F437214

General Info

Members Datasets Scaffolds Average Seq Length
410 189 820 187

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100184680|Ga0075434_1001846803
Length 205
Sequence VPEAGPERCRRVFLVVKLMTEYFLENFIEDLDRITRTEASQEKIIAAAKPLLERLVRQPHCLDAKYKKRGMTAYGRYMLHRAPRFNISSVVWGPGDSAKAHNHDTWGMVGVIDNEIQETRFRRKDDGSRSDHADLETIAVLRNQAGMVSCLISPNDDIHEMNNITSRDTVEIHVYGKDLTDMPRLRFDVANKTVKTFASPKYDNC

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
131 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
132 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
166 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
167 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
168 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
169 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.95
Rhizosphere 97.8
Stem 0
Stem Tuber 0
Unclassified 29.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100184680 3300006871 Unclassified 2106
2 Ga0058859_11755672 3300004798 Bacteria 1443
3 Ga0065714_10167580 3300005288 Unclassified 1020
4 Ga0065712_10000675 3300005290 Bacteria 10178
5 Ga0065712_10014523 3300005290 Bacteria 1866
6 Ga0065715_10110000 3300005293 Bacteria 2642
7 Ga0065715_10231267 3300005293 Unclassified 1233
8 Ga0065707_10090744 3300005295 Unclassified 4075
9 Ga0065707_10096911 3300005295 Unclassified 3222
10 Ga0070676_10022631 3300005328 Bacteria 3526
11 Ga0070690_100177491 3300005330 Bacteria 1470
12 Ga0070690_100289663 3300005330 Unclassified 1171
13 Ga0070670_100001766 3300005331 Bacteria 17595
14 Ga0070680_100176708 3300005336 Unclassified 1797
15 Ga0070680_100235346 3300005336 Bacteria 1547
16 Ga0070682_100761458 3300005337 Unclassified 783
17 Ga0070660_100076123 3300005339 Unclassified 2628
18 Ga0070689_100080436 3300005340 Unclassified 2557
19 Ga0070691_10084785 3300005341 Unclassified 1556
20 Ga0070668_100128321 3300005347 Bacteria 2033
21 Ga0070675_100077190 3300005354 Bacteria 2772
22 Ga0070671_100179458 3300005355 Unclassified 1792
23 Ga0070673_100488901 3300005364 Bacteria 1112
24 Ga0070673_101313812 3300005364 Unclassified 679
25 Ga0070659_100529380 3300005366 Bacteria 1007
26 Ga0070711_100113337 3300005439 Bacteria 1994
27 Ga0070705_100112826 3300005440 Bacteria 1740
28 Ga0070705_100543666 3300005440 Unclassified 889
29 Ga0070694_100060938 3300005444 Bacteria 2574
30 Ga0070694_100162002 3300005444 Bacteria 1642
31 Ga0070694_100512472 3300005444 Unclassified 956
32 Ga0070708_100019632 3300005445 Bacteria 5683
33 Ga0070708_100032633 3300005445 Bacteria 4519
34 Ga0070708_100061118 3300005445 Bacteria 3364
35 Ga0070708_100756853 3300005445 Bacteria 913
36 Ga0070678_100063131 3300005456 Bacteria 2739
37 Ga0070662_100090725 3300005457 Bacteria 2294
38 Ga0070662_100328449 3300005457 Unclassified 1249
39 Ga0070681_10065051 3300005458 Bacteria 3616
40 Ga0070681_10118311 3300005458 Bacteria 2586
41 Ga0068867_100476787 3300005459 Unclassified 1068
42 Ga0068867_101054268 3300005459 Unclassified 740
43 Ga0070706_100013301 3300005467 Bacteria 7610
44 Ga0070706_100208521 3300005467 Unclassified 1825
45 Ga0070706_100231236 3300005467 Bacteria 1726
46 Ga0070706_100239148 3300005467 Bacteria 1695
47 Ga0070706_100298818 3300005467 Bacteria 1502
48 Ga0070707_100043072 3300005468 Bacteria 4321
49 Ga0070707_100196491 3300005468 Archaea 1966
50 Ga0070707_100199728 3300005468 Unclassified 1949
51 Ga0070698_100298992 3300005471 Unclassified 1540
52 Ga0070699_100021901 3300005518 Bacteria 5508
53 Ga0070699_100064919 3300005518 Bacteria 3167
54 Ga0070699_100197002 3300005518 Bacteria 1791
55 Ga0070699_100297447 3300005518 Unclassified 1448
56 Ga0070679_100032634 3300005530 Bacteria 5152
57 Ga0070679_100116834 3300005530 Bacteria 2652
58 Ga0070697_100052807 3300005536 Bacteria 3303
59 Ga0070697_100093402 3300005536 Bacteria 2491
60 Ga0070697_100157292 3300005536 Bacteria 1919
61 Ga0070697_100214770 3300005536 Unclassified 1638
62 Ga0070697_100278761 3300005536 Unclassified 1434
63 Ga0068853_100160063 3300005539 Unclassified 2031
64 Ga0070686_100076797 3300005544 Bacteria 2201
