F437056

General Info

Members Datasets Scaffolds Average Seq Length
409 223 406 274

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0048754|Ga0466963_0048754_979_1914
Length 311
Sequence VTEGPSVGAALRGRPDAVEQGAHTGAPLQRRRRLRGGSVLPGFGLSLGFTLLYLGLLILIPLSTVFLKSATLPWATFWADVTGPRALAAYRLSLGASFLAASINLVFGLLVAWVLERYSFPGRRLIDALVDLPFALPTAVAGIALATLYAKNGWIGRWLEPMGIEVAYTRLGVVVALTFIGLPFVVRTVQPVLADLDPEVEEAAASLGAGRWQTFRRVLFPELVPAAMTGFVLAFARALGEYGSVIFIAGNMPMKSEIVPLLIMIKLEQYDYAGATAIALVFLLASFGLLLLINFLAWRRGRRLRAVDGES

Samples

Sample ID Description Type Environment
1 2738541295 Bacillus sp. OK085 Isolate Unclassified
2 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
3 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
148 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
191 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
192 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
193 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
194 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
195 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
201 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
216 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
217 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.24
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 0
Rhizoplane 7.33
Rhizosphere 87.53
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10012894 3300005327 Bacteria 6710
2 Ga0070690_100133624 3300005330 Bacteria 1678
3 Ga0070690_100373144 3300005330 Bacteria 1041
4 Ga0070670_100000315 3300005331 Bacteria 41551
5 Ga0070669_100000033 3300005353 Bacteria 144544
6 Ga0070675_100013100 3300005354 Bacteria 6514
7 Ga0070671_100008234 3300005355 Bacteria 8343
8 Ga0070671_100506935 3300005355 Bacteria 1038
9 Ga0070674_100204111 3300005356 Bacteria 1528
10 Ga0070673_100018445 3300005364 Bacteria 4984
11 Ga0070705_100044656 3300005440 Bacteria 2546
12 Ga0070700_100104962 3300005441 Bacteria 1868
13 Ga0070708_100023540 3300005445 Bacteria 5240
14 Ga0070708_100161814 3300005445 Bacteria 2086
15 Ga0070678_100333423 3300005456 Bacteria 1299
16 Ga0070706_100008439 3300005467 Bacteria 9595
17 Ga0070706_100171187 3300005467 Bacteria 2028
18 Ga0070707_100049934 3300005468 Bacteria 4010
19 Ga0070707_100448194 3300005468 Bacteria 1251
20 Ga0070698_100002008 3300005471 Bacteria 22594
21 Ga0070698_100004995 3300005471 Bacteria 14534
22 Ga0070698_100587675 3300005471 Bacteria 1054
23 Ga0070699_100001531 3300005518 Bacteria 21129
24 Ga0070699_100005205 3300005518 Bacteria 11431
25 Ga0070699_100053121 3300005518 Bacteria 3507
26 Ga0070679_100000518 3300005530 Bacteria 32749
27 Ga0070679_100074750 3300005530 Bacteria 3379
28 Ga0070679_100219851 3300005530 Bacteria 1861
29 Ga0070684_100033605 3300005535 Bacteria 4381
30 Ga0070684_100127234 3300005535 Bacteria 2296
31 Ga0070697_100026405 3300005536 Bacteria 4638
32 Ga0070672_100121277 3300005543 Bacteria 2140
33 Ga0070672_100156844 3300005543 Bacteria 1886
34 Ga0070686_100074874 3300005544 Bacteria 2226
35 Ga0070696_100000412 3300005546 Bacteria 26669
36 Ga0070696_100245072 3300005546 Bacteria 1353
37 Ga0070696_100265928 3300005546 Bacteria 1302
38 Ga0070693_100106953 3300005547 Bacteria 1714
39 Ga0070665_100009224 3300005548 Bacteria 9996
40 Ga0070704_100252133 3300005549 Bacteria 1450
41 Ga0068855_100004225 3300005563 Bacteria 17534
42 Ga0068855_100031455 3300005563 Bacteria 6336
43 Ga0068855_100129804 3300005563 Bacteria 2879
44 Ga0068855_100148048 3300005563 Bacteria 2671
45 Ga0068855_100797838 3300005563 Bacteria 1004
46 Ga0068854_100196939 3300005578 Bacteria 1581
47 Ga0068854_100479752 3300005578 Bacteria 1044
48 Ga0068856_100187295 3300005614 Bacteria 2083
49 Ga0070702_100342550 3300005615 Bacteria 1050
50 Ga0068859_100021974 3300005617 Bacteria 6398
51 Ga0068864_100013022 3300005618 Bacteria 6886
52 Ga0068863_100458389 3300005841 Bacteria 1252
53 Ga0081538_10003182 3300005981 Bacteria 15587
54 Ga0081538_10029311 3300005981 Bacteria 3763
55 Ga0075365_10047398 3300006038 Bacteria 2825
56 Ga0075363_100008892 3300006048 Bacteria 4699
57 Ga0070716_100237899 3300006173 Bacteria 1233
58 Ga0075362_10015343 3300006177 Bacteria 3114
59 Ga0075366_10008671 3300006195 Bacteria 5661
60 Ga0075370_10027086 3300006353 Bacteria 3179
61 Ga0068871_100113169 3300006358 Bacteria 2285
62 Ga0075428_100595525 3300006844 Bacteria 1181
63 Ga0075430_100022764 3300006846 Bacteria 5329
64 Ga0075430_100041138 3300006846 Bacteria 3911
65 Ga0075431_100002818 3300006847 Bacteria 16828
66 Ga0075431_100098469 3300006847 Bacteria 3019
67 Ga0075431_100176565 3300006847 Bacteria 2194
68 Ga0075431_100273517 3300006847 Bacteria 1711
69 Ga0075433_10006861 3300006852 Bacteria 9022
70 Ga0075433_10090590 3300006852 Bacteria 2703
71 Ga0075433_10152958 3300006852 Bacteria 2052
72 Ga0075434_100005385 3300006871 Bacteria 11645
73 Ga0075434_100009973 3300006871 Bacteria 8890
74 Ga0075434_100022809 3300006871 Bacteria 6095
75 Ga0075434_100025849 3300006871 Bacteria 5747
76 Ga0075434_100052985 3300006871 Bacteria 4032
77 Ga0068865_100146583 3300006881 Bacteria 1786
78 Ga0075436_100004319 3300006914 Bacteria 9753
79 Ga0075436_100009187 3300006914 Bacteria 6763
80 Ga0097620_100021975 3300006931 Bacteria 6398
81 Ga0075435_100175573 3300007076 Bacteria 1809
82 Ga0075435_100198615 3300007076 Bacteria 1699
83 Ga0099794_10035852 3300007265 Bacteria 2342
84 Ga0105240_10000636 3300009093 Bacteria 64769
85 Ga0105240_10001676 3300009093 Bacteria 37586
86 Ga0111539_10004321 3300009094 Bacteria 18600
87 Ga0111539_10135669 3300009094 Bacteria 2882
88 Ga0111539_10303011 3300009094 Bacteria 1860
89 Ga0105245_10003461 3300009098 Bacteria 14140
90 Ga0114129_10202070 3300009147 Bacteria 2691
91 Ga0114129_10637489 3300009147 Bacteria 1377
92 Ga0105248_10513994 3300009177 Bacteria 1350
93 Ga0105237_10233515 3300009545 Bacteria 1840
94 Ga0105238_10023992 3300009551 Bacteria 6219
