0078691 3300045976 Bacteria 2971
296 Ga0466967_0968028 3300045976 Bacteria 847
297 Ga0466967_1040879 3300045976 Bacteria 815
298 Ga0466967_2100373 3300045976 Bacteria 561
299 Ga0495641_0408185 3300046461 Bacteria 616
300 Ga0495580_0439750 3300046472 Bacteria 876
301 Ga0495582_0148228 3300046473 Bacteria 1331
302 Ga0495584_0082127 3300046491 Bacteria 1622
303 Ga0495584_0362485 3300046491 Bacteria 736
304 Ga0495596_0059725 3300046500 Bacteria 1486
305 Ga0495607_0137912 3300046501 Bacteria 1262
306 Ga0495616_0184590 3300046513 Bacteria 925
307 Ga0495631_0388544 3300046518 Bacteria 594
308 Ga0495637_0170234 3300046520 Bacteria 813
309 Ga0495637_0170915 3300046520 Bacteria 811
310 Ga0495609_0059542 3300046538 Bacteria 1689
311 Ga0495656_0158595 3300046615 Bacteria 1098
312 Ga0495656_0232796 3300046615 Bacteria 925
313 Ga0495656_0241065 3300046615 Bacteria 910
314 Ga0495599_0465963 3300046678 Bacteria 747
315 Ga0495658_0497926 3300046683 Bacteria 779
316 Ga0495581_0612461 3300047315 Bacteria 630
317 Ga0495676_0127551 3300047321 Bacteria 1842
318 Ga0495676_0156508 3300047321 Bacteria 1616
319 Ga0495676_0610616 3300047321 Bacteria 710
320 Ga0495615_0083226 3300048090 Bacteria 881
321 Ga0496100_0417684 3300048903 Bacteria 1024
322 Ga0496101_0188208 3300048904 Bacteria 1592
323 Ga0496101_0315090 3300048904 Bacteria 1227
324 Ga0496101_0395121 3300048904 Bacteria 1089
325 Ga0496102_0090728 3300048905 Bacteria 2828
326 Ga0496104_0050464 3300048907 Bacteria 3925
327 Ga0496104_0531198 3300048907 Bacteria 1087
328 Ga0496105_0071187 3300048908 Bacteria 2874
329 Ga0496105_0110443 3300048908 Bacteria 2270
330 Ga0496105_0808359 3300048908 Bacteria 712
331 Ga0496106_0348018 3300048909 Bacteria 1190
332 Ga0496107_0175676 3300048910 Bacteria 1590
333 Ga0496108_0269704 3300048911 Bacteria 1481
334 Ga0496108_0507131 3300048911 Bacteria 1053
335 Ga0496108_0559052 3300048911 Bacteria 998
336 Ga0496109_0001964 3300048912 Bacteria 17052
337 Ga0496109_0085767 3300048912 Bacteria 2907
338 Ga0496109_0686479 3300048912 Bacteria 961
339 Ga0496109_1896853 3300048912 Bacteria 528
340 Ga0496110_0004233 3300048913 Bacteria 11103
341 Ga0496110_0707892 3300048913 Bacteria 909
342 Ga0496111_0005273 3300048914 Bacteria 8251
343 Ga0496111_0681974 3300048914 Bacteria 748
344 Ga0496112_0760588 3300048915 Bacteria 895
345 Ga0496112_1035589 3300048915 Bacteria 740
346 Ga0496113_0003306 3300048916 Bacteria 9625
347 Ga0496113_0108962 3300048916 Bacteria 2153
348 Ga0496115_0921776 3300048918 Bacteria 672
349 Ga0496126_0006038 3300048929 Bacteria 13595
350 Ga0496126_0095246 3300048929 Bacteria 2612
351 Ga0501031_0106683 3300049568 Bacteria 1828
352 Ga0501031_0363867 3300049568 Bacteria 936
353 Ga0501031_1096410 3300049568 Bacteria 508
354 Ga0501032_0402147 3300049569 Bacteria 879
355 Ga0501033_0025031 3300049570 Bacteria 4497
356 Ga0501036_0072718 3300049572 Bacteria 2906
357 Ga0501037_0031121 3300049573 Bacteria 3940
358 Ga0501038_0012983 3300049574 Bacteria 7598
359 Ga0501038_1101677 3300049574 Bacteria 580
360 Ga0501039_0079984 3300049575 Bacteria 2543
361 Ga0501040_1167073 3300049576 Bacteria 559
362 Ga0501040_1424649 3300049576 Bacteria 503
363 Ga0501042_0107058 3300049578 Bacteria 2013
364 Ga0501042_0142269 3300049578 Bacteria 1729
