F437300

General Info

Members Datasets Scaffolds Average Seq Length
410 167 820 64

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0007010|Ga0316574_0007010_4252_4476
Length 74
Sequence MNQSTETKEMPKMKTNRGAAKRFARTASGSFKRNASHRRHILTKKATKRKRQLRAAHMLHKADVRAALRMMPYC

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
88 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
92 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
95 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
96 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
101 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
102 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
103 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
112 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
113 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
114 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
115 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
116 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
117 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
118 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
119 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
120 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
121 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
122 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
123 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
124 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
125 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
126 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
127 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
128 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
129 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
130 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
164 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
165 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
166 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
167 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.05
Metatranscriptomes 20.98
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 0
Rhizosphere 90.24
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0007010 3300035398 Bacteria 6141
2 Ga0058860_11748053 3300004801 Bacteria 1091
3 Ga0065712_10773720 3300005290 Bacteria 521
4 Ga0065707_10844089 3300005295 Bacteria 584
5 Ga0070676_10477606 3300005328 Bacteria 881
6 Ga0070670_100206667 3300005331 Bacteria 1707
7 Ga0070677_10086059 3300005333 Bacteria 1357
8 Ga0070677_10335263 3300005333 Bacteria 779
9 Ga0070680_100274818 3300005336 Bacteria 1427
10 Ga0068868_101099949 3300005338 Bacteria 731
11 Ga0070691_10965600 3300005341 Bacteria 530
12 Ga0070687_101257270 3300005343 Bacteria 548
13 Ga0070692_10755648 3300005345 Bacteria 660
14 Ga0070668_100093750 3300005347 Bacteria 2370
15 Ga0070669_100148025 3300005353 Bacteria 1815
16 Ga0070669_100161074 3300005353 Bacteria 1743
17 Ga0070669_101592794 3300005353 Bacteria 568
18 Ga0070675_100187173 3300005354 Bacteria 1792
19 Ga0070671_100603385 3300005355 Bacteria 949
20 Ga0070673_100031090 3300005364 Bacteria 4003
21 Ga0070688_101775505 3300005365 Bacteria 506
22 Ga0070667_100161819 3300005367 Bacteria 1972
23 Ga0070713_100344902 3300005436 Bacteria 1381
24 Ga0070705_101247067 3300005440 Bacteria 614
25 Ga0070663_100141209 3300005455 Bacteria 1839
26 Ga0070678_100154431 3300005456 Bacteria 1853
27 Ga0070662_100043142 3300005457 Bacteria 3225
28 Ga0070681_10735242 3300005458 Bacteria 903
29 Ga0068867_100243822 3300005459 Bacteria 1458
30 Ga0068867_100610060 3300005459 Bacteria 953
31 Ga0070672_100163616 3300005543 Bacteria 1847
32 Ga0070672_101605657 3300005543 Bacteria 584
33 Ga0070664_101591873 3300005564 Bacteria 619
34 Ga0068857_101705705 3300005577 Bacteria 616
35 Ga0068859_101625331 3300005617 Bacteria 714
36 Ga0068864_100311075 3300005618 Bacteria 1477
37 Ga0068866_10200164 3300005718 Bacteria 1193
38 Ga0068861_100060213 3300005719 Bacteria 2909
39 Ga0068861_100190969 3300005719 Bacteria 1712
40 Ga0068870_10084884 3300005840 Bacteria 1759