95 Ga0157370_10014757 3300013104 Bacteria 7976
96 Ga0157374_10121398 3300013296 Bacteria 2522
97 Ga0157378_10134141 3300013297 Bacteria 2294
98 Ga0157375_10010290 3300013308 Bacteria 8230
99 Ga0163163_10000581 3300014325 Bacteria 32150
100 Ga0163163_10075055 3300014325 Bacteria 3374
101 Ga0163163_10502282 3300014325 Bacteria 1275
102 Ga0157380_10032615 3300014326 Bacteria 4009
103 Ga0182008_10098425 3300014497 Bacteria 1444
104 Ga0157379_10128566 3300014968 Bacteria 2280
105 Ga0157376_10381126 3300014969 Bacteria 1358
106 Ga0213872_10023602 3300021361 Bacteria 2830
107 Ga0213872_10028989 3300021361 Bacteria 2539
108 Ga0213876_10004571 3300021384 Bacteria 7717
109 Ga0207692_10038562 3300025898 Bacteria 2344
110 Ga0207705_10303921 3300025909 Bacteria 1224
111 Ga0207684_10001346 3300025910 Bacteria 26938
112 Ga0207684_10162491 3300025910 Bacteria 1923
113 Ga0207707_10152572 3300025912 Bacteria 2020
114 Ga0207695_10001937 3300025913 Bacteria 32151
115 Ga0207695_10002354 3300025913 Bacteria 28096
116 Ga0207660_10214356 3300025917 Bacteria 1509
117 Ga0207660_10242845 3300025917 Bacteria 1419
118 Ga0207662_10020454 3300025918 Bacteria 3777
119 Ga0207652_10000539 3300025921 Bacteria 38450
120 Ga0207652_10002124 3300025921 Bacteria 17010
121 Ga0207652_10077869 3300025921 Bacteria 2894
122 Ga0207646_10079919 3300025922 Bacteria 2923
123 Ga0207681_10000011 3300025923 Bacteria 366878
124 Ga0207694_10013557 3300025924 Bacteria 6140
125 Ga0207650_10001035 3300025925 Bacteria 20865
126 Ga0207650_10105353 3300025925 Bacteria 2177
127 Ga0207687_10046074 3300025927 Bacteria 3017
128 Ga0207644_10006358 3300025931 Bacteria 7693
129 Ga0207644_10509468 3300025931 Bacteria 993
130 Ga0207706_10230308 3300025933 Bacteria 1621
131 Ga0207669_10155362 3300025937 Bacteria 1608
132 Ga0207691_10068281 3300025940 Bacteria 3212
133 Ga0207691_10085661 3300025940 Bacteria 2828
134 Ga0207711_10352769 3300025941 Bacteria 1362
135 Ga0207661_10021489 3300025944 Bacteria 4835
136 Ga0207661_10254857 3300025944 Bacteria 1561
137 Ga0207667_10075108 3300025949 Bacteria 3510
138 Ga0207667_10084976 3300025949 Bacteria 3276
139 Ga0207667_10164154 3300025949 Bacteria 2284
140 Ga0207667_10255882 3300025949 Bacteria 1791
141 Ga0207651_10009062 3300025960 Bacteria 5417
142 Ga0207651_10048975 3300025960 Bacteria 2860
143 Ga0207677_10181128 3300026023 Bacteria 1657
144 Ga0207708_10080502 3300026075 Bacteria 2503
145 Ga0207702_10144582 3300026078 Bacteria 2156
146 Ga0207641_10211742 3300026088 Bacteria 1793
147 Ga0207676_10015397 3300026095 Bacteria 5515
148 Ga0207674_10265787 3300026116 Bacteria 1663
149 Ga0207683_10354820 3300026121 Bacteria 1346
150 Ga0209974_10009866 3300027876 Bacteria 3230
151 Ga0207428_10033646 3300027907 Bacteria 4207
152 Ga0207428_10065739 3300027907 Bacteria 2859
153 Ga0207428_10129183 3300027907 Bacteria 1934
154 Ga0268266_10007273 3300028379 Bacteria 10011
155 Ga0265337_1003077 3300028556 Bacteria 7359
156 Ga0265318_10000049 3300028577 Bacteria 119684
157 Ga0265318_10000061 3300028577 Bacteria 108688
158 Ga0265318_10097807 3300028577 Bacteria 1080
159 Ga0265338_10061045 3300028800 Bacteria 3306
160 Ga0265760_10020369 3300031090 Bacteria 1914
161 Ga0265330_10000113 3300031235 Bacteria 66221
162 Ga0265330_10002551 3300031235 Bacteria 9894
163 Ga0265332_10000643 3300031238 Bacteria 22735
164 Ga0265332_10137781 3300031238 Bacteria 1023
165 Ga0265328_10000847 3300031239 Bacteria 14199
166 Ga0265328_10010549 3300031239 Bacteria 3715
167 Ga0265320_10000055 3300031240 Bacteria 109446
168 Ga0265320_10001827 3300031240 Bacteria 15091
169 Ga0265320_10004730 3300031240 Bacteria 8866
170 Ga0265320_10005071 3300031240 Bacteria 8514
171 Ga0265320_10019845 3300031240 Bacteria 3662
172 Ga0265320_10027081 3300031240 Bacteria 2993
173 Ga0265329_10004583 3300031242 Bacteria 5716
174 Ga0265329_10004636 3300031242 Bacteria 5671
175 Ga0265339_10001828 3300031249 Bacteria 15611
176 Ga0265339_10031291 3300031249 Bacteria 3008
177 Ga0265339_10037007 3300031249 Bacteria 2728
178 Ga0265331_10000043 3300031250 Bacteria 189515
179 Ga0265331_10002124 3300031250 Bacteria 13640
180 Ga0265331_10010041 3300031250 Bacteria 5264
181 Ga0265316_10005276 3300031344 Bacteria 12609
182 Ga0265316_10117552 3300031344 Bacteria 2010
183 Ga0307509_10088357 3300031507 Bacteria 3182
184 Ga0307408_100011448 3300031548 Bacteria 5862
185 Ga0307408_100023107 3300031548 Bacteria 4233
186 Ga0307408_100188942 3300031548 Bacteria 1658
187 Ga0307408_100208310 3300031548 Bacteria 1587
188 Ga0307408_100287054 3300031548 Bacteria 1373
189 Ga0265313_10000036 3300031595 Bacteria 124141
190 Ga0265313_10000538 3300031595 Bacteria 39535
191 Ga0265313_10017826 3300031595 Bacteria 4013
192 Ga0265313_10025887 3300031595 Bacteria 3101
193 Ga0265314_10002898 3300031711 Bacteria 17026
194 Ga0265314_10006948 3300031711 Bacteria 9907
195 Ga0265314_10007376 3300031711 Bacteria 9543
196 Ga0265314_10026699 3300031711 Bacteria 4334
197 Ga0265342_10000326 3300031712 Bacteria 53802
198 Ga0265342_10003780 3300031712 Bacteria 12207
199 Ga0265342_10010422 3300031712 Bacteria 6449
200 Ga0265342_10018496 3300031712 Bacteria 4513
201 Ga0307405_10057080 3300031731 Bacteria 2451
202 Ga0307405_10166144 3300031731 Bacteria 1569
203 Ga0307405_10190766 3300031731 Bacteria 1480
204 Ga0307413_10002938 3300031824 Bacteria 7045
205 Ga0307413_10007920 3300031824 Bacteria 4973
206 Ga0307410_10004500 3300031852 Bacteria 7218
207 Ga0307410_10041132 3300031852 Bacteria 3046
208 Ga0307410_10382466 3300031852 Bacteria 1133
209 Ga0307406_10025491 3300031901 Bacteria 3541
210 Ga0307406_10028500 3300031901 Bacteria 3375
211 Ga0307406_10052162 3300031901 Bacteria 2600
212 Ga0307406_10103935 3300031901 Bacteria 1941
213 Ga0307407_10069688 3300031903 Bacteria 2088
214 Ga0307412_10021106 3300031911 Bacteria 3974
215 Ga0307412_10082539 3300031911 Bacteria 2226