65 Ga0070696_100060762 3300005546 Bacteria 2643
66 Ga0070696_100122079 3300005546 Bacteria 1886
67 Ga0070696_100603692 3300005546 Bacteria 885
68 Ga0070693_100207396 3300005547 Unclassified 1277
69 Ga0070665_100096111 3300005548 Bacteria 2968
70 Ga0070704_100082906 3300005549 Bacteria 2366
71 Ga0070704_100477444 3300005549 Bacteria 1078
72 Ga0070704_100499000 3300005549 Bacteria 1056
73 Ga0068855_100348968 3300005563 Unclassified 1630
74 Ga0070664_100020148 3300005564 Bacteria 5491
75 Ga0070664_100043831 3300005564 Bacteria 3776
76 Ga0068856_100177928 3300005614 Bacteria 2140
77 Ga0070702_100322982 3300005615 Unclassified 1076
78 Ga0068859_100007145 3300005617 Bacteria 11336
79 Ga0068859_100117036 3300005617 Bacteria 2730
80 Ga0068866_10108173 3300005718 Unclassified 1546
81 Ga0068863_100281317 3300005841 Bacteria 1612
82 Ga0068860_100597238 3300005843 Unclassified 1109
83 Ga0081455_10000754 3300005937 Bacteria 42061
84 Ga0081455_10084285 3300005937 Bacteria 2594
85 Ga0081455_10135509 3300005937 Bacteria 1919
86 Ga0081538_10017245 3300005981 Bacteria 5491
87 Ga0081538_10126446 3300005981 Bacteria 1214
88 Ga0081540_1007234 3300005983 Bacteria 7956
89 Ga0075432_10021755 3300006058 Bacteria 2192
90 Ga0070716_100772644 3300006173 Bacteria 741
91 Ga0070716_100913689 3300006173 Bacteria 688
92 Ga0070712_100043632 3300006175 Bacteria 3088
93 Ga0075427_10070306 3300006194 Bacteria 623
94 Ga0075428_100009637 3300006844 Bacteria 10723
95 Ga0075428_100092659 3300006844 Bacteria 3294
96 Ga0075428_100115327 3300006844 Bacteria 2926
97 Ga0075428_100522919 3300006844 Viruses 1269
98 Ga0075428_100858062 3300006844 Unclassified 964
99 Ga0075428_101463269 3300006844 Bacteria 716
100 Ga0075430_100018124 3300006846 Bacteria 5992
101 Ga0075430_100044441 3300006846 Bacteria 3756
102 Ga0075430_100056217 3300006846 Bacteria 3308
103 Ga0075430_100113411 3300006846 Bacteria 2259
104 Ga0075430_100331838 3300006846 Bacteria 1257
105 Ga0075430_100595823 3300006846 Unclassified 912
106 Ga0075431_100001064 3300006847 Bacteria 24562
107 Ga0075431_100010083 3300006847 Bacteria 9492
108 Ga0075431_100073690 3300006847 Bacteria 3523
109 Ga0075431_100108225 3300006847 Bacteria 2868
110 Ga0075431_100452912 3300006847 Archaea 1279
111 Ga0075433_10000479 3300006852 Bacteria 26051
112 Ga0075433_10000685 3300006852 Bacteria 23063
113 Ga0075433_10105108 3300006852 Bacteria 2501
114 Ga0075433_10221627 3300006852 Bacteria 1680
115 Ga0075433_10743955 3300006852 Unclassified 858
116 Ga0075434_100044376 3300006871 Bacteria 4410
117 Ga0075434_100542811 3300006871 Bacteria 1182
118 Ga0075434_100654071 3300006871 Bacteria 1069
119 Ga0075434_100676770 3300006871 Unclassified 1050
120 Ga0075434_101107833 3300006871 Unclassified 805
121 Ga0075429_100001389 3300006880 Bacteria 19781
122 Ga0075429_100271733 3300006880 Unclassified 1485
123 Ga0068865_100196110 3300006881 Unclassified 1565
124 Ga0068865_101367656 3300006881 Unclassified 631
125 Ga0075436_100002119 3300006914 Bacteria 13690
126 Ga0075436_100003906 3300006914 Bacteria 10214
127 Ga0075436_100155661 3300006914 Bacteria 1610
128 Ga0097620_100007145 3300006931 Bacteria 11336
129 Ga0097620_100117037 3300006931 Bacteria 2730
130 Ga0075435_100017185 3300007076 Bacteria 5468
131 Ga0075435_100017768 3300007076 Bacteria 5390
132 Ga0075435_100116885 3300007076 Bacteria 2222
133 Ga0075435_100139340 3300007076 Bacteria 2034
134 Ga0075435_100696717 3300007076 Unclassified 883
135 Ga0099794_10005607 3300007265 Bacteria 5048
136 Ga0099794_10276939 3300007265 Bacteria 867
137 Ga0111539_10038032 3300009094 Bacteria 5805
138 Ga0111539_10552384 3300009094 Unclassified 1341
139 Ga0111539_10963000 3300009094 Unclassified 992
140 Ga0111539_11182262 3300009094 Unclassified 888
141 Ga0111539_11423004 3300009094 Unclassified 804
142 Ga0105245_10654112 3300009098 Unclassified 1081
143 Ga0114129_10000847 3300009147 Bacteria 39608
144 Ga0114129_10008633 3300009147 Bacteria 14530
145 Ga0114129_10067632 3300009147 Bacteria 4983
146 Ga0114129_10076616 3300009147 Bacteria 4655