41 Ga0068870_10189574 3300005840 Bacteria 1240
42 Ga0068862_100177379 3300005844 Bacteria 1911
43 Ga0068862_100318383 3300005844 Bacteria 1435
44 Ga0075368_10305962 3300006042 Viruses 686
45 Ga0070715_10878043 3300006163 Unclassified 550
46 Ga0070712_101329008 3300006175 Bacteria 627
47 Ga0075428_100032808 3300006844 Bacteria 5734
48 Ga0075428_100385809 3300006844 Bacteria 1502
49 Ga0075428_100440671 3300006844 Bacteria 1395
50 Ga0075430_100114660 3300006846 Bacteria 2245
51 Ga0075431_100161302 3300006847 Bacteria 2305
52 Ga0075431_100162604 3300006847 Bacteria 2295
53 Ga0075431_100413069 3300006847 Bacteria 1349
54 Ga0075431_100761028 3300006847 Bacteria 943
55 Ga0075429_100586684 3300006880 Bacteria 976
56 Ga0075429_101081697 3300006880 Bacteria 700
57 Ga0075429_101160169 3300006880 Bacteria 674
58 Ga0068865_100097229 3300006881 Bacteria 2149
59 Ga0097620_101625233 3300006931 Bacteria 714
60 Ga0111539_10421836 3300009094 Bacteria 1554
61 Ga0111539_10599199 3300009094 Bacteria 1283
62 Ga0111539_10701996 3300009094 Bacteria 1178
63 Ga0114129_10823367 3300009147 Bacteria 1182
64 Ga0105249_10567795 3300009553 Bacteria 1187
65 Ga0157375_10443534 3300013308 Bacteria 1464
66 Ga0157380_10005050 3300014326 Bacteria 9206
67 Ga0157380_10080125 3300014326 Bacteria 2668
68 Ga0157379_12366603 3300014968 Bacteria 530
69 Ga0163161_10215750 3300017792 Bacteria 1484
70 Ga0163161_10228343 3300017792 Bacteria 1444
71 Ga0207682_10032518 3300025893 Bacteria 2097
72 Ga0207682_10342632 3300025893 Bacteria 704
73 Ga0207642_10142476 3300025899 Bacteria 1265
74 Ga0207645_10033162 3300025907 Bacteria 3319
75 Ga0207645_10153964 3300025907 Bacteria 1502
76 Ga0207643_10081873 3300025908 Bacteria 1871
77 Ga0207643_10370946 3300025908 Bacteria 901
78 Ga0207643_10545975 3300025908 Bacteria 743
79 Ga0207660_10344543 3300025917 Bacteria 1193
80 Ga0207681_10094919 3300025923 Bacteria 2138
81 Ga0207681_10172981 3300025923 Bacteria 1638
82 Ga0207681_11367791 3300025923 Bacteria 594
83 Ga0207650_10694399 3300025925 Bacteria 859
84 Ga0207650_10704132 3300025925 Bacteria 853
85 Ga0207650_11213857 3300025925 Bacteria 642
86 Ga0207659_10027869 3300025926 Bacteria 3831
87 Ga0207664_10000363 3300025929 Bacteria 33182
88 Ga0207664_10008647 3300025929 Bacteria 7118
89 Ga0207644_10156289 3300025931 Bacteria 1769
90 Ga0207706_10114408 3300025933 Bacteria 2373
91 Ga0207706_10124398 3300025933 Bacteria 2269
92 Ga0207669_10343583 3300025937 Bacteria 1150
93 Ga0207704_10116356 3300025938 Bacteria 1819
94 Ga0207691_10047793 3300025940 Bacteria 3925
95 Ga0207691_10101931 3300025940 Bacteria 2561
96 Ga0207679_11587207 3300025945 Bacteria 600
97 Ga0207651_10082530 3300025960 Bacteria 2321
98 Ga0207668_10074069 3300025972 Bacteria 2443
99 Ga0207640_10971927 3300025981 Bacteria 745
100 Ga0207658_10031269 3300025986 Bacteria 3779
101 Ga0207658_11296183 3300025986 Bacteria 666
102 Ga0207678_11631535 3300026067 Bacteria 567
103 Ga0207708_10606208 3300026075 Bacteria 928
104 Ga0207641_12542590 3300026088 Bacteria 510
105 Ga0207648_10037100 3300026089 Bacteria 4293
106 Ga0207648_10424171 3300026089 Bacteria 1208
107 Ga0207676_10594479 3300026095 Bacteria 1062
108 Ga0207675_100029034 3300026118 Bacteria 5153
109 Ga0207675_100086863 3300026118 Bacteria 2937
110 Ga0207683_10147517 3300026121 Bacteria 2122
111 Ga0210000_1012271 3300027462 Bacteria 1272
112 Ga0209982_1002128 3300027552 Bacteria 2756
113 Ga0210002_1002862 3300027617 Bacteria 2519
114 Ga0209971_1021660 3300027682 Bacteria 1529
115 Ga0209813_10131649 3300027866 Viruses 880
116 Ga0209974_10060300 3300027876 Bacteria 1284
117 Ga0207428_10089372 3300027907 Bacteria 2394
118 Ga0268265_10457100 3300028380 Bacteria 1194
119 Ga0268265_10536918 3300028380 Bacteria 1108
120 Ga0268264_10845157 3300028381 Bacteria 916
121 Ga0265328_10442574 3300031239 Bacteria 513
122 Ga0265331_10027399 3300031250 Bacteria 2857
123 Ga0265327_10001175 3300031251 Bacteria 35521
124 Ga0265327_10002249 3300031251 Bacteria 20915
125 Ga0265327_10132753 3300031251 Bacteria 1170
126 Ga0265327_10347597 3300031251 Bacteria 648