216 Ga0307409_100031041 3300031995 Bacteria 3849
217 Ga0307409_100336669 3300031995 Bacteria 1418
218 Ga0307416_100001252 3300032002 Bacteria 13696
219 Ga0307416_100002074 3300032002 Bacteria 11298
220 Ga0307416_100002489 3300032002 Bacteria 10595
221 Ga0307416_100019810 3300032002 Bacteria 4781
222 Ga0307416_100080586 3300032002 Bacteria 2749
223 Ga0307416_100494820 3300032002 Bacteria 1286
224 Ga0307414_10041106 3300032004 Bacteria 3128
225 Ga0307414_10073494 3300032004 Bacteria 2474
226 Ga0307414_10143126 3300032004 Bacteria 1875
227 Ga0307414_10334662 3300032004 Bacteria 1294
228 Ga0307411_10002990 3300032005 Bacteria 7695
229 Ga0307411_10016242 3300032005 Bacteria 4212
230 Ga0307411_10031115 3300032005 Bacteria 3279
231 Ga0307415_100004037 3300032126 Bacteria 7567
232 Ga0307415_100005319 3300032126 Bacteria 6819
233 Ga0307415_100008380 3300032126 Bacteria 5722
234 Ga0307415_100067346 3300032126 Bacteria 2502
235 Ga0307415_100192773 3300032126 Bacteria 1610
236 Ga0373950_0000004 3300034818 Bacteria 527382
237 Ga0373932_0030858 3300035112 Bacteria 1489
238 Ga0373957_0044301 3300035120 Bacteria 1683
239 Ga0373961_0000342 3300035241 Bacteria 20468
240 Ga0373931_0094605 3300035691 Bacteria 1671
241 Ga0373931_0271498 3300035691 Bacteria 1038
242 Ga0395899_0000004 3300037312 Bacteria 874267
243 Ga0395899_0022054 3300037312 Bacteria 4829
244 Ga0395900_0019258 3300037418 Bacteria 6958
245 Ga0395905_0010620 3300037471 Bacteria 8937
246 Ga0395901_0001910 3300038443 Bacteria 21454
247 Ga0395901_0285527 3300038443 Bacteria 1714
248 Ga0242420_016928 3300038996 Bacteria 1272
249 Ga0436365_0742888 3300039437 Bacteria 55848
250 Ga0436365_0781711 3300039437 Bacteria 1809
251 Ga0436365_1809723 3300039437 Bacteria 4115
252 Ga0436360_0316453 3300039438 Bacteria 2190
253 Ga0436360_0588717 3300039438 Bacteria 921
254 Ga0436361_0269658 3300039447 Bacteria 3150
255 Ga0436362_0263973 3300039453 Bacteria 1144
256 Ga0436362_1201000 3300039453 Bacteria 4271
257 Ga0451793_1491565 3300041452 Bacteria 8009
258 Ga0451807_0939694 3300041486 Bacteria 1725
259 Ga0439459_0014087 3300042438 Bacteria 1448
260 Ga0439460_0043678 3300042461 Bacteria 1325
261 Ga0451577_0000009 3300042876 Bacteria 646744
262 Ga0451577_0050975 3300042876 Bacteria 3695
263 Ga0439440_0051797 3300042993 Bacteria 1028
264 Ga0453683_0003255 3300044673 Bacteria 12071
265 Ga0453683_0333909 3300044673 Bacteria 972
266 Ga0466963_0048754 3300044694 Bacteria 2800
267 Ga0453684_0000358 3300044712 Bacteria 188931
268 Ga0453684_0007742 3300044712 Bacteria 19613
269 Ga0453684_0009048 3300044712 Bacteria 17577
270 Ga0453684_0012200 3300044712 Bacteria 14241
271 Ga0453684_0054005 3300044712 Bacteria 5238
272 Ga0451576_0003725 3300045051 Bacteria 20614
273 Ga0495638_0000090 3300046460 Bacteria 148040
274 Ga0496100_0468062 3300048903 Bacteria 968
275 Ga0496101_0109912 3300048904 Bacteria 2074
276 Ga0496101_0454106 3300048904 Bacteria 1011
277 Ga0496102_0063531 3300048905 Bacteria 3381
278 Ga0496102_0080038 3300048905 Bacteria 3010
279 Ga0496103_0139348 3300048906 Bacteria 1551
280 Ga0496104_0034440 3300048907 Bacteria 4723
281 Ga0496104_0059045 3300048907 Bacteria 3631
282 Ga0496104_0190746 3300048907 Bacteria 1961
283 Ga0496104_0413808 3300048907 Bacteria 1260
284 Ga0496106_0143752 3300048909 Bacteria 1878
285 Ga0496107_0130826 3300048910 Bacteria 1853
286 Ga0496108_0012746 3300048911 Bacteria 6845
287 Ga0496108_0033157 3300048911 Bacteria 4290
288 Ga0496108_0054607 3300048911 Bacteria 3352
289 Ga0496109_0001067 3300048912 Bacteria 22713
290 Ga0496109_0096271 3300048912 Bacteria 2742
291 Ga0496110_0003128 3300048913 Bacteria 12571
292 Ga0496110_0145495 3300048913 Bacteria 2143
293 Ga0496111_0029632 3300048914 Bacteria 3888
294 Ga0496112_0000833 3300048915 Bacteria 21956
295 Ga0496112_0009455 3300048915 Bacteria 8785
296 Ga0496112_0304747 3300048915 Bacteria 1538
297 Ga0496112_0710064 3300048915 Unclassified 933
298 Ga0496113_0000535 3300048916 Bacteria 18744
299 Ga0496113_0024153 3300048916 Bacteria 4316
300 Ga0496113_0118745 3300048916 Bacteria 2065
301 Ga0496115_0068025 3300048918 Bacteria 2883
302 Ga0501294_002189 3300049517 Bacteria 1872
303 Ga0501034_0405142 3300049571 Bacteria 1286
304 Ga0501036_0005738 3300049572 Bacteria 10072
305 Ga0501038_0402476 3300049574 Bacteria 1059
306 Ga0501039_0029378 3300049575 Bacteria 4234
307 Ga0501039_0214360 3300049575 Bacteria 1514
308 Ga0501040_0051432 3300049576 Bacteria 2818
309 Ga0501041_0005683 3300049577 Bacteria 7286
310 Ga0501041_0016666 3300049577 Bacteria 4372
311 Ga0501041_0022361 3300049577 Bacteria 3785
312 Ga0501041_0280757 3300049577 Bacteria 1048
313 Ga0501042_0034928 3300049578 Bacteria 3567
314 Ga0501046_0028218 3300049580 Bacteria 4573
315 Ga0501046_0036869 3300049580 Bacteria 3933
316 Ga0501048_0030262 3300049582 Bacteria 3917
317 Ga0501067_0000036 3300049583 Bacteria 83409
318 Ga0501067_0055259 3300049583 Bacteria 2200
319 Ga0501067_0066470 3300049583 Bacteria 1995
320 Ga0501067_0233677 3300049583 Bacteria 1023
321 Ga0501069_0051359 3300049585 Bacteria 2294
322 Ga0501069_0171736 3300049585 Bacteria 1251
323 Ga0501070_0000019 3300049586 Bacteria 171935
324 Ga0501071_0008526 3300049587 Bacteria 6781
325 Ga0501072_0017785 3300049588 Bacteria 5466
326 Ga0501072_0062522 3300049588 Bacteria 2937
327 Ga0501073_0000097 3300049589 Bacteria 55680
328 Ga0501074_0028634 3300049590 Bacteria 4038
329 Ga0501074_0035863 3300049590 Bacteria 3593
330 Ga0501075_0013025 3300049591 Bacteria 5927
331 Ga0501075_0068827 3300049591 Bacteria 2675
332 Ga0501076_0069304 3300049592 Bacteria 2818
333 Ga0501076_0089582 3300049592 Bacteria 2473
334 Ga0501077_0008511 3300049593 Bacteria 6358
335 Ga0501077_0009846 3300049593 Bacteria 5945
336 Ga0501217_037546 3300049661 Bacteria 1220
337 Ga0501243_001744 3300049675 Bacteria 3141
338 Ga0501249_003273 3300049679 Bacteria 3260
339 Ga0501252_023876 3300049682 Bacteria 815