365 Ga0501043_0064070 3300049579 Bacteria 2886
366 Ga0501046_0010594 3300049580 Bacteria 7913
367 Ga0501046_1167304 3300049580 Bacteria 530
368 Ga0501047_0817238 3300049581 Bacteria 746
369 Ga0501048_0218556 3300049582 Bacteria 1351
370 Ga0501067_0377424 3300049583 Bacteria 790
371 Ga0501068_0048013 3300049584 Bacteria 2576
372 Ga0501068_0460831 3300049584 Bacteria 823
373 Ga0501069_0032882 3300049585 Bacteria 2855
374 Ga0501070_0131430 3300049586 Bacteria 2067
375 Ga0501071_0070896 3300049587 Bacteria 2540
376 Ga0501072_0528753 3300049588 Bacteria 932
377 Ga0501073_0042803 3300049589 Bacteria 3195
378 Ga0501074_0038416 3300049590 Bacteria 3469
379 Ga0501074_0252374 3300049590 Bacteria 1254
380 Ga0501079_0226358 3300049741 Bacteria 1461
381 Ga0501079_0367819 3300049741 Bacteria 1127
382 Ga0501079_0661493 3300049741 Bacteria 822
383 Ga0501080_0030979 3300049742 Bacteria 4984
384 Ga0501080_0037404 3300049742 Bacteria 4533
385 Ga0501083_0017844 3300049744 Bacteria 4950
386 Ga0501035_0030971 3300049822 Bacteria 4872
387 Ga0501035_0291693 3300049822 Bacteria 1377
388 Ga0501044_0447087 3300049823 Bacteria 1199
389 Ga0501045_0293834 3300049824 Bacteria 1209
390 nmdc:mga05p37_1995454_c1 3300050507 Bacteria 549
391 nmdc:mga05p37_9388_c1 3300050507 Bacteria 11579
392 nmdc:mga09592_41633_c1 3300050508 Bacteria 3862
393 nmdc:mga0qj67_11533_c1 3300050509 Bacteria 6623
394 nmdc:mga0qj67_38415_c1 3300050509 Bacteria 3755
395 nmdc:mga0qj67_646449_c1 3300050509 Bacteria 844
396 nmdc:mga0qj67_9219_c1 3300050509 Bacteria 7333
397 nmdc:mga06r32_557804_c1 3300050510 Bacteria 1119
398 nmdc:mga06r32_68253_c1 3300050510 Bacteria 3434
399 nmdc:mga08y16_1164533_c1 3300050511 Bacteria 743
400 nmdc:mga08y16_683316_c1 3300050511 Bacteria 1028
401 Ga0495601_0648971 3300053077 Bacteria 675
402 Ga0495595_0081996 3300053084 Bacteria 1538
403 Ga0495619_0061594 3300053085 Bacteria 2497
404 Ga0495619_0744066 3300053085 Bacteria 665
405 Ga0501084_0143732 3300054114 Bacteria 2009
406 Ga0501082_0004134 3300060353 Bacteria 12678
407 Ga0501082_0098252 3300060353 Bacteria 2532
408 Ga0466962_0067574 3300061719 Bacteria 1707
409 Ga0466962_0072869 3300061719 Bacteria 1641
410 Ga0466962_0565212 3300061719 Bacteria 578
411 Ga0451800_0460611
412 LJQas_1012401
413 JGI25404J52841_10066694
414 Ga0058863_11862084
415 Ga0070658_10237675
416 Ga0070658_10379189
417 Ga0070676_10159556
418 Ga0070683_100318782
419 Ga0070670_102185191
420 Ga0070680_100486200
421 Ga0070682_100071844
422 Ga0068868_100181002
423 Ga0070660_100059718
424 Ga0070660_100949873
425 Ga0070660_101827853
426 Ga0070691_10283348
427 Ga0070691_10365535
428 Ga0070687_100148158
429 Ga0070668_100051487
430 Ga0070668_100428988
431 Ga0070688_100256601
432 Ga0070659_100095531
433 Ga0070714_100024650
434 Ga0070714_100066724
435 Ga0070714_101840704
436 Ga0070713_100007509
437 Ga0070711_101604514
438 Ga0070700_100021909
439 Ga0070663_101009217
440 Ga0070663_101347274
441 Ga0070663_101440192
442 Ga0070662_100017424
443 Ga0070662_100862016
444 Ga0070662_101246016
445 Ga0070681_10165345
446 Ga0068867_100522296
447 Ga0070685_10292447
448 Ga0070679_100272834
449 Ga0070679_100360809
450 Ga0070684_100078251
451 Ga0070684_101180881
452 Ga0070684_101488092
453 Ga0068853_100660005
454 Ga0068853_101531853