127 Ga0265316_10001277 3300031344 Bacteria 27035
128 Ga0265316_10001311 3300031344 Bacteria 26774
129 Ga0316575_10003115 3300031665 Bacteria 5661
130 Ga0316575_10004830 3300031665 Bacteria 4761
131 Ga0316575_10012783 3300031665 Bacteria 3128
132 Ga0316575_10017208 3300031665 Bacteria 2743
133 Ga0316575_10297346 3300031665 Bacteria 682
134 Ga0316575_10507943 3300031665 Bacteria 523
135 Ga0316579_10004030 3300031691 Bacteria 5792
136 Ga0316579_10005892 3300031691 Bacteria 4970
137 Ga0316579_10007747 3300031691 Bacteria 4449
138 Ga0316579_10020133 3300031691 Bacteria 2954
139 Ga0316579_10050953 3300031691 Bacteria 1936
140 Ga0316579_10083337 3300031691 Bacteria 1524
141 Ga0316579_10098381 3300031691 Bacteria 1399
142 Ga0316579_10155800 3300031691 Bacteria 1103
143 Ga0265314_10185138 3300031711 Bacteria 1244
144 Ga0316576_10000397 3300031727 Bacteria 20074
145 Ga0316576_10003844 3300031727 Bacteria 8896
146 Ga0316576_10016757 3300031727 Bacteria 4961
147 Ga0316576_10018336 3300031727 Bacteria 4776
148 Ga0316576_10021503 3300031727 Bacteria 4464
149 Ga0316576_10030613 3300031727 Bacteria 3811
150 Ga0316576_10088103 3300031727 Bacteria 2310
151 Ga0316576_10219516 3300031727 Bacteria 1430
152 Ga0316576_10366708 3300031727 Bacteria 1070
153 Ga0316576_10372148 3300031727 Bacteria 1061
154 Ga0316576_10752477 3300031727 Bacteria 703
155 Ga0316576_11296127 3300031727 Bacteria 513
156 Ga0316578_10000024 3300031728 Bacteria 30182
157 Ga0316578_10000647 3300031728 Bacteria 12325
158 Ga0316578_10001170 3300031728 Bacteria 10350
159 Ga0316578_10002740 3300031728 Bacteria 7835
160 Ga0316578_10007045 3300031728 Bacteria 5601
161 Ga0316578_10017655 3300031728 Bacteria 3888
162 Ga0316578_10018341 3300031728 Bacteria 3833
163 Ga0316578_10020822 3300031728 Bacteria 3630
164 Ga0316578_10032699 3300031728 Bacteria 2974
165 Ga0316578_10051975 3300031728 Bacteria 2400
166 Ga0316578_10181175 3300031728 Bacteria 1269
167 Ga0316578_10190270 3300031728 Bacteria 1236
168 Ga0316578_10196879 3300031728 Bacteria 1213
169 Ga0316578_10314994 3300031728 Bacteria 934
170 Ga0316577_10000473 3300031733 Bacteria 15821
171 Ga0316577_10000931 3300031733 Bacteria 12990
172 Ga0316577_10011233 3300031733 Bacteria 4850
173 Ga0316577_10012862 3300031733 Bacteria 4567
174 Ga0316577_10159009 3300031733 Bacteria 1274
175 Ga0316577_10187675 3300031733 Bacteria 1168
176 Ga0316577_10223874 3300031733 Bacteria 1064
177 Ga0316577_10533486 3300031733 Bacteria 667
178 Ga0307412_11106928 3300031911 Bacteria 705
179 Ga0307411_11391386 3300032005 Unclassified 642
180 Ga0307415_100720992 3300032126 Bacteria 902
181 Ga0316583_10001794 3300032133 Bacteria 7297
182 Ga0316583_10002942 3300032133 Bacteria 5988
183 Ga0316583_10009521 3300032133 Bacteria 3498
184 Ga0316583_10019331 3300032133 Bacteria 2446
185 Ga0316583_10047759 3300032133 Bacteria 1509
186 Ga0316583_10048857 3300032133 Bacteria 1489
187 Ga0316583_10085496 3300032133 Bacteria 1101
188 Ga0316583_10121966 3300032133 Bacteria 908
189 Ga0316583_10139401 3300032133 Bacteria 845
190 Ga0316583_10143746 3300032133 Bacteria 831
191 Ga0316585_10000252 3300032137 Bacteria 11473
192 Ga0316585_10013457 3300032137 Bacteria 2435
193 Ga0316585_10034555 3300032137 Bacteria 1598
194 Ga0316585_10040571 3300032137 Bacteria 1482
195 Ga0316585_10102508 3300032137 Unclassified 939
196 Ga0316580_10000003 3300032139 Bacteria 42954
197 Ga0316580_10000929 3300032139 Bacteria 7242
198 Ga0316580_10001414 3300032139 Bacteria 6255
199 Ga0316580_10001625 3300032139 Bacteria 5949
200 Ga0316580_10002866 3300032139 Bacteria 4818
201 Ga0316580_10015743 3300032139 Bacteria 2314
202 Ga0316580_10019489 3300032139 Bacteria 2088
203 Ga0316593_10000647 3300032168 Bacteria 6681
204 Ga0316593_10001173 3300032168 Bacteria 5590
205 Ga0316593_10001511 3300032168 Bacteria 5155
206 Ga0316593_10002626 3300032168 Bacteria 4306
207 Ga0316593_10002736 3300032168 Bacteria 4252
208 Ga0316593_10002976 3300032168 Bacteria 4123
209 Ga0316593_10004127 3300032168 Bacteria 3691
210 Ga0316593_10004919 3300032168 Bacteria 3477