147 Ga0114129_10079740 3300009147 Bacteria 4551
148 Ga0114129_10127078 3300009147 Bacteria 3505
149 Ga0114129_10223845 3300009147 Unclassified 2537
150 Ga0114129_10660441 3300009147 Bacteria 1348
151 Ga0114129_10871337 3300009147 Bacteria 1143
152 Ga0114129_10973895 3300009147 Bacteria 1070
153 Ga0114129_11695867 3300009147 Bacteria 771
154 Ga0105243_10048093 3300009148 Bacteria 3361
155 Ga0105243_11044972 3300009148 Bacteria 822
156 Ga0105243_11504953 3300009148 Bacteria 697
157 Ga0105241_10067855 3300009174 Bacteria 2761
158 Ga0105248_10662920 3300009177 Bacteria 1177
159 Ga0105237_10595613 3300009545 Unclassified 1112
160 Ga0105249_10386395 3300009553 Bacteria 1427
161 Ga0105249_11679420 3300009553 Unclassified 708
162 Ga0105239_10154962 3300010375 Bacteria 2558
163 Ga0105246_10149500 3300011119 Bacteria 1766
164 Ga0157374_10431524 3300013296 Bacteria 1317
165 Ga0157378_10047663 3300013297 Bacteria 3810
166 Ga0163162_10285155 3300013306 Bacteria 1783
167 Ga0163162_10504814 3300013306 Unclassified 1340
168 Ga0157379_10227102 3300014968 Bacteria 1692
169 Ga0157376_10154522 3300014969 Bacteria 2073
170 Ga0163161_10110085 3300017792 Bacteria 2058
171 Ga0207653_10035669 3300025885 Bacteria 1619
172 Ga0207645_10001709 3300025907 Bacteria 17815
173 Ga0207684_10050469 3300025910 Bacteria 3529
174 Ga0207684_10339931 3300025910 Unclassified 1293
175 Ga0207684_10829413 3300025910 Bacteria 780
176 Ga0207654_10075454 3300025911 Bacteria 2015
177 Ga0207707_10017796 3300025912 Bacteria 6197
178 Ga0207707_10064520 3300025912 Bacteria 3188
179 Ga0207693_10019132 3300025915 Bacteria 5450
180 Ga0207660_10264454 3300025917 Unclassified 1361
181 Ga0207649_10081190 3300025920 Bacteria 2099
182 Ga0207652_10130347 3300025921 Bacteria 2242
183 Ga0207646_10019184 3300025922 Bacteria 6358
184 Ga0207646_10067516 3300025922 Bacteria 3192
185 Ga0207646_10590768 3300025922 Archaea 997
186 Ga0207659_10091890 3300025926 Unclassified 2268
187 Ga0207687_10770906 3300025927 Unclassified 819
188 Ga0207706_10002867 3300025933 Bacteria 16723
189 Ga0207686_10681669 3300025934 Unclassified 815
190 Ga0207704_10422683 3300025938 Unclassified 1057
191 Ga0207704_11178599 3300025938 Unclassified 653
192 Ga0207665_10064675 3300025939 Bacteria 2486
193 Ga0207665_10141537 3300025939 Bacteria 1716
194 Ga0207665_10506729 3300025939 Unclassified 933
195 Ga0207665_10867724 3300025939 Bacteria 715
196 Ga0207689_11064743 3300025942 Unclassified 682
197 Ga0207679_10006161 3300025945 Bacteria 7577
198 Ga0207679_10281889 3300025945 Bacteria 1425
199 Ga0207651_10876714 3300025960 Unclassified 798
200 Ga0207703_10247510 3300026035 Unclassified 1605
201 Ga0207678_10204964 3300026067 Bacteria 1687
202 Ga0207641_10147242 3300026088 Bacteria 2130
203 Ga0207674_10180422 3300026116 Bacteria 2063
204 Ga0207675_100270662 3300026118 Unclassified 1648
205 Ga0207683_10009718 3300026121 Bacteria 8204
206 Ga0207683_10280157 3300026121 Bacteria 1524
207 Ga0209973_1006654 3300027252 Bacteria 1268
208 Ga0209982_1004915 3300027552 Bacteria 1926
209 Ga0209588_1111111 3300027671 Bacteria 880
210 Ga0209971_1010477 3300027682 Bacteria 2196
211 Ga0209998_10008264 3300027717 Bacteria 2158
212 Ga0209974_10002067 3300027876 Bacteria 7339
213 Ga0209974_10017455 3300027876 Bacteria 2381
214 Ga0207428_10129936 3300027907 Unclassified 1928
215 Ga0207428_10276308 3300027907 Bacteria 1248
216 Ga0207428_10279236 3300027907 Unclassified 1240
217 Ga0268266_10248713 3300028379 Bacteria 1644
218 Ga0307408_100018248 3300031548 Bacteria 4710
219 Ga0307408_100030371 3300031548 Bacteria 3752
220 Ga0307405_10074783 3300031731 Bacteria 2192
221 Ga0307410_10069004 3300031852 Bacteria 2444
222 Ga0307410_10400424 3300031852 Bacteria 1109
223 Ga0307407_10650168 3300031903 Unclassified 790
224 Ga0307412_10167379 3300031911 Bacteria 1640
225 Ga0307412_10667129 3300031911 Bacteria 889
226 Ga0307409_100003392 3300031995 Bacteria 8645
227 Ga0307416_100003677 3300032002 Bacteria 9082
228 Ga0307416_100022684 3300032002 Bacteria 4537
229 Ga0307416_100068900 3300032002 Bacteria 2925