455 Ga0070696_100007245
456 Ga0070693_100291925
457 Ga0070665_101362224
458 Ga0070664_100560850
459 Ga0070664_100610659
460 Ga0068857_101315093
461 Ga0068854_100130082
462 Ga0068854_100250656
463 Ga0068854_100285798
464 Ga0068856_100015429
465 Ga0068856_100027096
466 Ga0068856_100773652
467 Ga0070702_100051219
468 Ga0068852_100001278
469 Ga0068859_100166862
470 Ga0068859_100754791
471 Ga0068864_100339315
472 Ga0068861_100163769
473 Ga0068861_100334726
474 Ga0068861_100370098
475 Ga0068862_101864690
476 Ga0081455_10016062
477 Ga0081455_10130087
478 Ga0081455_10228849
479 Ga0081540_1000943
480 Ga0081539_10002674
481 Ga0081539_10005347
482 Ga0070717_10073462
483 Ga0070717_10086511
484 Ga0070717_10298204
485 Ga0070717_11939099
486 Ga0075428_101115650
487 Ga0075430_100006271
488 Ga0075430_100162937
489 Ga0075431_100072121
490 Ga0075431_100757659
491 Ga0075429_100023605
492 Ga0097620_100166854
493 Ga0097620_100754672
494 Ga0105240_10049867
495 Ga0105240_10437184
496 Ga0105240_11846383
497 Ga0105245_10010315
498 Ga0105245_10052325
499 Ga0105247_10972561
500 Ga0105247_11119328
501 Ga0114129_10232722
502 Ga0114129_11195711
503 Ga0105243_10424578
504 Ga0105243_11661017
505 Ga0105242_10988252
506 Ga0105242_12252983
507 Ga0105242_12677286
508 Ga0105237_10195085
509 Ga0105238_10033749
510 Ga0105238_12764313
511 Ga0105249_10001947
512 Ga0105249_10238938
513 Ga0105249_12682118
514 Ga0105239_10553266
515 Ga0105239_10807747
516 Ga0105239_11739492
517 Ga0157335_1039011
518 Ga0157316_1007907
519 Ga0157371_10305279
520 Ga0157370_10236007
521 Ga0157369_10199656
522 Ga0157369_11623952
523 Ga0157369_12227646
524 Ga0157374_12435204
525 Ga0157378_12513859
526 Ga0163162_10195338
527 Ga0157372_10774736
528 Ga0157372_10810243
529 Ga0157372_12606231
530 Ga0157380_10296492
531 Ga0157380_11544876
532 Ga0157380_12699217
533 Ga0182008_10164241
534 Ga0157377_10329995
535 Ga0157377_11133495
536 Ga0157376_12381382
537 Ga0163161_10020184
538 Ga0163161_11016500
539 Ga0163161_12101010
540 Ga0197907_10363273
541 Ga0197907_10438105
542 Ga0197907_10912341
543 Ga0206356_10884603
544 Ga0206355_1032230
545 Ga0206355_1359819
546 Ga0206355_1495325
547 Ga0206351_10007671
548 Ga0206352_10674016
549 Ga0206352_10746788
550 Ga0206352_10919818
551 Ga0206350_11440425
552 Ga0206354_10658999
553 Ga0206353_10671731
554 Ga0154015_1037672
555 Ga0154015_1230873
556 Ga0213876_10502035
557 Ga0224712_10157784
558 Ga0224712_10163932
559 Ga0224712_10268419
560 Ga0224712_10275073
561 Ga0224712_10278071
562 Ga0224712_10356904
563 Ga0207692_11200659
564 Ga0207688_10242527
565 Ga0207705_10288826
566 Ga0207707_10006730
567 Ga0207671_10189903
568 Ga0207693_10505981
569 Ga0207660_10265305
570 Ga0207662_10150392
571 Ga0207657_10064033
572 Ga0207657_10195420
573 Ga0207652_10037495
574 Ga0207652_10243086
575 Ga0207694_10277795
576 Ga0207650_11729361
577 Ga0207687_10038798
578 Ga0207687_10582666
579 Ga0207700_10227942
580 Ga0207700_10383421
581 Ga0207664_10002520
582 Ga0207664_10071031
583 Ga0207664_11763115
584 Ga0207690_10660528
585 Ga0207706_10003622
586 Ga0207706_10305266
587 Ga0207706_11468596
588 Ga0207709_10256119
589 Ga0207709_11533234
590 Ga0207689_10124441
591 Ga0207661_10002136
592 Ga0207667_10497381
593 Ga0207712_10151998
594 Ga0207712_10316236