340 Ga0501221_027926 3300049704 Bacteria 1157
341 Ga0501225_0030941 3300049705 Bacteria 1473
342 Ga0501079_0014722 3300049741 Bacteria 5961
343 Ga0501079_0027691 3300049741 Bacteria 4347
344 Ga0501079_0054194 3300049741 Bacteria 3093
345 Ga0501079_0122545 3300049741 Bacteria 2022
346 Ga0501079_0146336 3300049741 Bacteria 1841
347 Ga0501080_0026624 3300049742 Bacteria 5373
348 Ga0501080_0057726 3300049742 Bacteria 3613
349 Ga0501080_0401232 3300049742 Bacteria 1233
350 Ga0501080_0408878 3300049742 Bacteria 1220
351 Ga0501081_0014807 3300049743 Bacteria 5148
352 Ga0501081_0027763 3300049743 Bacteria 3816
353 Ga0501081_0352102 3300049743 Bacteria 1085
354 Ga0501083_0003603 3300049744 Bacteria 10861
355 Ga0501083_0012214 3300049744 Bacteria 6011
356 Ga0501083_0015170 3300049744 Bacteria 5394
357 Ga0501083_0072699 3300049744 Bacteria 2286
358 Ga0501268_005590 3300049765 Bacteria 1813
359 Ga0501273_002730 3300049770 Bacteria 1819
360 Ga0501035_0258344 3300049822 Bacteria 1477
361 Ga0501045_0156099 3300049824 Bacteria 1698
362 nmdc:mga03683_1075_c1 3300050489 Bacteria 8004
363 nmdc:mga0yw44_33917_c1 3300050492 Bacteria 2986
364 nmdc:mga0k408_351_c1 3300050493 Bacteria 25242
365 nmdc:mga0k408_437_c1 3300050493 Bacteria 22803
366 nmdc:mga05p37_443454_c1 3300050507 Bacteria 1505
367 nmdc:mga0qj67_18456_c1 3300050509 Bacteria 4308
368 nmdc:mga0qj67_39250_c1 3300050509 Bacteria 3717
369 nmdc:mga06r32_140303_c1 3300050510 Bacteria 2392
370 nmdc:mga06r32_176217_c1 3300050510 Bacteria 2123
371 nmdc:mga06r32_615603_c1 3300050510 Bacteria 1056
372 nmdc:mga08y16_211269_c1 3300050511 Bacteria 2010
373 nmdc:mga08y16_47720_c1 3300050511 Bacteria 4482
374 nmdc:mga08y16_4847_c1 3300050511 Bacteria 14042
375 nmdc:mga0n895_23500_c1 3300050512 Bacteria 5795
376 nmdc:mga0n895_26939_c1 3300050512 Bacteria 5453
377 nmdc:mga0n895_45620_c1 3300050512 Bacteria 4277
378 nmdc:mga0n895_4726_c1 3300050512 Bacteria 11245
379 nmdc:mga0rr50_18534_c1 3300050513 Bacteria 4678
380 nmdc:mga0rr50_206073_c1 3300050513 Bacteria 1618
381 nmdc:mga08x19_67652_c1 3300050514 Bacteria 2324
382 nmdc:mga08x19_7025_c1 3300050514 Bacteria 6684
383 nmdc:mga0a205_17310_c1 3300050515 Bacteria 6753
384 nmdc:mga0a205_31976_c1 3300050515 Bacteria 5044
385 nmdc:mga0a205_51485_c1 3300050515 Bacteria 3975
386 Ga0500641_0000593 3300053096 Bacteria 13063
387 Ga0500641_0015004 3300053096 Bacteria 2868
388 Ga0500555_000391 3300053103 Bacteria 18414
389 Ga0500556_0000897 3300053104 Bacteria 16623
390 Ga0500616_0000436 3300053153 Bacteria 55137
391 Ga0501084_0001331 3300054114 Bacteria 19487
392 Ga0501084_0017922 3300054114 Bacteria 5896
393 Ga0501084_0377780 3300054114 Bacteria 1198
394 Ga0590071_000607 3300059421 Bacteria 10258
395 Ga0590071_006544 3300059421 Bacteria 2770
396 Ga0590075_014937 3300059424 Bacteria 1902
397 Ga0590075_018071 3300059424 Bacteria 1742
398 Ga0501082_0013117 3300060353 Bacteria 7125
399 Ga0501082_0025406 3300060353 Bacteria 5104
400 Ga0501082_0055845 3300060353 Bacteria 3401
401 Ga0501082_0283685 3300060353 Bacteria 1441
402 Ga0530510_0047403 3300061734 Bacteria 3105
403 Ga0530510_0076303 3300061734 Bacteria 2435
404 Ga0530510_0161942 3300061734 Bacteria 1655
405 Ga0530510_0236245 3300061734 Bacteria 1360
406 Ga0530510_0244167 3300061734 Bacteria 1337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0258344 Ga0501035_0258344_352_1194 224
2 3300014326 Ga0157380_10032615 Ga0157380_100326154 231
3 3300049571 Ga0501034_0405142 Ga0501034_0405142_271_1107 238
4 3300031090 Ga0265760_10020369 Ga0265760_100203693 239
5 3300031240 Ga0265320_10027081 Ga0265320_100270812 240
6 3300005355 Ga0070671_100008234 Ga0070671_1000082343 242
7 3300025931 Ga0207644_10006358 Ga0207644_100063582 242
8 3300025917 Ga0207660_10242845 Ga0207660_102428452 244
9 3300006173 Ga0070716_100237899 Ga0070716_1002378992 246
10 3300031507 Ga0307509_10088357 Ga0307509_100883572 246
11 3300005353 Ga0070669_100000033 Ga0070669_10000003322 247
12 3300025923 Ga0207681_10000011 Ga0207681_10000011201 247
13 3300005331 Ga0070670_100000315 Ga0070670_10000031517 248
14 3300025925 Ga0207650_10001035 Ga0207650_1000103520 248
15 3300038996 Ga0242420_016928 Ga0242420_016928_478_1239 248
16 3300049583 Ga0501067_0233677 Ga0501067_0233677_23_775 248
17 3300049585 Ga0501069_0171736 Ga0501069_0171736_310_1062 248
18 3300050489 nmdc:mga03683_1075_c1 nmdc:mga03683_1075_c1_5202_5960 248
19 3300050509 nmdc:mga0qj67_39250_c1 nmdc:mga0qj67_39250_c1_594_1346 248
20 3300050510 nmdc:mga06r32_176217_c1 nmdc:mga06r32_176217_c1_791_1543 248
21 3300050512 nmdc:mga0n895_45620_c1 nmdc:mga0n895_45620_c1_713_1465 248
22 3300050515 nmdc:mga0a205_31976_c1 nmdc:mga0a205_31976_c1_1805_2557 248
23 3300005456 Ga0070678_100333423 Ga0070678_1003334231 250
24 3300026121 Ga0207683_10354820 Ga0207683_103548202 250
25 3300041486 Ga0451807_0939694 Ga0451807_0939694_620_1555 250
26 3300048915 Ga0496112_0710064 Ga0496112_0710064_45_875 251
27 3300050512 nmdc:mga0n895_23500_c1 nmdc:mga0n895_23500_c1_2597_3412 251
28 3300005530 Ga0070679_100074750 Ga0070679_1000747504 252
29 3300025921 Ga0207652_10077869 Ga0207652_100778693 252
30 3300050514 nmdc:mga08x19_7025_c1 nmdc:mga08x19_7025_c1_3521_4339 252
31 3300053153 Ga0500616_0000436 Ga0500616_0000436_20248_21099 252
32 3300028556 Ga0265337_1003077 Ga0265337_10030775 253
33 3300031240 Ga0265320_10001827 Ga0265320_100018278 253
34 3300031250 Ga0265331_10010041 Ga0265331_100100413 253
35 3300031595 Ga0265313_10000538 Ga0265313_1000053812 253
36 3300042993 Ga0439440_0051797 Ga0439440_0051797_141_953 253
37 3300031240 Ga0265320_10005071 Ga0265320_100050719 254
38 3300053096 Ga0500641_0015004 Ga0500641_0015004_50_862 254
39 3300005471 Ga0070698_100004995 Ga0070698_1000049953 255
40 3300005518 Ga0070699_100053121 Ga0070699_1000531213 255
41 3300005536 Ga0070697_100026405 Ga0070697_1000264053 255
42 3300005355 Ga0070671_100506935 Ga0070671_1005069351 256