211 Ga0316593_10013054 3300032168 Bacteria 2452
212 Ga0316593_10017725 3300032168 Bacteria 2176
213 Ga0316593_10022315 3300032168 Bacteria 1988
214 Ga0316593_10030899 3300032168 Bacteria 1742
215 Ga0316593_10036107 3300032168 Bacteria 1628
216 Ga0316593_10037521 3300032168 Bacteria 1601
217 Ga0316593_10053230 3300032168 Bacteria 1371
218 Ga0316593_10054719 3300032168 Bacteria 1355
219 Ga0316593_10055556 3300032168 Bacteria 1346
220 Ga0316593_10073409 3300032168 Bacteria 1186
221 Ga0316593_10098114 3300032168 Bacteria 1037
222 Ga0316593_10121036 3300032168 Bacteria 940
223 Ga0316593_10148711 3300032168 Bacteria 851
224 Ga0316592_1003626 3300033524 Bacteria 2801
225 Ga0316592_1003690 3300033524 Bacteria 2786
226 Ga0316592_1008021 3300033524 Bacteria 2075
227 Ga0316592_1008353 3300033524 Bacteria 2044
228 Ga0316592_1015230 3300033524 Unclassified 1599
229 Ga0316592_1023636 3300033524 Bacteria 1320
230 Ga0316592_1024943 3300033524 Bacteria 1287
231 Ga0316592_1026784 3300033524 Bacteria 1245
232 Ga0316592_1047344 3300033524 Bacteria 958
233 Ga0316592_1048972 3300033524 Bacteria 942
234 Ga0316592_1050157 3300033524 Bacteria 932
235 Ga0316592_1071251 3300033524 Bacteria 786
236 Ga0316586_1001392 3300033527 Bacteria 2756
237 Ga0316586_1001477 3300033527 Bacteria 2708
238 Ga0316586_1001863 3300033527 Bacteria 2532
239 Ga0316586_1011444 3300033527 Bacteria 1359
240 Ga0316586_1018709 3300033527 Bacteria 1126
241 Ga0316586_1046902 3300033527 Bacteria 768
242 Ga0316588_1000994 3300033528 Bacteria 4418
243 Ga0316588_1001270 3300033528 Bacteria 4062
244 Ga0316588_1005453 3300033528 Bacteria 2480
245 Ga0316588_1008379 3300033528 Bacteria 2127
246 Ga0316588_1013509 3300033528 Bacteria 1773
247 Ga0316588_1016815 3300033528 Bacteria 1625
248 Ga0316588_1025493 3300033528 Bacteria 1366
249 Ga0316588_1044248 3300033528 Bacteria 1070
250 Ga0316588_1060725 3300033528 Bacteria 922
251 Ga0316588_1061563 3300033528 Bacteria 916
252 Ga0316587_1001147 3300033529 Bacteria 3143
253 Ga0316587_1005542 3300033529 Bacteria 1897
254 Ga0316587_1006820 3300033529 Bacteria 1757
255 Ga0316587_1010633 3300033529 Bacteria 1474
256 Ga0316587_1012847 3300033529 Bacteria 1366
257 Ga0316587_1026334 3300033529 Bacteria 1013
258 Ga0316587_1026382 3300033529 Bacteria 1012
259 Ga0316587_1029324 3300033529 Bacteria 967
260 Ga0316587_1030581 3300033529 Bacteria 950
261 Ga0316587_1032047 3300033529 Bacteria 931
262 Ga0316587_1034321 3300033529 Bacteria 904
263 Ga0316587_1039589 3300033529 Bacteria 850
264 Ga0316587_1058167 3300033529 Bacteria 714
265 Ga0316587_1069852 3300033529 Bacteria 657
266 Ga0316587_1103684 3300033529 Bacteria 549
267 Ga0316596_1000989 3300033541 Bacteria 5464
268 Ga0316596_1001370 3300033541 Bacteria 4880
269 Ga0316596_1001638 3300033541 Bacteria 4598
270 Ga0316596_1002709 3300033541 Bacteria 3809
271 Ga0316596_1007123 3300033541 Bacteria 2632
272 Ga0316596_1007850 3300033541 Bacteria 2529
273 Ga0316596_1009890 3300033541 Bacteria 2296
274 Ga0316596_1022526 3300033541 Bacteria 1610
275 Ga0316596_1023188 3300033541 Bacteria 1589
276 Ga0316596_1034826 3300033541 Bacteria 1315
277 Ga0316596_1035767 3300033541 Bacteria 1298
278 Ga0316596_1045395 3300033541 Bacteria 1159
279 Ga0316596_1052015 3300033541 Bacteria 1085
280 Ga0316596_1053987 3300033541 Bacteria 1066
281 Ga0316596_1060731 3300033541 Bacteria 1008
282 Ga0316596_1077041 3300033541 Bacteria 895
283 Ga0316596_1100385 3300033541 Bacteria 783
284 Ga0316596_1114226 3300033541 Bacteria 733
285 Ga0316596_1140037 3300033541 Bacteria 662
286 Ga0316596_1169052 3300033541 Unclassified 603
287 Ga0373946_0336227 3300035171 Bacteria 753
288 Ga0316574_0000040 3300035398 Bacteria 31335
289 Ga0316574_0010079 3300035398 Bacteria 5320
290 Ga0316574_0010414 3300035398 Bacteria 5254
291 Ga0316574_0035891 3300035398 Bacteria 3032
292 Ga0316574_0054632 3300035398 Bacteria 2494
293 Ga0316574_0080480 3300035398 Bacteria 2067
294 Ga0316574_0165521 3300035398 Bacteria 1424
295 Ga0316574_0282622 3300035398 Bacteria 1057
296 Ga0316574_0471375 3300035398 Bacteria 785
297 Ga0373927_0000003 3300035695 Bacteria 480348