230 Ga0307411_10062431 3300032005 Bacteria 2485
231 Ga0307411_10313823 3300032005 Bacteria 1263
232 Ga0307415_100161268 3300032126 Bacteria 1738
233 Ga0373951_0071811 3300035091 Unclassified 883
234 Ga0373945_0046974 3300035116 Bacteria 1577
235 Ga0373931_0099974 3300035691 Bacteria 1630
236 Ga0373933_0134106 3300035724 Bacteria 1559
237 Ga0373937_0155119 3300036401 Bacteria 2146
238 Ga0373925_0034727 3300037068 Bacteria 3718
239 Ga0395901_1253872 3300038443 Unclassified 705
240 Ga0242420_040970 3300038996 Unclassified 885
241 Ga0439431_0071561 3300041997 Unclassified 925
242 Ga0439448_0046247 3300042005 Unclassified 1418
243 Ga0451576_0226159 3300045051 Bacteria 1954
244 Ga0451576_0230098 3300045051 Bacteria 1936
245 Ga0451576_1197151 3300045051 Bacteria 793
246 Ga0495621_0186882 3300046539 Unclassified 829
247 Ga0495647_0057531 3300046681 Bacteria 1527
248 Ga0496100_0284979 3300048903 Unclassified 1233
249 Ga0496102_0559748 3300048905 Bacteria 1066
250 Ga0496106_0509371 3300048909 Unclassified 967
251 Ga0496106_0954073 3300048909 Unclassified 676
252 Ga0496109_0682289 3300048912 Unclassified 965
253 Ga0496110_0094968 3300048913 Bacteria 2670
254 Ga0496112_0051466 3300048915 Bacteria 4040
255 Ga0496112_0549269 3300048915 Unclassified 1089
256 Ga0501031_0006738 3300049568 Bacteria 7492
257 Ga0501032_0018911 3300049569 Bacteria 4820
258 Ga0501033_0040337 3300049570 Unclassified 3485
259 Ga0501036_0042402 3300049572 Bacteria 3852
260 Ga0501036_0460666 3300049572 Unclassified 1059
261 Ga0501037_0013149 3300049573 Bacteria 6102
262 Ga0501037_0015150 3300049573 Bacteria 5673
263 Ga0501038_0013535 3300049574 Bacteria 7436
264 Ga0501038_0064790 3300049574 Bacteria 3115
265 Ga0501039_0003996 3300049575 Bacteria 11087
266 Ga0501039_0156613 3300049575 Unclassified 1790
267 Ga0501040_0002631 3300049576 Bacteria 11579
268 Ga0501040_0356040 3300049576 Bacteria 1049
269 Ga0501040_0546945 3300049576 Unclassified 835
270 Ga0501041_0039829 3300049577 Unclassified 2851
271 Ga0501041_0505266 3300049577 Unclassified 769
272 Ga0501042_0002038 3300049578 Bacteria 12243
273 Ga0501042_0014436 3300049578 Bacteria 5392
274 Ga0501042_0662276 3300049578 Unclassified 759
275 Ga0501043_0004103 3300049579 Bacteria 11893
276 Ga0501043_0041056 3300049579 Bacteria 3635
277 Ga0501046_0014008 3300049580 Bacteria 6772
278 Ga0501046_0111076 3300049580 Unclassified 2094
279 Ga0501046_0133583 3300049580 Bacteria 1881
280 Ga0501046_0190636 3300049580 Unclassified 1529
281 Ga0501046_0202370 3300049580 Unclassified 1477
282 Ga0501048_0007455 3300049582 Bacteria 8293
283 Ga0501048_0044268 3300049582 Unclassified 3183
284 Ga0501048_0112025 3300049582 Bacteria 1927
285 Ga0501048_0253511 3300049582 Bacteria 1250
286 Ga0501068_0001383 3300049584 Bacteria 12901
287 Ga0501069_0004979 3300049585 Bacteria 6890
288 Ga0501069_0295746 3300049585 Unclassified 949
289 Ga0501070_0007695 3300049586 Bacteria 9138
290 Ga0501071_0006753 3300049587 Bacteria 7471
291 Ga0501071_0055331 3300049587 Bacteria 2864
292 Ga0501071_0191475 3300049587 Unclassified 1534
293 Ga0501071_0209179 3300049587 Bacteria 1466
294 Ga0501071_0489475 3300049587 Bacteria 943
295 Ga0501072_0000283 3300049588 Bacteria 36724
296 Ga0501072_0194079 3300049588 Unclassified 1619
297 Ga0501072_0300676 3300049588 Bacteria 1275
298 Ga0501072_0537686 3300049588 Bacteria 923
299 Ga0501073_0031600 3300049589 Bacteria 3777
300 Ga0501074_0022805 3300049590 Bacteria 4551
301 Ga0501075_0000657 3300049591 Bacteria 21245
302 Ga0501075_0010614 3300049591 Bacteria 6480
303 Ga0501075_0041170 3300049591 Unclassified 3461
304 Ga0501075_0044843 3300049591 Bacteria 3317
305 Ga0501075_0093300 3300049591 Bacteria 2285
306 Ga0501075_0281034 3300049591 Bacteria 1268
307 Ga0501075_0289861 3300049591 Bacteria 1247
308 Ga0501076_0001370 3300049592 Bacteria 16338
309 Ga0501076_0084323 3300049592 Unclassified 2552
310 Ga0501076_0377167 3300049592 Unclassified 1166
311 Ga0501076_0537660 3300049592 Bacteria 963
312 Ga0501076_0604076 3300049592 Bacteria 905
313 Ga0501077_0000756 3300049593 Bacteria 19572