595 Ga0207668_10855767
596 Ga0207640_10180292
597 Ga0207640_10786617
598 Ga0207677_10240361
599 Ga0207639_10616493
600 Ga0207678_10402259
601 Ga0207708_10025481
602 Ga0207708_10808627
603 Ga0207708_11140857
604 Ga0207702_10230853
605 Ga0207702_10718058
606 Ga0207702_12436282
607 Ga0207641_11690118
608 Ga0207648_12159514
609 Ga0207676_11806008
610 Ga0207674_10114097
611 Ga0207675_100017632
612 Ga0207675_100105489
613 Ga0207675_100365486
614 Ga0207675_102178688
615 Ga0209998_10188465
616 Ga0207428_10615873
617 Ga0268265_12034876
618 Ga0265766_1006742
619 Ga0307408_100273698
620 Ga0307408_100402114
621 Ga0307408_100504832
622 Ga0307408_101692903
623 Ga0307408_101709467
624 Ga0307405_10026669
625 Ga0307405_10224677
626 Ga0307405_10227626
627 Ga0307405_11884068
628 Ga0307413_10208751
629 Ga0307410_10058647
630 Ga0307410_10978834
631 Ga0307406_10022114
632 Ga0307406_11039887
633 Ga0307406_11641442
634 Ga0307406_11682307
635 Ga0307407_10205915
636 Ga0307407_10243928
637 Ga0307407_10651325
638 Ga0307407_11450240
639 Ga0307412_10110219
640 Ga0307409_100003689
641 Ga0307409_100112652
642 Ga0307409_100209445
643 Ga0307409_100455961
644 Ga0307409_100744529
645 Ga0307409_100871829
646 Ga0307409_100889576
647 Ga0307416_100073552
648 Ga0307416_100198089
649 Ga0307416_100300072
650 Ga0307416_100346899
651 Ga0307416_101116437
652 Ga0307416_102972926
653 Ga0307414_10637523
654 Ga0307411_10080428
655 Ga0307415_100032369
656 Ga0307415_100188306
657 Ga0307415_100692703
658 Ga0307415_100888535
659 Ga0307415_100994991
660 Ga0307415_101114829
661 Ga0373945_0085680
662 Ga0373943_0280388
663 Ga0373943_0995007
664 Ga0373947_0161258
665 Ga0373937_0625267
666 Ga0373925_0192457
667 Ga0373925_0288397
668 Ga0395898_0364498
669 Ga0395898_1388028
670 Ga0436364_0374849
671 Ga0395901_0100576
672 Ga0436365_0503174
673 Ga0436365_1114241
674 Ga0436365_1312538
675 Ga0436365_1685731
676 Ga0436365_1772586
677 Ga0436360_0355654
678 Ga0436361_0456292
679 Ga0436363_0939426
680 Ga0436363_1481315
681 Ga0436362_0611355
682 Ga0451847_0593125
683 Ga0451853_2227801
684 Ga0451853_4016279
685 Ga0439448_0265856
686 Ga0439444_0201689
687 Ga0466965_0305929
688 Ga0466966_0054774
689 Ga0466961_0644922
690 Ga0466963_0015205
691 Ga0466963_0295528
692 Ga0466971_0193593
693 Ga0466968_0041929
694 Ga0466968_0391048
695 Ga0466968_0462267
696 Ga0466957_0129518
697 Ga0466960_0021703
698 Ga0466960_0538343
699 Ga0466960_0630201
700 Ga0466959_0080369
701 Ga0466959_0345870
702 Ga0466959_0874614
703 Ga0466958_0005965
704 Ga0466967_0019264
705 Ga0466967_0078691
706 Ga0466967_0968028
707 Ga0466967_1040879
708 Ga0466967_2100373
709 Ga0495641_0408185
710 Ga0495580_0439750
711 Ga0495582_0148228
712 Ga0495584_0082127
713 Ga0495584_0362485
714 Ga0495596_0059725
715 Ga0495607_0137912
716 Ga0495616_0184590
717 Ga0495631_0388544
718 Ga0495637_0170234
719 Ga0495637_0170915
720 Ga0495609_0059542
721 Ga0495656_0158595
722 Ga0495656_0232796
723 Ga0495656_0241065
724 Ga0495599_0465963
725 Ga0495658_0497926
726 Ga0495581_0612461
727 Ga0495676_0127551
728 Ga0495676_0156508
729 Ga0495676_0610616
730 Ga0495615_0083226
731 Ga0496100_0417684
732 Ga0496101_0188208
733 Ga0496101_0315090
734 Ga0496101_0395121
735 Ga0496102_0090728
736 Ga0496104_0050464
737 Ga0496104_0531198
738 Ga0496105_0071187