298 Ga0316582_0001577 3300036647 Bacteria 10153
299 Ga0316582_0006448 3300036647 Bacteria 6161
300 Ga0316582_0015941 3300036647 Bacteria 4311
301 Ga0316582_0025453 3300036647 Bacteria 3553
302 Ga0316582_0039607 3300036647 Bacteria 2935
303 Ga0316582_0055106 3300036647 Bacteria 2533
304 Ga0316582_0110529 3300036647 Bacteria 1829
305 Ga0316582_0226315 3300036647 Bacteria 1280
306 Ga0316582_0271205 3300036647 Bacteria 1164
307 Ga0316582_0600702 3300036647 Bacteria 757
308 Ga0316582_0870555 3300036647 Unclassified 616
309 Ga0316584_0000899 3300036712 Bacteria 16931
310 Ga0316584_0009673 3300036712 Bacteria 6703
311 Ga0316584_0011473 3300036712 Bacteria 6226
312 Ga0316584_0031162 3300036712 Bacteria 3942
313 Ga0316584_0034802 3300036712 Bacteria 3735
314 Ga0316584_0064225 3300036712 Bacteria 2749
315 Ga0316584_0070840 3300036712 Unclassified 2612
316 Ga0316584_0092947 3300036712 Bacteria 2258
317 Ga0316584_0111763 3300036712 Bacteria 2044
318 Ga0316584_0325406 3300036712 Bacteria 1108
319 Ga0316584_0336249 3300036712 Bacteria 1086
320 Ga0316584_0371102 3300036712 Bacteria 1024
321 Ga0316584_0451419 3300036712 Bacteria 909
322 Ga0316581_0038611 3300037588 Bacteria 1452
323 Ga0316581_0083501 3300037588 Bacteria 983
324 Ga0400484_26699 3300038725 Bacteria 28337
325 Ga0400484_42172 3300038725 Bacteria 8041
326 Ga0400490_02918 3300038726 Bacteria 27177
327 Ga0400490_06488 3300038726 Bacteria 5318
328 Ga0400490_57442 3300038726 Bacteria 9890
329 Ga0400491_28226 3300038727 Bacteria 2905
330 Ga0400485_03086 3300038735 Bacteria 2192
331 Ga0400485_10975 3300038735 Bacteria 6517
332 Ga0400485_22349 3300038735 Bacteria 174815
333 Ga0400488_02729 3300038741 Bacteria 26775
334 Ga0400488_09211 3300038741 Bacteria 2595
335 Ga0400488_14279 3300038741 Bacteria 13772
336 Ga0400488_39077 3300038741 Bacteria 3117
337 Ga0400486_10036 3300038742 Bacteria 65877
338 Ga0400486_21088 3300038742 Bacteria 7206
339 Ga0400483_031139 3300039062 Bacteria 8639
340 Ga0400483_092050 3300039062 Bacteria 1824
341 Ga0400483_097540 3300039062 Bacteria 10318
342 Ga0400483_185560 3300039062 Bacteria 9527
343 Ga0400483_244033 3300039062 Bacteria 20829
344 Ga0400483_276512 3300039062 Bacteria 10018
345 Ga0400489_39378 3300039093 Bacteria 2615
346 Ga0400487_03936 3300039110 Bacteria 51706
347 Ga0400487_25360 3300039110 Bacteria 2223
348 Ga0400487_51847 3300039110 Bacteria 54060
349 Ga0400487_61156 3300039110 Bacteria 1638
350 Ga0439453_0111550 3300041408 Bacteria 619
351 Ga0439443_018516 3300042003 Bacteria 1079
352 Ga0450923_112931 3300042125 Bacteria 635
353 Ga0450896_040143 3300042133 Bacteria 727
354 Ga0450898_011424 3300042134 Bacteria 1453
355 Ga0450905_015901 3300042142 Bacteria 1082
356 Ga0439446_0167329 3300042156 Bacteria 730
357 Ga0439460_0151656 3300042461 Bacteria 773
358 Ga0451577_0000083 3300042876 Bacteria 213999
359 Ga0451577_1071959 3300042876 Bacteria 722
360 Ga0453684_0068460 3300044712 Bacteria 4507
361 Ga0495621_0227190 3300046539 Bacteria 757
362 Ga0496117_0310424 3300048920 Bacteria 831
363 Ga0496121_0177126 3300048924 Bacteria 1543
364 Ga0496122_0511569 3300048925 Bacteria 581
365 Ga0496126_0010176 3300048929 Bacteria 9898
366 Ga0496126_0063141 3300048929 Bacteria 3321
367 Ga0501034_0099526 3300049571 Bacteria 2902
368 Ga0501036_0171484 3300049572 Bacteria 1828
369 Ga0501038_1328509 3300049574 Bacteria 518
370 Ga0501039_0081757 3300049575 Bacteria 2515
371 Ga0501040_0045200 3300049576 Bacteria 3003
372 Ga0501042_0463539 3300049578 Bacteria 919
373 Ga0501043_1275626 3300049579 Bacteria 513
374 Ga0501048_0229741 3300049582 Bacteria 1316
375 Ga0501069_0032544 3300049585 Bacteria 2870
376 Ga0501069_0284845 3300049585 Bacteria 967
377 Ga0501070_0016037 3300049586 Bacteria 6296
378 Ga0501070_0081692 3300049586 Bacteria 2674
379 Ga0501070_0652986 3300049586 Bacteria 835
380 Ga0501074_0013474 3300049590 Bacteria 5946
381 Ga0501076_0502565 3300049592 Bacteria 999
382 Ga0501077_0735473 3300049593 Bacteria 634
383 Ga0501080_0566349 3300049742 Bacteria 1011
384 Ga0501080_0798407 3300049742 Bacteria 828