314 Ga0501077_0003529 3300049593 Bacteria 9393
315 Ga0501077_0017094 3300049593 Unclassified 4574
316 Ga0501077_0088125 3300049593 Bacteria 1967
317 Ga0501077_0142622 3300049593 Bacteria 1519
318 Ga0501077_0549893 3300049593 Bacteria 741
319 Ga0501209_095298 3300049656 Bacteria 869
320 Ga0501230_034757 3300049667 Bacteria 955
321 Ga0501233_082357 3300049668 Bacteria 830
322 Ga0501235_078888 3300049669 Bacteria 785
323 Ga0501249_135142 3300049679 Unclassified 611
324 Ga0501079_0016026 3300049741 Bacteria 5726
325 Ga0501079_0021129 3300049741 Bacteria 4976
326 Ga0501079_0148088 3300049741 Bacteria 1830
327 Ga0501079_0280652 3300049741 Unclassified 1302
328 Ga0501079_0847749 3300049741 Bacteria 720
329 Ga0501079_0879204 3300049741 Unclassified 706
330 Ga0501080_0011236 3300049742 Bacteria 8196
331 Ga0501080_0015880 3300049742 Bacteria 6946
332 Ga0501080_0148413 3300049742 Unclassified 2168
333 Ga0501080_0512504 3300049742 Bacteria 1071
334 Ga0501081_0001455 3300049743 Bacteria 14509
335 Ga0501081_0011500 3300049743 Bacteria 5790
336 Ga0501081_0098200 3300049743 Bacteria 2068
337 Ga0501081_0151089 3300049743 Bacteria 1668
338 Ga0501081_0223649 3300049743 Bacteria 1369
339 Ga0501081_0828589 3300049743 Unclassified 697
340 Ga0501083_0015010 3300049744 Bacteria 5422
341 Ga0501083_0408625 3300049744 Unclassified 883
342 Ga0501035_0053002 3300049822 Bacteria 3629
343 Ga0501035_0101726 3300049822 Bacteria 2521
344 Ga0501045_0002678 3300049824 Bacteria 12149
345 Ga0501045_0078568 3300049824 Bacteria 2432
346 Ga0501045_0137489 3300049824 Bacteria 1817
347 Ga0501045_0152085 3300049824 Bacteria 1722
348 Ga0501045_0562285 3300049824 Bacteria 846
349 Ga0501045_0978833 3300049824 Unclassified 620
350 nmdc:mga05p37_111782_c1 3300050507 Bacteria 3360
351 nmdc:mga05p37_137362_c1 3300050507 Bacteria 2996
352 nmdc:mga05p37_15790_c1 3300050507 Bacteria 9081
353 nmdc:mga05p37_263989_c1 3300050507 Bacteria 2059
354 nmdc:mga05p37_3046_c1 3300050507 Bacteria 19461
355 nmdc:mga05p37_4682_c1 3300050507 Bacteria 15979
356 nmdc:mga05p37_66854_c1 3300050507 Bacteria 4421
357 nmdc:mga05p37_780914_c1 3300050507 Unclassified 1048
358 nmdc:mga05p37_94971_c1 3300050507 Bacteria 3674
359 nmdc:mga09592_11081_c1 3300050508 Bacteria 7337
360 nmdc:mga0qj67_139275_c1 3300050509 Unclassified 1967
361 nmdc:mga0qj67_224475_c1 3300050509 Bacteria 1525
362 nmdc:mga0qj67_456571_c1 3300050509 Bacteria 1029
363 nmdc:mga0qj67_540734_c1 3300050509 Unclassified 935
364 nmdc:mga0qj67_91470_c1 3300050509 Bacteria 2445
365 nmdc:mga06r32_1545082_c1 3300050510 Unclassified 603
366 nmdc:mga06r32_2393_c1 3300050510 Bacteria 16786
367 nmdc:mga06r32_51808_c1 3300050510 Bacteria 3929
368 nmdc:mga06r32_62628_c1 3300050510 Bacteria 3584
369 nmdc:mga06r32_660796_c1 3300050510 Unclassified 1013
370 nmdc:mga06r32_704051_c1 3300050510 Bacteria 976
371 nmdc:mga08y16_39208_c1 3300050511 Bacteria 4970
372 nmdc:mga08y16_55684_c1 3300050511 Bacteria 4132
373 nmdc:mga08y16_568601_c1 3300050511 Unclassified 1146
374 nmdc:mga08y16_659855_c1 3300050511 Unclassified 1049
375 nmdc:mga0n895_1004_c1 3300050512 Bacteria 20486
376 nmdc:mga0n895_1108536_c1 3300050512 Unclassified 769
377 nmdc:mga0n895_1981_c1 3300050512 Bacteria 15706
378 nmdc:mga0n895_640212_c1 3300050512 Unclassified 1063
379 nmdc:mga0n895_80437_c1 3300050512 Bacteria 3247
380 nmdc:mga0rr50_1272059_c1 3300050513 Unclassified 624
381 nmdc:mga0rr50_1899_c1 3300050513 Bacteria 11596
382 nmdc:mga0rr50_194761_c1 3300050513 Bacteria 1663
383 nmdc:mga0rr50_211345_c1 3300050513 Bacteria 1598
384 nmdc:mga0rr50_39135_c1 3300050513 Bacteria 3438
385 nmdc:mga0rr50_59001_c1 3300050513 Bacteria 2879
386 nmdc:mga08x19_26966_c1 3300050514 Bacteria 3590
387 nmdc:mga08x19_33785_c1 3300050514 Unclassified 3229
388 nmdc:mga08x19_59640_c1 3300050514 Bacteria 2471
389 nmdc:mga08x19_77542_c1 3300050514 Bacteria 2176
390 nmdc:mga0a205_123326_c1 3300050515 Bacteria 2491
391 nmdc:mga0a205_12687_c1 3300050515 Bacteria 7806
392 nmdc:mga0a205_193_c1 3300050515 Bacteria 42226
393 nmdc:mga0a205_215444_c1 3300050515 Bacteria 1807