43 3300005618 Ga0068864_100013022 Ga0068864_1000130224 256
44 3300009098 Ga0105245_10003461 Ga0105245_1000346117 256
45 3300009177 Ga0105248_10513994 Ga0105248_105139941 256
46 3300013308 Ga0157375_10010290 Ga0157375_100102902 256
47 3300014325 Ga0163163_10000581 Ga0163163_100005819 256
48 3300021361 Ga0213872_10028989 Ga0213872_100289892 256
49 3300025927 Ga0207687_10046074 Ga0207687_100460743 256
50 3300025931 Ga0207644_10509468 Ga0207644_105094681 256
51 3300025941 Ga0207711_10352769 Ga0207711_103527691 256
52 3300026095 Ga0207676_10015397 Ga0207676_100153973 256
53 3300039453 Ga0436362_0263973 Ga0436362_0263973_206_1060 256
54 3300048907 Ga0496104_0190746 Ga0496104_0190746_234_1010 256
55 3300049585 Ga0501069_0051359 Ga0501069_0051359_853_1623 256
56 3300049586 Ga0501070_0000019 Ga0501070_0000019_166212_166982 256
57 3300049590 Ga0501074_0035863 Ga0501074_0035863_1616_2386 256
58 3300049741 Ga0501079_0146336 Ga0501079_0146336_650_1420 256
59 3300049742 Ga0501080_0026624 Ga0501080_0026624_3901_4671 256
60 3300049742 Ga0501080_0401232 Ga0501080_0401232_201_971 256
61 3300049743 Ga0501081_0352102 Ga0501081_0352102_76_846 256
62 3300049744 Ga0501083_0012214 Ga0501083_0012214_5182_5952 256
63 3300049744 Ga0501083_0015170 Ga0501083_0015170_481_1251 256
64 3300054114 Ga0501084_0377780 Ga0501084_0377780_285_1055 256
65 3300060353 Ga0501082_0055845 Ga0501082_0055845_1860_2630 256
66 3300061734 Ga0530510_0236245 Ga0530510_0236245_537_1307 256
67 3300005563 Ga0068855_100004225 Ga0068855_1000042258 257
68 3300009093 Ga0105240_10000636 Ga0105240_1000063653 257
69 3300013104 Ga0157370_10014757 Ga0157370_100147572 257
70 3300025898 Ga0207692_10038562 Ga0207692_100385622 257
71 3300025912 Ga0207707_10152572 Ga0207707_101525722 257
72 3300025913 Ga0207695_10001937 Ga0207695_100019372 257
73 3300025913 Ga0207695_10002354 Ga0207695_100023549 257
74 3300025944 Ga0207661_10254857 Ga0207661_102548572 257
75 3300028800 Ga0265338_10061045 Ga0265338_100610452 257
76 3300031249 Ga0265339_10037007 Ga0265339_100370072 257
77 3300035120 Ga0373957_0044301 Ga0373957_0044301_792_1622 257
78 3300005445 Ga0070708_100161814 Ga0070708_1001618141 258
79 3300005471 Ga0070698_100002008 Ga0070698_1000020084 258
80 3300005518 Ga0070699_100001531 Ga0070699_1000015315 258
81 3300005841 Ga0068863_100458389 Ga0068863_1004583892 258
82 3300006914 Ga0075436_100004319 Ga0075436_1000043197 258
83 3300037312 Ga0395899_0022054 Ga0395899_0022054_2977_3795 258
84 3300037418 Ga0395900_0019258 Ga0395900_0019258_2620_3438 258
85 3300037471 Ga0395905_0010620 Ga0395905_0010620_5506_6324 258
86 3300038443 Ga0395901_0001910 Ga0395901_0001910_14678_15496 258
87 3300049682 Ga0501252_023876 Ga0501252_023876_21_803 258
88 3300050513 nmdc:mga0rr50_18534_c1 nmdc:mga0rr50_18534_c1_2395_3252 258
89 3300005981 Ga0081538_10003182 Ga0081538_100031829 259
90 3300006038 Ga0075365_10047398 Ga0075365_100473981 259
91 3300006852 Ga0075433_10152958 Ga0075433_101529582 259
92 3300006871 Ga0075434_100052985 Ga0075434_1000529852 259
93 3300009093 Ga0105240_10001676 Ga0105240_1000167616 259
94 3300013296 Ga0157374_10121398 Ga0157374_101213983 259
95 3300014325 Ga0163163_10502282 Ga0163163_105022822 259
96 3300014968 Ga0157379_10128566 Ga0157379_101285663 259
97 3300014969 Ga0157376_10381126 Ga0157376_103811261 259
98 3300044712 Ga0453684_0009048 Ga0453684_0009048_14241_15110 259
99 3300050492 nmdc:mga0yw44_33917_c1 nmdc:mga0yw44_33917_c1_229_1065 259
100 3300050515 nmdc:mga0a205_51485_c1 nmdc:mga0a205_51485_c1_2329_3162 259
101 3300005330 Ga0070690_100133624 Ga0070690_1001336242 260
102 3300005546 Ga0070696_100245072 Ga0070696_1002450721 260
103 3300005546 Ga0070696_100265928 Ga0070696_1002659282 260
104 3300006844 Ga0075428_100595525 Ga0075428_1005955252 260
105 3300006871 Ga0075434_100025849 Ga0075434_1000258493 260
106 3300007265 Ga0099794_10035852 Ga0099794_100358522 260
107 3300009094 Ga0111539_10303011 Ga0111539_103030112 260
108 3300009147 Ga0114129_10637489 Ga0114129_106374892 260
109 3300014497 Ga0182008_10098425 Ga0182008_100984252 260
110 3300037312 Ga0395899_0000004 Ga0395899_0000004_271197_272045 260
111 3300048904 Ga0496101_0454106 Ga0496101_0454106_79_942 260
112 3300048905 Ga0496102_0080038 Ga0496102_0080038_936_1724 260
113 3300048910 Ga0496107_0130826 Ga0496107_0130826_628_1452 260
114 3300048915 Ga0496112_0304747 Ga0496112_0304747_307_1131 260
115 3300048918 Ga0496115_0068025 Ga0496115_0068025_1441_2229 260
116 3300050507 nmdc:mga05p37_443454_c1 nmdc:mga05p37_443454_c1_215_1048 260
117 3300005563 Ga0068855_100129804 Ga0068855_1001298042 261
118 3300006847 Ga0075431_100098469 Ga0075431_1000984693 261
119 3300025949 Ga0207667_10075108 Ga0207667_100751082 261
120 3300028577 Ga0265318_10000061 Ga0265318_1000006130 261
121 3300031235 Ga0265330_10002551 Ga0265330_100025513 261
122 3300031239 Ga0265328_10000847 Ga0265328_1000084711 261
123 3300031240 Ga0265320_10004730 Ga0265320_100047304 261
124 3300031242 Ga0265329_10004636 Ga0265329_100046363 261
125 3300031250 Ga0265331_10002124 Ga0265331_100021249 261
126 3300031711 Ga0265314_10007376 Ga0265314_100073762 261
127 3300031712 Ga0265342_10003780 Ga0265342_100037808 261
128 3300035241 Ga0373961_0000342 Ga0373961_0000342_1468_2367 261
129 3300039438 Ga0436360_0588717 Ga0436360_0588717_37_867 261
130 3300039453 Ga0436362_1201000 Ga0436362_1201000_2861_3691 261
131 3300050512 nmdc:mga0n895_4726_c1 nmdc:mga0n895_4726_c1_5102_5917 261
132 3300050514 nmdc:mga08x19_67652_c1 nmdc:mga08x19_67652_c1_1185_2000 261
133 3300005356 Ga0070674_100204111 Ga0070674_1002041112 262
134 3300025937 Ga0207669_10155362 Ga0207669_101553622 262
135 3300039437 Ga0436365_0781711 Ga0436365_0781711_930_1781 262
136 3300049744 Ga0501083_0003603 Ga0501083_0003603_766_1650 263
137 3300006846 Ga0075430_100022764 Ga0075430_1000227647 265
138 3300006847 Ga0075431_100273517 Ga0075431_1002735171 265