739 Ga0496105_0110443
740 Ga0496105_0808359
741 Ga0496106_0348018
742 Ga0496107_0175676
743 Ga0496108_0269704
744 Ga0496108_0507131
745 Ga0496108_0559052
746 Ga0496109_0001964
747 Ga0496109_0085767
748 Ga0496109_0686479
749 Ga0496109_1896853
750 Ga0496110_0004233
751 Ga0496110_0707892
752 Ga0496111_0005273
753 Ga0496111_0681974
754 Ga0496112_0760588
755 Ga0496112_1035589
756 Ga0496113_0003306
757 Ga0496113_0108962
758 Ga0496115_0921776
759 Ga0496126_0006038
760 Ga0496126_0095246
761 Ga0501031_0106683
762 Ga0501031_0363867
763 Ga0501031_1096410
764 Ga0501032_0402147
765 Ga0501033_0025031
766 Ga0501036_0072718
767 Ga0501037_0031121
768 Ga0501038_0012983
769 Ga0501038_1101677
770 Ga0501039_0079984
771 Ga0501040_1167073
772 Ga0501040_1424649
773 Ga0501042_0107058
774 Ga0501042_0142269
775 Ga0501043_0064070
776 Ga0501046_0010594
777 Ga0501046_1167304
778 Ga0501047_0817238
779 Ga0501048_0218556
780 Ga0501067_0377424
781 Ga0501068_0048013
782 Ga0501068_0460831
783 Ga0501069_0032882
784 Ga0501070_0131430
785 Ga0501071_0070896
786 Ga0501072_0528753
787 Ga0501073_0042803
788 Ga0501074_0038416
789 Ga0501074_0252374
790 Ga0501079_0226358
791 Ga0501079_0367819
792 Ga0501079_0661493
793 Ga0501080_0030979
794 Ga0501080_0037404
795 Ga0501083_0017844
796 Ga0501035_0030971
797 Ga0501035_0291693
798 Ga0501044_0447087
799 Ga0501045_0293834
800 nmdc:mga05p37_1995454_c1
801 nmdc:mga05p37_9388_c1
802 nmdc:mga09592_41633_c1
803 nmdc:mga0qj67_11533_c1
804 nmdc:mga0qj67_38415_c1
805 nmdc:mga0qj67_646449_c1
806 nmdc:mga0qj67_9219_c1
807 nmdc:mga06r32_557804_c1
808 nmdc:mga06r32_68253_c1
809 nmdc:mga08y16_1164533_c1
810 nmdc:mga08y16_683316_c1
811 Ga0495601_0648971
812 Ga0495595_0081996
813 Ga0495619_0061594
814 Ga0495619_0744066
815 Ga0501084_0143732
816 Ga0501082_0004134
817 Ga0501082_0098252
818 Ga0466962_0067574
819 Ga0466962_0072869
820 Ga0466962_0565212

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

80

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9532 20 84
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9322 18 83
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9301 18 83
6ywv-assembly1.cif.gz_R the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa 0.9262 19 81
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9258 20 84
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9532 20 84 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9258 20 84 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8615 29 82 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8467 29 82 2.40.50.100
af_Q4DLT4_19_136_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8464 16 82 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A3D3VUF3-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9718 23 84 GO:0003735
GO:0006412
GO:0022625
AF-A0A2S6T0A6-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9681 20 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-S8C416-F1-model_v4 Ribosomal protein L27 0.9609 21 82 GO:0003735
GO:0005840
GO:0006412
AF-A0A1V5VQS4-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9596 19 81 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1Y1QEJ4-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9587 20 83 GO:0003735
GO:0006412
GO:0022625

Map