394 nmdc:mga0a205_269872_c1 3300050515 Bacteria 1578
395 nmdc:mga0a205_505811_c1 3300050515 Unclassified 1065
396 nmdc:mga0a205_885386_c1 3300050515 Unclassified 740
397 nmdc:mga0a205_987_c1 3300050515 Bacteria 23554
398 Ga0501084_0000573 3300054114 Bacteria 28128
399 Ga0501084_0121108 3300054114 Bacteria 2200
400 Ga0501084_0307640 3300054114 Unclassified 1338
401 Ga0501084_0354782 3300054114 Unclassified 1239
402 Ga0590075_019532 3300059424 Unclassified 1683
403 Ga0590077_041205 3300059426 Unclassified 1026
404 Ga0590077_074620 3300059426 Unclassified 777
405 Ga0501082_0006829 3300060353 Bacteria 9866
406 Ga0501082_0056467 3300060353 Bacteria 3382
407 Ga0530510_0075046 3300061734 Unclassified 2455
408 Ga0530510_0418095 3300061734 Bacteria 1012
409 Ga0530510_0500210 3300061734 Bacteria 921
410 Ga0530510_0602444 3300061734 Unclassified 835
411 Ga0075434_100184680
412 Ga0058859_11755672
413 Ga0065714_10167580
414 Ga0065712_10000675
415 Ga0065712_10014523
416 Ga0065715_10110000
417 Ga0065715_10231267
418 Ga0065707_10090744
419 Ga0065707_10096911
420 Ga0070676_10022631
421 Ga0070690_100177491
422 Ga0070690_100289663
423 Ga0070670_100001766
424 Ga0070680_100176708
425 Ga0070680_100235346
426 Ga0070682_100761458
427 Ga0070660_100076123
428 Ga0070689_100080436
429 Ga0070691_10084785
430 Ga0070668_100128321
431 Ga0070675_100077190
432 Ga0070671_100179458
433 Ga0070673_100488901
434 Ga0070673_101313812
435 Ga0070659_100529380
436 Ga0070711_100113337
437 Ga0070705_100112826
438 Ga0070705_100543666
439 Ga0070694_100060938
440 Ga0070694_100162002
441 Ga0070694_100512472
442 Ga0070708_100019632
443 Ga0070708_100032633
444 Ga0070708_100061118
445 Ga0070708_100756853
446 Ga0070678_100063131
447 Ga0070662_100090725
448 Ga0070662_100328449
449 Ga0070681_10065051
450 Ga0070681_10118311
451 Ga0068867_100476787
452 Ga0068867_101054268
453 Ga0070706_100013301
454 Ga0070706_100208521
455 Ga0070706_100231236
456 Ga0070706_100239148
457 Ga0070706_100298818
458 Ga0070707_100043072
459 Ga0070707_100196491
460 Ga0070707_100199728
461 Ga0070698_100298992
462 Ga0070699_100021901
463 Ga0070699_100064919
464 Ga0070699_100197002
465 Ga0070699_100297447
466 Ga0070679_100032634
467 Ga0070679_100116834
468 Ga0070697_100052807
469 Ga0070697_100093402
470 Ga0070697_100157292
471 Ga0070697_100214770
472 Ga0070697_100278761
473 Ga0068853_100160063
474 Ga0070686_100076797
475 Ga0070696_100060762
476 Ga0070696_100122079
477 Ga0070696_100603692
478 Ga0070693_100207396
479 Ga0070665_100096111
480 Ga0070704_100082906
481 Ga0070704_100477444
482 Ga0070704_100499000
483 Ga0068855_100348968
484 Ga0070664_100020148
485 Ga0070664_100043831
486 Ga0068856_100177928
487 Ga0070702_100322982
488 Ga0068859_100007145
489 Ga0068859_100117036
490 Ga0068866_10108173
491 Ga0068863_100281317
492 Ga0068860_100597238
493 Ga0081455_10000754
494 Ga0081455_10084285
495 Ga0081455_10135509
496 Ga0081538_10017245
497 Ga0081538_10126446
498 Ga0081540_1007234
499 Ga0075432_10021755
500 Ga0070716_100772644
501 Ga0070716_100913689
502 Ga0070712_100043632
503 Ga0075427_10070306
504 Ga0075428_100009637
505 Ga0075428_100092659
506 Ga0075428_100115327
507 Ga0075428_100522919
508 Ga0075428_100858062
509 Ga0075428_101463269
510 Ga0075430_100018124
511 Ga0075430_100044441
512 Ga0075430_100056217
513 Ga0075430_100113411
514 Ga0075430_100331838
515 Ga0075430_100595823
516 Ga0075431_100001064
517 Ga0075431_100010083
518 Ga0075431_100073690
519 Ga0075431_100108225
520 Ga0075431_100452912
521 Ga0075433_10000479
522 Ga0075433_10000685
523 Ga0075433_10105108
524 Ga0075433_10221627
525 Ga0075433_10743955
526 Ga0075434_100044376
527 Ga0075434_100542811
528 Ga0075434_100654071
529 Ga0075434_100676770
530 Ga0075434_101107833
531 Ga0075429_100001389
532 Ga0075429_100271733
533 Ga0068865_100196110
534 Ga0068865_101367656
535 Ga0075436_100002119
536 Ga0075436_100003906
537 Ga0075436_100155661
538 Ga0097620_100007145
539 Ga0097620_100117037
540 Ga0075435_100017185
541 Ga0075435_100017768
542 Ga0075435_100116885
543 Ga0075435_100139340
544 Ga0075435_100696717