139 3300025910 Ga0207684_10001346 Ga0207684_100013464 265
140 3300050509 nmdc:mga0qj67_18456_c1 nmdc:mga0qj67_18456_c1_2759_3637 265
141 3300050510 nmdc:mga06r32_140303_c1 nmdc:mga06r32_140303_c1_637_1515 265
142 3300041452 Ga0451793_1491565 Ga0451793_1491565_1233_2057 266
143 3300042438 Ga0439459_0014087 Ga0439459_0014087_599_1423 266
144 3300042461 Ga0439460_0043678 Ga0439460_0043678_410_1216 266
145 3300042876 Ga0451577_0050975 Ga0451577_0050975_1965_2774 266
146 3300046460 Ga0495638_0000090 Ga0495638_0000090_20068_20892 266
147 3300049574 Ga0501038_0402476 Ga0501038_0402476_15_821 266
148 3300049577 Ga0501041_0022361 Ga0501041_0022361_2535_3341 266
149 3300050511 nmdc:mga08y16_47720_c1 nmdc:mga08y16_47720_c1_2890_3696 266
150 3300005563 Ga0068855_100148048 Ga0068855_1001480482 267
151 3300025921 Ga0207652_10002124 Ga0207652_100021246 267
152 3300039437 Ga0436365_1809723 Ga0436365_1809723_2752_3597 267
153 3300044712 Ga0453684_0007742 Ga0453684_0007742_4413_5246 267
154 3300044673 Ga0453683_0333909 Ga0453683_0333909_50_859 268
155 3300059421 Ga0590071_006544 Ga0590071_006544_860_1687 268
156 3300059424 Ga0590075_018071 Ga0590075_018071_25_852 268
157 3300005549 Ga0070704_100252133 Ga0070704_1002521332 269
158 3300006871 Ga0075434_100005385 Ga0075434_1000053854 269
159 3300006871 Ga0075434_100009973 Ga0075434_1000099734 269
160 3300006914 Ga0075436_100009187 Ga0075436_1000091872 269
161 3300007076 Ga0075435_100175573 Ga0075435_1001755732 269
162 3300007076 Ga0075435_100198615 Ga0075435_1001986152 269
163 3300009094 Ga0111539_10004321 Ga0111539_100043217 269
164 3300027907 Ga0207428_10033646 Ga0207428_100336462 269
165 3300050511 nmdc:mga08y16_4847_c1 nmdc:mga08y16_4847_c1_3148_3975 269
166 3300050512 nmdc:mga0n895_26939_c1 nmdc:mga0n895_26939_c1_2716_3543 269
167 3300050513 nmdc:mga0rr50_206073_c1 nmdc:mga0rr50_206073_c1_711_1538 269
168 iso_pu_bacteria 2857465823 2857469810 269
169 3300031240 Ga0265320_10019845 Ga0265320_100198453 270
170 3300031344 Ga0265316_10117552 Ga0265316_101175522 270
171 3300031595 Ga0265313_10017826 Ga0265313_100178262 270
172 3300053096 Ga0500641_0000593 Ga0500641_0000593_661_1485 270
173 iso_pu_bacteria 2738541295 2738813279 270
174 iso_pu_bacteria 3001892409 3001895833 270
175 3300005578 Ga0068854_100479752 Ga0068854_1004797521 271
176 3300006358 Ga0068871_100113169 Ga0068871_1001131693 271
177 3300009147 Ga0114129_10202070 Ga0114129_102020701 271
178 3300031595 Ga0265313_10025887 Ga0265313_100258871 271
179 3300005467 Ga0070706_100171187 Ga0070706_1001711872 272
180 3300005468 Ga0070707_100049934 Ga0070707_1000499343 272
181 3300005471 Ga0070698_100587675 Ga0070698_1005876752 272
182 3300021384 Ga0213876_10004571 Ga0213876_1000457110 272
183 3300025910 Ga0207684_10162491 Ga0207684_101624912 272
184 3300025922 Ga0207646_10079919 Ga0207646_100799193 272
185 3300031249 Ga0265339_10001828 Ga0265339_1000182810 272
186 3300031711 Ga0265314_10026699 Ga0265314_100266994 272
187 3300031712 Ga0265342_10018496 Ga0265342_100184962 272
188 3300034818 Ga0373950_0000004 Ga0373950_0000004_281015_281851 272
189 3300039437 Ga0436365_0742888 Ga0436365_0742888_26255_27133 272
190 3300048904 Ga0496101_0109912 Ga0496101_0109912_944_1768 272
191 3300048907 Ga0496104_0059045 Ga0496104_0059045_379_1203 272
192 3300048911 Ga0496108_0033157 Ga0496108_0033157_1569_2393 272
193 3300048912 Ga0496109_0096271 Ga0496109_0096271_1438_2262 272
194 3300048913 Ga0496110_0145495 Ga0496110_0145495_218_1042 272
195 3300048914 Ga0496111_0029632 Ga0496111_0029632_1996_2820 272
196 3300048916 Ga0496113_0024153 Ga0496113_0024153_3056_3880 272
197 3300049583 Ga0501067_0000036 Ga0501067_0000036_65556_66392 272
198 3300049583 Ga0501067_0066470 Ga0501067_0066470_750_1586 272
199 3300049589 Ga0501073_0000097 Ga0501073_0000097_28391_29227 272
200 3300049742 Ga0501080_0408878 Ga0501080_0408878_356_1201 272
201 3300060353 Ga0501082_0013117 Ga0501082_0013117_4942_5787 272
202 3300005330 Ga0070690_100373144 Ga0070690_1003731441 273
203 3300005440 Ga0070705_100044656 Ga0070705_1000446563 273
204 3300005441 Ga0070700_100104962 Ga0070700_1001049622 273
205 3300005445 Ga0070708_100023540 Ga0070708_1000235402 273
206 3300005467 Ga0070706_100008439 Ga0070706_1000084395 273
207 3300005468 Ga0070707_100448194 Ga0070707_1004481942 273
208 3300005518 Ga0070699_100005205 Ga0070699_10000520510 273
209 3300005530 Ga0070679_100000518 Ga0070679_10000051810 273
210 3300005530 Ga0070679_100219851 Ga0070679_1002198512 273
211 3300005535 Ga0070684_100127234 Ga0070684_1001272341 273
212 3300005544 Ga0070686_100074874 Ga0070686_1000748742 273
213 3300005546 Ga0070696_100000412 Ga0070696_10000041212 273
214 3300005547 Ga0070693_100106953 Ga0070693_1001069532 273
215 3300005563 Ga0068855_100031455 Ga0068855_1000314553 273
216 3300005563 Ga0068855_100797838 Ga0068855_1007978381 273
217 3300005578 Ga0068854_100196939 Ga0068854_1001969392 273
218 3300005614 Ga0068856_100187295 Ga0068856_1001872952 273
219 3300005617 Ga0068859_100021974 Ga0068859_1000219742 273
220 3300006048 Ga0075363_100008892 Ga0075363_1000088922 273
221 3300006177 Ga0075362_10015343 Ga0075362_100153432 273
222 3300006195 Ga0075366_10008671 Ga0075366_100086713 273
223 3300006353 Ga0075370_10027086 Ga0075370_100270864 273
224 3300006846 Ga0075430_100041138 Ga0075430_1000411382 273
225 3300006847 Ga0075431_100002818 Ga0075431_10000281811 273
226 3300006847 Ga0075431_100176565 Ga0075431_1001765652 273
227 3300006852 Ga0075433_10006861 Ga0075433_100068613 273
228 3300006871 Ga0075434_100022809 Ga0075434_1000228091 273
229 3300006881 Ga0068865_100146583 Ga0068865_1001465832 273
230 3300006931 Ga0097620_100021975 Ga0097620_1000219752 273
231 3300009094 Ga0111539_10135669 Ga0111539_101356692 273
232 3300009545 Ga0105237_10233515 Ga0105237_102335152 273
233 3300009551 Ga0105238_10023992 Ga0105238_100239923 273
234 3300014325 Ga0163163_10075055 Ga0163163_100750551 273