385 Ga0501080_1373251 3300049742 Bacteria 603
386 Ga0501080_1641244 3300049742 Bacteria 544
387 Ga0501081_0981631 3300049743 Bacteria 638
388 Ga0501081_1443968 3300049743 Bacteria 522
389 Ga0501045_0273954 3300049824 Bacteria 1256
390 nmdc:mga06z11_772476_c1 3300050494 Bacteria 585
391 nmdc:mga04h51_151111_c1 3300050495 Viruses 887
392 nmdc:mga05p37_199915_c1 3300050507 Bacteria 2421
393 nmdc:mga09592_1161718_c1 3300050508 Bacteria 639
394 nmdc:mga09592_44131_c1 3300050508 Bacteria 3752
395 nmdc:mga0qj67_71575_c1 3300050509 Bacteria 2768
396 nmdc:mga06r32_158572_c1 3300050510 Bacteria 2245
397 nmdc:mga06r32_298684_c1 3300050510 Bacteria 1597
398 nmdc:mga06r32_495435_c1 3300050510 Bacteria 1199
399 nmdc:mga06r32_551191_c1 3300050510 Bacteria 1127
400 nmdc:mga08y16_1389653_c1 3300050511 Bacteria 666
401 nmdc:mga08y16_1731060_c1 3300050511 Bacteria 580
402 nmdc:mga08y16_397213_c1 3300050511 Bacteria 1412
403 nmdc:mga08y16_669512_c1 3300050511 Bacteria 1040
404 Ga0501084_0156148 3300054114 Bacteria 1924
405 Ga0587092_074520 3300059512 Bacteria 659
406 Ga0530510_1226881 3300061734 Bacteria 575
407 2691331942 2690315857 Bacteria 4396207
408 2919536612 2919534386 Bacteria 4577686
409 2989393177 2989392574 Bacteria 4554005
410 8001526085 8001522603 Bacteria 4726425
411 Ga0316574_0007010
412 Ga0058860_11748053
413 Ga0065712_10773720
414 Ga0065707_10844089
415 Ga0070676_10477606
416 Ga0070670_100206667
417 Ga0070677_10086059
418 Ga0070677_10335263
419 Ga0070680_100274818
420 Ga0068868_101099949
421 Ga0070691_10965600
422 Ga0070687_101257270
423 Ga0070692_10755648
424 Ga0070668_100093750
425 Ga0070669_100148025
426 Ga0070669_100161074
427 Ga0070669_101592794
428 Ga0070675_100187173
429 Ga0070671_100603385
430 Ga0070673_100031090
431 Ga0070688_101775505
432 Ga0070667_100161819
433 Ga0070713_100344902
434 Ga0070705_101247067
435 Ga0070663_100141209
436 Ga0070678_100154431
437 Ga0070662_100043142
438 Ga0070681_10735242
439 Ga0068867_100243822
440 Ga0068867_100610060
441 Ga0070672_100163616
442 Ga0070672_101605657
443 Ga0070664_101591873
444 Ga0068857_101705705
445 Ga0068859_101625331
446 Ga0068864_100311075
447 Ga0068866_10200164
448 Ga0068861_100060213
449 Ga0068861_100190969
450 Ga0068870_10084884
451 Ga0068870_10189574
452 Ga0068862_100177379
453 Ga0068862_100318383
454 Ga0075368_10305962
455 Ga0070715_10878043
456 Ga0070712_101329008
457 Ga0075428_100032808
458 Ga0075428_100385809
459 Ga0075428_100440671
460 Ga0075430_100114660
461 Ga0075431_100161302
462 Ga0075431_100162604
463 Ga0075431_100413069
464 Ga0075431_100761028
465 Ga0075429_100586684
466 Ga0075429_101081697
467 Ga0075429_101160169
468 Ga0068865_100097229
469 Ga0097620_101625233
470 Ga0111539_10421836
471 Ga0111539_10599199
472 Ga0111539_10701996
473 Ga0114129_10823367
474 Ga0105249_10567795
475 Ga0157375_10443534
476 Ga0157380_10005050
477 Ga0157380_10080125
478 Ga0157379_12366603
479 Ga0163161_10215750
480 Ga0163161_10228343
481 Ga0207682_10032518
482 Ga0207682_10342632
483 Ga0207642_10142476
484 Ga0207645_10033162
485 Ga0207645_10153964
486 Ga0207643_10081873
487 Ga0207643_10370946
488 Ga0207643_10545975
489 Ga0207660_10344543
490 Ga0207681_10094919
491 Ga0207681_10172981
492 Ga0207681_11367791
493 Ga0207650_10694399
494 Ga0207650_10704132
495 Ga0207650_11213857
496 Ga0207659_10027869
497 Ga0207664_10000363
498 Ga0207664_10008647
499 Ga0207644_10156289
500 Ga0207706_10114408
501 Ga0207706_10124398
502 Ga0207669_10343583
503 Ga0207704_10116356
504 Ga0207691_10047793
505 Ga0207691_10101931
506 Ga0207679_11587207
507 Ga0207651_10082530
508 Ga0207668_10074069
509 Ga0207640_10971927
510 Ga0207658_10031269
511 Ga0207658_11296183
512 Ga0207678_11631535
513 Ga0207708_10606208
514 Ga0207641_12542590
515 Ga0207648_10037100
516 Ga0207648_10424171
517 Ga0207676_10594479
518 Ga0207675_100029034
519 Ga0207675_100086863
520 Ga0207683_10147517
521 Ga0210000_1012271
522 Ga0209982_1002128
523 Ga0210002_1002862
524 Ga0209971_1021660
525 Ga0209813_10131649
526 Ga0209974_10060300
527 Ga0207428_10089372
528 Ga0268265_10457100
529 Ga0268265_10536918