545 Ga0099794_10005607
546 Ga0099794_10276939
547 Ga0111539_10038032
548 Ga0111539_10552384
549 Ga0111539_10963000
550 Ga0111539_11182262
551 Ga0111539_11423004
552 Ga0105245_10654112
553 Ga0114129_10000847
554 Ga0114129_10008633
555 Ga0114129_10067632
556 Ga0114129_10076616
557 Ga0114129_10079740
558 Ga0114129_10127078
559 Ga0114129_10223845
560 Ga0114129_10660441
561 Ga0114129_10871337
562 Ga0114129_10973895
563 Ga0114129_11695867
564 Ga0105243_10048093
565 Ga0105243_11044972
566 Ga0105243_11504953
567 Ga0105241_10067855
568 Ga0105248_10662920
569 Ga0105237_10595613
570 Ga0105249_10386395
571 Ga0105249_11679420
572 Ga0105239_10154962
573 Ga0105246_10149500
574 Ga0157374_10431524
575 Ga0157378_10047663
576 Ga0163162_10285155
577 Ga0163162_10504814
578 Ga0157379_10227102
579 Ga0157376_10154522
580 Ga0163161_10110085
581 Ga0207653_10035669
582 Ga0207645_10001709
583 Ga0207684_10050469
584 Ga0207684_10339931
585 Ga0207684_10829413
586 Ga0207654_10075454
587 Ga0207707_10017796
588 Ga0207707_10064520
589 Ga0207693_10019132
590 Ga0207660_10264454
591 Ga0207649_10081190
592 Ga0207652_10130347
593 Ga0207646_10019184
594 Ga0207646_10067516
595 Ga0207646_10590768
596 Ga0207659_10091890
597 Ga0207687_10770906
598 Ga0207706_10002867
599 Ga0207686_10681669
600 Ga0207704_10422683
601 Ga0207704_11178599
602 Ga0207665_10064675
603 Ga0207665_10141537
604 Ga0207665_10506729
605 Ga0207665_10867724
606 Ga0207689_11064743
607 Ga0207679_10006161
608 Ga0207679_10281889
609 Ga0207651_10876714
610 Ga0207703_10247510
611 Ga0207678_10204964
612 Ga0207641_10147242
613 Ga0207674_10180422
614 Ga0207675_100270662
615 Ga0207683_10009718
616 Ga0207683_10280157
617 Ga0209973_1006654
618 Ga0209982_1004915
619 Ga0209588_1111111
620 Ga0209971_1010477
621 Ga0209998_10008264
622 Ga0209974_10002067
623 Ga0209974_10017455
624 Ga0207428_10129936
625 Ga0207428_10276308
626 Ga0207428_10279236
627 Ga0268266_10248713
628 Ga0307408_100018248
629 Ga0307408_100030371
630 Ga0307405_10074783
631 Ga0307410_10069004
632 Ga0307410_10400424
633 Ga0307407_10650168
634 Ga0307412_10167379
635 Ga0307412_10667129
636 Ga0307409_100003392
637 Ga0307416_100003677
638 Ga0307416_100022684
639 Ga0307416_100068900
640 Ga0307411_10062431
641 Ga0307411_10313823
642 Ga0307415_100161268
643 Ga0373951_0071811
644 Ga0373945_0046974
645 Ga0373931_0099974
646 Ga0373933_0134106
647 Ga0373937_0155119
648 Ga0373925_0034727
649 Ga0395901_1253872
650 Ga0242420_040970
651 Ga0439431_0071561
652 Ga0439448_0046247
653 Ga0451576_0226159
654 Ga0451576_0230098
655 Ga0451576_1197151
656 Ga0495621_0186882
657 Ga0495647_0057531
658 Ga0496100_0284979
659 Ga0496102_0559748
660 Ga0496106_0509371
661 Ga0496106_0954073
662 Ga0496109_0682289
663 Ga0496110_0094968
664 Ga0496112_0051466
665 Ga0496112_0549269
666 Ga0501031_0006738
667 Ga0501032_0018911
668 Ga0501033_0040337
669 Ga0501036_0042402
670 Ga0501036_0460666
671 Ga0501037_0013149
672 Ga0501037_0015150
673 Ga0501038_0013535
674 Ga0501038_0064790
675 Ga0501039_0003996
676 Ga0501039_0156613
677 Ga0501040_0002631
678 Ga0501040_0356040
679 Ga0501040_0546945
680 Ga0501041_0039829
681 Ga0501041_0505266
682 Ga0501042_0002038
683 Ga0501042_0014436
684 Ga0501042_0662276
685 Ga0501043_0004103
686 Ga0501043_0041056
687 Ga0501046_0014008
688 Ga0501046_0111076
689 Ga0501046_0133583
690 Ga0501046_0190636
691 Ga0501046_0202370
692 Ga0501048_0007455
693 Ga0501048_0044268
694 Ga0501048_0112025
695 Ga0501048_0253511
696 Ga0501068_0001383
697 Ga0501069_0004979
698 Ga0501069_0295746
699 Ga0501070_0007695
700 Ga0501071_0006753
701 Ga0501071_0055331
702 Ga0501071_0191475
703 Ga0501071_0209179
704 Ga0501071_0489475
705 Ga0501072_0000283
706 Ga0501072_0194079
707 Ga0501072_0300676
708 Ga0501072_0537686
709 Ga0501073_0031600
710 Ga0501074_0022805
711 Ga0501075_0000657
712 Ga0501075_0010614
713 Ga0501075_0041170
714 Ga0501075_0044843
715 Ga0501075_0093300
716 Ga0501075_0281034
717 Ga0501075_0289861
718 Ga0501076_0001370
719 Ga0501076_0084323
720 Ga0501076_0377167
721 Ga0501076_0537660
722 Ga0501076_0604076
723 Ga0501077_0000756