235 3300021361 Ga0213872_10023602 Ga0213872_100236023 273
236 3300025917 Ga0207660_10214356 Ga0207660_102143562 273
237 3300025921 Ga0207652_10000539 Ga0207652_1000053925 273
238 3300025924 Ga0207694_10013557 Ga0207694_100135573 273
239 3300025933 Ga0207706_10230308 Ga0207706_102303082 273
240 3300025949 Ga0207667_10084976 Ga0207667_100849762 273
241 3300025949 Ga0207667_10164154 Ga0207667_101641542 273
242 3300025949 Ga0207667_10255882 Ga0207667_102558821 273
243 3300026023 Ga0207677_10181128 Ga0207677_101811282 273
244 3300026075 Ga0207708_10080502 Ga0207708_100805022 273
245 3300026078 Ga0207702_10144582 Ga0207702_101445822 273
246 3300026116 Ga0207674_10265787 Ga0207674_102657872 273
247 3300027876 Ga0209974_10009866 Ga0209974_100098663 273
248 3300027907 Ga0207428_10065739 Ga0207428_100657392 273
249 3300028577 Ga0265318_10000049 Ga0265318_1000004918 273
250 3300028577 Ga0265318_10097807 Ga0265318_100978071 273
251 3300031235 Ga0265330_10000113 Ga0265330_1000011352 273
252 3300031238 Ga0265332_10000643 Ga0265332_100006437 273
253 3300031238 Ga0265332_10137781 Ga0265332_101377812 273
254 3300031239 Ga0265328_10010549 Ga0265328_100105491 273
255 3300031240 Ga0265320_10000055 Ga0265320_1000005572 273
256 3300031242 Ga0265329_10004583 Ga0265329_100045832 273
257 3300031249 Ga0265339_10031291 Ga0265339_100312912 273
258 3300031250 Ga0265331_10000043 Ga0265331_1000004318 273
259 3300031344 Ga0265316_10005276 Ga0265316_1000527610 273
260 3300031548 Ga0307408_100011448 Ga0307408_1000114484 273
261 3300031548 Ga0307408_100023107 Ga0307408_1000231073 273
262 3300031548 Ga0307408_100188942 Ga0307408_1001889422 273
263 3300031548 Ga0307408_100208310 Ga0307408_1002083101 273
264 3300031548 Ga0307408_100287054 Ga0307408_1002870542 273
265 3300031595 Ga0265313_10000036 Ga0265313_1000003691 273
266 3300031711 Ga0265314_10002898 Ga0265314_1000289814 273
267 3300031712 Ga0265342_10010422 Ga0265342_100104223 273
268 3300031731 Ga0307405_10057080 Ga0307405_100570801 273
269 3300031731 Ga0307405_10166144 Ga0307405_101661441 273
270 3300031731 Ga0307405_10190766 Ga0307405_101907662 273
271 3300031824 Ga0307413_10002938 Ga0307413_100029381 273
272 3300031824 Ga0307413_10007920 Ga0307413_100079204 273
273 3300031852 Ga0307410_10004500 Ga0307410_100045008 273
274 3300031852 Ga0307410_10041132 Ga0307410_100411322 273
275 3300031852 Ga0307410_10382466 Ga0307410_103824662 273
276 3300031901 Ga0307406_10025491 Ga0307406_100254913 273
277 3300031901 Ga0307406_10028500 Ga0307406_100285002 273
278 3300031901 Ga0307406_10052162 Ga0307406_100521623 273
279 3300031901 Ga0307406_10103935 Ga0307406_101039352 273
280 3300031903 Ga0307407_10069688 Ga0307407_100696882 273
281 3300031911 Ga0307412_10021106 Ga0307412_100211061 273
282 3300031911 Ga0307412_10082539 Ga0307412_100825391 273
283 3300031995 Ga0307409_100031041 Ga0307409_1000310414 273
284 3300031995 Ga0307409_100336669 Ga0307409_1003366692 273
285 3300032002 Ga0307416_100001252 Ga0307416_1000012525 273
286 3300032002 Ga0307416_100002074 Ga0307416_1000020748 273
287 3300032002 Ga0307416_100002489 Ga0307416_1000024899 273
288 3300032002 Ga0307416_100019810 Ga0307416_1000198103 273
289 3300032002 Ga0307416_100080586 Ga0307416_1000805863 273
290 3300032002 Ga0307416_100494820 Ga0307416_1004948201 273
291 3300032004 Ga0307414_10041106 Ga0307414_100411062 273
292 3300032004 Ga0307414_10073494 Ga0307414_100734942 273
293 3300032004 Ga0307414_10143126 Ga0307414_101431262 273
294 3300032004 Ga0307414_10334662 Ga0307414_103346622 273
295 3300032005 Ga0307411_10002990 Ga0307411_100029905 273
296 3300032005 Ga0307411_10016242 Ga0307411_100162423 273
297 3300032005 Ga0307411_10031115 Ga0307411_100311153 273
298 3300032126 Ga0307415_100004037 Ga0307415_1000040372 273
299 3300032126 Ga0307415_100005319 Ga0307415_1000053195 273
300 3300032126 Ga0307415_100008380 Ga0307415_1000083804 273
301 3300032126 Ga0307415_100067346 Ga0307415_1000673462 273
302 3300032126 Ga0307415_100192773 Ga0307415_1001927732 273
303 3300035112 Ga0373932_0030858 Ga0373932_0030858_293_1126 273
304 3300035691 Ga0373931_0094605 Ga0373931_0094605_421_1254 273
305 3300035691 Ga0373931_0271498 Ga0373931_0271498_22_855 273
306 3300038443 Ga0395901_0285527 Ga0395901_0285527_353_1186 273
307 3300039438 Ga0436360_0316453 Ga0436360_0316453_1087_1938 273
308 3300039447 Ga0436361_0269658 Ga0436361_0269658_1675_2526 273
309 3300048903 Ga0496100_0468062 Ga0496100_0468062_41_874 273
310 3300048905 Ga0496102_0063531 Ga0496102_0063531_2251_3084 273
311 3300048906 Ga0496103_0139348 Ga0496103_0139348_118_960 273
312 3300048907 Ga0496104_0034440 Ga0496104_0034440_578_1411 273
313 3300048907 Ga0496104_0413808 Ga0496104_0413808_109_942 273
314 3300048909 Ga0496106_0143752 Ga0496106_0143752_270_1103 273
315 3300048911 Ga0496108_0012746 Ga0496108_0012746_3371_4204 273
316 3300048911 Ga0496108_0054607 Ga0496108_0054607_1380_2213 273
317 3300048912 Ga0496109_0001067 Ga0496109_0001067_5744_6577 273
318 3300048913 Ga0496110_0003128 Ga0496110_0003128_4279_5112 273
319 3300048915 Ga0496112_0000833 Ga0496112_0000833_13313_14146 273
320 3300048915 Ga0496112_0009455 Ga0496112_0009455_3438_4271 273
321 3300048916 Ga0496113_0000535 Ga0496113_0000535_15771_16604 273
322 3300048916 Ga0496113_0118745 Ga0496113_0118745_83_916 273
323 3300049517 Ga0501294_002189 Ga0501294_002189_844_1671 273
324 3300049572 Ga0501036_0005738 Ga0501036_0005738_2793_3620 273
325 3300049575 Ga0501039_0029378 Ga0501039_0029378_1838_2671 273
326 3300049575 Ga0501039_0214360 Ga0501039_0214360_411_1244 273
327 3300049576 Ga0501040_0051432 Ga0501040_0051432_1496_2329 273
328 3300049577 Ga0501041_0005683 Ga0501041_0005683_1715_2542 273
329 3300049577 Ga0501041_0016666 Ga0501041_0016666_1423_2256 273
330 3300049577 Ga0501041_0280757 Ga0501041_0280757_195_1022 273
331 3300049578 Ga0501042_0034928 Ga0501042_0034928_2692_3525 273