530 Ga0268264_10845157
531 Ga0265328_10442574
532 Ga0265331_10027399
533 Ga0265327_10001175
534 Ga0265327_10002249
535 Ga0265327_10132753
536 Ga0265327_10347597
537 Ga0265316_10001277
538 Ga0265316_10001311
539 Ga0316575_10003115
540 Ga0316575_10004830
541 Ga0316575_10012783
542 Ga0316575_10017208
543 Ga0316575_10297346
544 Ga0316575_10507943
545 Ga0316579_10004030
546 Ga0316579_10005892
547 Ga0316579_10007747
548 Ga0316579_10020133
549 Ga0316579_10050953
550 Ga0316579_10083337
551 Ga0316579_10098381
552 Ga0316579_10155800
553 Ga0265314_10185138
554 Ga0316576_10000397
555 Ga0316576_10003844
556 Ga0316576_10016757
557 Ga0316576_10018336
558 Ga0316576_10021503
559 Ga0316576_10030613
560 Ga0316576_10088103
561 Ga0316576_10219516
562 Ga0316576_10366708
563 Ga0316576_10372148
564 Ga0316576_10752477
565 Ga0316576_11296127
566 Ga0316578_10000024
567 Ga0316578_10000647
568 Ga0316578_10001170
569 Ga0316578_10002740
570 Ga0316578_10007045
571 Ga0316578_10017655
572 Ga0316578_10018341
573 Ga0316578_10020822
574 Ga0316578_10032699
575 Ga0316578_10051975
576 Ga0316578_10181175
577 Ga0316578_10190270
578 Ga0316578_10196879
579 Ga0316578_10314994
580 Ga0316577_10000473
581 Ga0316577_10000931
582 Ga0316577_10011233
583 Ga0316577_10012862
584 Ga0316577_10159009
585 Ga0316577_10187675
586 Ga0316577_10223874
587 Ga0316577_10533486
588 Ga0307412_11106928
589 Ga0307411_11391386
590 Ga0307415_100720992
591 Ga0316583_10001794
592 Ga0316583_10002942
593 Ga0316583_10009521
594 Ga0316583_10019331
595 Ga0316583_10047759
596 Ga0316583_10048857
597 Ga0316583_10085496
598 Ga0316583_10121966
599 Ga0316583_10139401
600 Ga0316583_10143746
601 Ga0316585_10000252
602 Ga0316585_10013457
603 Ga0316585_10034555
604 Ga0316585_10040571
605 Ga0316585_10102508
606 Ga0316580_10000003
607 Ga0316580_10000929
608 Ga0316580_10001414
609 Ga0316580_10001625
610 Ga0316580_10002866
611 Ga0316580_10015743
612 Ga0316580_10019489
613 Ga0316593_10000647
614 Ga0316593_10001173
615 Ga0316593_10001511
616 Ga0316593_10002626
617 Ga0316593_10002736
618 Ga0316593_10002976
619 Ga0316593_10004127
620 Ga0316593_10004919
621 Ga0316593_10013054
622 Ga0316593_10017725
623 Ga0316593_10022315
624 Ga0316593_10030899
625 Ga0316593_10036107
626 Ga0316593_10037521
627 Ga0316593_10053230
628 Ga0316593_10054719
629 Ga0316593_10055556
630 Ga0316593_10073409
631 Ga0316593_10098114
632 Ga0316593_10121036
633 Ga0316593_10148711
634 Ga0316592_1003626
635 Ga0316592_1003690
636 Ga0316592_1008021
637 Ga0316592_1008353
638 Ga0316592_1015230
639 Ga0316592_1023636
640 Ga0316592_1024943
641 Ga0316592_1026784
642 Ga0316592_1047344
643 Ga0316592_1048972
644 Ga0316592_1050157
645 Ga0316592_1071251
646 Ga0316586_1001392
647 Ga0316586_1001477
648 Ga0316586_1001863
649 Ga0316586_1011444
650 Ga0316586_1018709
651 Ga0316586_1046902
652 Ga0316588_1000994
653 Ga0316588_1001270
654 Ga0316588_1005453
655 Ga0316588_1008379
656 Ga0316588_1013509
657 Ga0316588_1016815
658 Ga0316588_1025493
659 Ga0316588_1044248
660 Ga0316588_1060725
661 Ga0316588_1061563
662 Ga0316587_1001147
663 Ga0316587_1005542
664 Ga0316587_1006820
665 Ga0316587_1010633
666 Ga0316587_1012847
667 Ga0316587_1026334
668 Ga0316587_1026382
669 Ga0316587_1029324
670 Ga0316587_1030581
671 Ga0316587_1032047
672 Ga0316587_1034321
673 Ga0316587_1039589
674 Ga0316587_1058167
675 Ga0316587_1069852
676 Ga0316587_1103684
677 Ga0316596_1000989
678 Ga0316596_1001370
679 Ga0316596_1001638
680 Ga0316596_1002709
681 Ga0316596_1007123
682 Ga0316596_1007850
683 Ga0316596_1009890
684 Ga0316596_1022526
685 Ga0316596_1023188
686 Ga0316596_1034826
687 Ga0316596_1035767
688 Ga0316596_1045395
689 Ga0316596_1052015
690 Ga0316596_1053987
691 Ga0316596_1060731
692 Ga0316596_1077041
693 Ga0316596_1100385
694 Ga0316596_1114226
695 Ga0316596_1140037
696 Ga0316596_1169052
697 Ga0373946_0336227
698 Ga0316574_0000040
699 Ga0316574_0010079
700 Ga0316574_0010414
701 Ga0316574_0035891
702 Ga0316574_0054632
703 Ga0316574_0080480
704 Ga0316574_0165521
705 Ga0316574_0282622
706 Ga0316574_0471375
707 Ga0373927_0000003
708 Ga0316582_0001577
709 Ga0316582_0006448