724 Ga0501077_0003529
725 Ga0501077_0017094
726 Ga0501077_0088125
727 Ga0501077_0142622
728 Ga0501077_0549893
729 Ga0501209_095298
730 Ga0501230_034757
731 Ga0501233_082357
732 Ga0501235_078888
733 Ga0501249_135142
734 Ga0501079_0016026
735 Ga0501079_0021129
736 Ga0501079_0148088
737 Ga0501079_0280652
738 Ga0501079_0847749
739 Ga0501079_0879204
740 Ga0501080_0011236
741 Ga0501080_0015880
742 Ga0501080_0148413
743 Ga0501080_0512504
744 Ga0501081_0001455
745 Ga0501081_0011500
746 Ga0501081_0098200
747 Ga0501081_0151089
748 Ga0501081_0223649
749 Ga0501081_0828589
750 Ga0501083_0015010
751 Ga0501083_0408625
752 Ga0501035_0053002
753 Ga0501035_0101726
754 Ga0501045_0002678
755 Ga0501045_0078568
756 Ga0501045_0137489
757 Ga0501045_0152085
758 Ga0501045_0562285
759 Ga0501045_0978833
760 nmdc:mga05p37_111782_c1
761 nmdc:mga05p37_137362_c1
762 nmdc:mga05p37_15790_c1
763 nmdc:mga05p37_263989_c1
764 nmdc:mga05p37_3046_c1
765 nmdc:mga05p37_4682_c1
766 nmdc:mga05p37_66854_c1
767 nmdc:mga05p37_780914_c1
768 nmdc:mga05p37_94971_c1
769 nmdc:mga09592_11081_c1
770 nmdc:mga0qj67_139275_c1
771 nmdc:mga0qj67_224475_c1
772 nmdc:mga0qj67_456571_c1
773 nmdc:mga0qj67_540734_c1
774 nmdc:mga0qj67_91470_c1
775 nmdc:mga06r32_1545082_c1
776 nmdc:mga06r32_2393_c1
777 nmdc:mga06r32_51808_c1
778 nmdc:mga06r32_62628_c1
779 nmdc:mga06r32_660796_c1
780 nmdc:mga06r32_704051_c1
781 nmdc:mga08y16_39208_c1
782 nmdc:mga08y16_55684_c1
783 nmdc:mga08y16_568601_c1
784 nmdc:mga08y16_659855_c1
785 nmdc:mga0n895_1004_c1
786 nmdc:mga0n895_1108536_c1
787 nmdc:mga0n895_1981_c1
788 nmdc:mga0n895_640212_c1
789 nmdc:mga0n895_80437_c1
790 nmdc:mga0rr50_1272059_c1
791 nmdc:mga0rr50_1899_c1
792 nmdc:mga0rr50_194761_c1
793 nmdc:mga0rr50_211345_c1
794 nmdc:mga0rr50_39135_c1
795 nmdc:mga0rr50_59001_c1
796 nmdc:mga08x19_26966_c1
797 nmdc:mga08x19_33785_c1
798 nmdc:mga08x19_59640_c1
799 nmdc:mga08x19_77542_c1
800 nmdc:mga0a205_123326_c1
801 nmdc:mga0a205_12687_c1
802 nmdc:mga0a205_193_c1
803 nmdc:mga0a205_215444_c1
804 nmdc:mga0a205_269872_c1
805 nmdc:mga0a205_505811_c1
806 nmdc:mga0a205_885386_c1
807 nmdc:mga0a205_987_c1
808 Ga0501084_0000573
809 Ga0501084_0121108
810 Ga0501084_0307640
811 Ga0501084_0354782
812 Ga0590075_019532
813 Ga0590077_041205
814 Ga0590077_074620
815 Ga0501082_0006829
816 Ga0501082_0056467
817 Ga0530510_0075046
818 Ga0530510_0418095
819 Ga0530510_0500210
820 Ga0530510_0602444

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05995

CDO_I

Cysteine dioxygenase type I

51

187

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xb9-assembly6.cif.gz_L crystal structure of azotobacter vinelandii 3-mercaptopropionic acid dioxygenase in complex with 3-hydroxypropionic acid 0.9172 6 186
4wvz-assembly2.cif.gz_B crystal structure of artificial crosslinked thiol dioxygenase g95c variant from pseudomonas aeruginosa 0.9171 6 186
4tlf-assembly2.cif.gz_B crystal structure of thiol dioxygenase from pseudomonas aeruginosa 0.9145 6 186
6xb9-assembly1.cif.gz_F-2 crystal structure of azotobacter vinelandii 3-mercaptopropionic acid dioxygenase in complex with 3-hydroxypropionic acid 0.9061 6 186
7kov-assembly1.cif.gz_B crystal structure of azotobacter vinelandii 3-mercaptopropionic acid dioxygenase in complex with thiocyanate 0.9027 6 186
ID Description Score Start End Superfamily
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8809 56 159 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8656 55 170 2.60.120.10
4qmaA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8617 42 187 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8575 55 170 2.60.120.10
4qmaA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8561 42 187 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7V2ICF4-F1-model_v4 Cysteine dioxygenase 0.9701 12 187
AF-A0A2D9WAZ7-F1-model_v4 Cysteine dioxygenase 0.9694 2 187 GO:0005506
GO:0016702
AF-A0A1F7P7X3-F1-model_v4 Cysteine dioxygenase 0.9668 1 187
AF-A0A1F9JZ64-F1-model_v4 Cysteine dioxygenase 0.9665 1 161 GO:0005506
GO:0016702
AF-A0A1F7P7X3-F1-model_v4 Cysteine dioxygenase 0.9617 1 187

Map