710 Ga0316582_0015941
711 Ga0316582_0025453
712 Ga0316582_0039607
713 Ga0316582_0055106
714 Ga0316582_0110529
715 Ga0316582_0226315
716 Ga0316582_0271205
717 Ga0316582_0600702
718 Ga0316582_0870555
719 Ga0316584_0000899
720 Ga0316584_0009673
721 Ga0316584_0011473
722 Ga0316584_0031162
723 Ga0316584_0034802
724 Ga0316584_0064225
725 Ga0316584_0070840
726 Ga0316584_0092947
727 Ga0316584_0111763
728 Ga0316584_0325406
729 Ga0316584_0336249
730 Ga0316584_0371102
731 Ga0316584_0451419
732 Ga0316581_0038611
733 Ga0316581_0083501
734 Ga0400484_26699
735 Ga0400484_42172
736 Ga0400490_02918
737 Ga0400490_06488
738 Ga0400490_57442
739 Ga0400491_28226
740 Ga0400485_03086
741 Ga0400485_10975
742 Ga0400485_22349
743 Ga0400488_02729
744 Ga0400488_09211
745 Ga0400488_14279
746 Ga0400488_39077
747 Ga0400486_10036
748 Ga0400486_21088
749 Ga0400483_031139
750 Ga0400483_092050
751 Ga0400483_097540
752 Ga0400483_185560
753 Ga0400483_244033
754 Ga0400483_276512
755 Ga0400489_39378
756 Ga0400487_03936
757 Ga0400487_25360
758 Ga0400487_51847
759 Ga0400487_61156
760 Ga0439453_0111550
761 Ga0439443_018516
762 Ga0450923_112931
763 Ga0450896_040143
764 Ga0450898_011424
765 Ga0450905_015901
766 Ga0439446_0167329
767 Ga0439460_0151656
768 Ga0451577_0000083
769 Ga0451577_1071959
770 Ga0453684_0068460
771 Ga0495621_0227190
772 Ga0496117_0310424
773 Ga0496121_0177126
774 Ga0496122_0511569
775 Ga0496126_0010176
776 Ga0496126_0063141
777 Ga0501034_0099526
778 Ga0501036_0171484
779 Ga0501038_1328509
780 Ga0501039_0081757
781 Ga0501040_0045200
782 Ga0501042_0463539
783 Ga0501043_1275626
784 Ga0501048_0229741
785 Ga0501069_0032544
786 Ga0501069_0284845
787 Ga0501070_0016037
788 Ga0501070_0081692
789 Ga0501070_0652986
790 Ga0501074_0013474
791 Ga0501076_0502565
792 Ga0501077_0735473
793 Ga0501080_0566349
794 Ga0501080_0798407
795 Ga0501080_1373251
796 Ga0501080_1641244
797 Ga0501081_0981631
798 Ga0501081_1443968
799 Ga0501045_0273954
800 nmdc:mga06z11_772476_c1
801 nmdc:mga04h51_151111_c1
802 nmdc:mga05p37_199915_c1
803 nmdc:mga09592_1161718_c1
804 nmdc:mga09592_44131_c1
805 nmdc:mga0qj67_71575_c1
806 nmdc:mga06r32_158572_c1
807 nmdc:mga06r32_298684_c1
808 nmdc:mga06r32_495435_c1
809 nmdc:mga06r32_551191_c1
810 nmdc:mga08y16_1389653_c1
811 nmdc:mga08y16_1731060_c1
812 nmdc:mga08y16_397213_c1
813 nmdc:mga08y16_669512_c1
814 Ga0501084_0156148
815 Ga0587092_074520
816 Ga0530510_1226881
817 2691331942
818 2919536612
819 2989393177
820 8001526085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01632

Ribosomal_L35p

Ribosomal protein L35

11

71

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4z-assembly1.cif.gz_2 a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.616 3 64
7uvy-assembly1.cif.gz_2 a. baumannii ribosome-streptothricin-d complex: 70s with p-site trna 0.614 3 64
5mrc-assembly1.cif.gz_Z structure of the yeast mitochondrial ribosome - class a 0.613 4 64
7uvv-assembly1.cif.gz_2 a. baumannii ribosome-streptothricin-f complex: 70s with p-site trna 0.6109 3 64
8fn2-assembly1.cif.gz_g the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.5999 3 64
ID Description Score Start End Superfamily
1vw4Z00 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.6221 4 64 4.10.410.60
1vw4Z00 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.6048 4 64 4.10.410.60
3d5b800 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.5512 2 63 4.10.410.60
3d5b800 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.5384 2 63 4.10.410.60
af_Q4DD98_234_302_3.30.210.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 3;DNA polymerase, thumb domain 0.5356 9 62 3.30.210.10
ID Description Score Start End GO Terms
AF-A0A2H5U238-F1-model_v4 deleted 0.6353 1 64
AF-A0A351MQZ3-F1-model_v4 Large ribosomal subunit protein bL35 0.6324 5 64 GO:0003735
GO:0006412
GO:0015934
AF-A0A4T0H0N4-F1-model_v4 Uncharacterized protein 0.6311 4 64 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2H5U238-F1-model_v4 deleted 0.6273 1 64
AF-A0A1E3NHZ8-F1-model_v4 50S ribosomal protein L35 0.6266 4 64 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map