332 3300049580 Ga0501046_0028218 Ga0501046_0028218_1177_2010 273
333 3300049580 Ga0501046_0036869 Ga0501046_0036869_2839_3666 273
334 3300049582 Ga0501048_0030262 Ga0501048_0030262_2431_3264 273
335 3300049583 Ga0501067_0055259 Ga0501067_0055259_1341_2174 273
336 3300049587 Ga0501071_0008526 Ga0501071_0008526_2992_3825 273
337 3300049588 Ga0501072_0017785 Ga0501072_0017785_1188_2021 273
338 3300049588 Ga0501072_0062522 Ga0501072_0062522_878_1705 273
339 3300049590 Ga0501074_0028634 Ga0501074_0028634_1615_2442 273
340 3300049591 Ga0501075_0013025 Ga0501075_0013025_4116_4949 273
341 3300049591 Ga0501075_0068827 Ga0501075_0068827_1819_2649 273
342 3300049592 Ga0501076_0069304 Ga0501076_0069304_858_1685 273
343 3300049592 Ga0501076_0089582 Ga0501076_0089582_1492_2325 273
344 3300049593 Ga0501077_0008511 Ga0501077_0008511_613_1446 273
345 3300049593 Ga0501077_0009846 Ga0501077_0009846_3391_4224 273
346 3300049661 Ga0501217_037546 Ga0501217_037546_257_1084 273
347 3300049675 Ga0501243_001744 Ga0501243_001744_575_1402 273
348 3300049679 Ga0501249_003273 Ga0501249_003273_576_1403 273
349 3300049704 Ga0501221_027926 Ga0501221_027926_71_898 273
350 3300049705 Ga0501225_0030941 Ga0501225_0030941_40_867 273
351 3300049741 Ga0501079_0014722 Ga0501079_0014722_4498_5331 273
352 3300049741 Ga0501079_0027691 Ga0501079_0027691_561_1394 273
353 3300049741 Ga0501079_0054194 Ga0501079_0054194_578_1405 273
354 3300049741 Ga0501079_0122545 Ga0501079_0122545_837_1724 273
355 3300049742 Ga0501080_0057726 Ga0501080_0057726_1729_2562 273
356 3300049743 Ga0501081_0014807 Ga0501081_0014807_1807_2634 273
357 3300049743 Ga0501081_0027763 Ga0501081_0027763_288_1121 273
358 3300049744 Ga0501083_0072699 Ga0501083_0072699_733_1560 273
359 3300049765 Ga0501268_005590 Ga0501268_005590_101_928 273
360 3300049770 Ga0501273_002730 Ga0501273_002730_84_911 273
361 3300049824 Ga0501045_0156099 Ga0501045_0156099_660_1493 273
362 3300050493 nmdc:mga0k408_437_c1 nmdc:mga0k408_437_c1_11486_12337 273
363 3300050510 nmdc:mga06r32_615603_c1 nmdc:mga06r32_615603_c1_142_975 273
364 3300054114 Ga0501084_0001331 Ga0501084_0001331_15907_16734 273
365 3300054114 Ga0501084_0017922 Ga0501084_0017922_4713_5546 273
366 3300059421 Ga0590071_000607 Ga0590071_000607_2336_3163 273
367 3300059424 Ga0590075_014937 Ga0590075_014937_713_1540 273
368 3300060353 Ga0501082_0025406 Ga0501082_0025406_1820_2653 273
369 3300060353 Ga0501082_0283685 Ga0501082_0283685_198_1025 273
370 3300061734 Ga0530510_0047403 Ga0530510_0047403_368_1201 273
371 3300061734 Ga0530510_0076303 Ga0530510_0076303_1530_2363 273
372 3300061734 Ga0530510_0161942 Ga0530510_0161942_555_1397 273
373 3300061734 Ga0530510_0244167 Ga0530510_0244167_323_1150 273
374 3300005548 Ga0070665_100009224 Ga0070665_1000092249 274
375 3300005615 Ga0070702_100342550 Ga0070702_1003425502 274
376 3300006852 Ga0075433_10090590 Ga0075433_100905902 274
377 3300025918 Ga0207662_10020454 Ga0207662_100204543 274
378 3300027907 Ga0207428_10129183 Ga0207428_101291832 274
379 3300028379 Ga0268266_10007273 Ga0268266_100072732 274
380 3300031711 Ga0265314_10006948 Ga0265314_100069489 274
381 3300031712 Ga0265342_10000326 Ga0265342_1000032621 274
382 3300042876 Ga0451577_0000009 Ga0451577_0000009_138895_139755 274
383 3300044673 Ga0453683_0003255 Ga0453683_0003255_5080_5940 274
384 3300044694 Ga0466963_0048754 Ga0466963_0048754_979_1914 274
385 3300044712 Ga0453684_0000358 Ga0453684_0000358_7032_7892 274
386 3300044712 Ga0453684_0012200 Ga0453684_0012200_11709_12566 274
387 3300044712 Ga0453684_0054005 Ga0453684_0054005_3680_4537 274
388 3300045051 Ga0451576_0003725 Ga0451576_0003725_10494_11354 274
389 3300050493 nmdc:mga0k408_351_c1 nmdc:mga0k408_351_c1_23066_23932 274
390 3300050511 nmdc:mga08y16_211269_c1 nmdc:mga08y16_211269_c1_95_988 274
391 3300050515 nmdc:mga0a205_17310_c1 nmdc:mga0a205_17310_c1_4790_5620 274
392 3300053103 Ga0500555_000391 Ga0500555_000391_843_1712 274
393 3300053104 Ga0500556_0000897 Ga0500556_0000897_8338_9207 274
394 3300005354 Ga0070675_100013100 Ga0070675_1000131006 275
395 3300005364 Ga0070673_100018445 Ga0070673_1000184455 275
396 3300005535 Ga0070684_100033605 Ga0070684_1000336054 275
397 3300005543 Ga0070672_100121277 Ga0070672_1001212772 275
398 3300005543 Ga0070672_100156844 Ga0070672_1001568442 275
399 3300005981 Ga0081538_10029311 Ga0081538_100293113 275
400 3300013297 Ga0157378_10134141 Ga0157378_101341412 275
401 3300025925 Ga0207650_10105353 Ga0207650_101053532 275
402 3300025940 Ga0207691_10068281 Ga0207691_100682812 275
403 3300025940 Ga0207691_10085661 Ga0207691_100856612 275
404 3300025944 Ga0207661_10021489 Ga0207661_100214893 275
405 3300025960 Ga0207651_10009062 Ga0207651_100090622 275
406 3300025960 Ga0207651_10048975 Ga0207651_100489753 275
407 3300026088 Ga0207641_10211742 Ga0207641_102117422 275
408 3300005327 Ga0070658_10012894 Ga0070658_100128947 276
409 3300025909 Ga0207705_10303921 Ga0207705_103039211 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

104

306

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.875 15 263
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.859 15 263
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8566 13 266
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8519 20 266
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.84 13 263
ID Description Score Start End Superfamily
af_P16701_14_273_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9125 15 271 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.904 16 270 1.10.3720.10
af_P16701_14_273_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8993 15 271 1.10.3720.10
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.898 53 270 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8905 16 270 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A3B8TSF8-F1-model_v4 deleted 0.9546 17 205
AF-A0A1W5YJQ0-F1-model_v4 Sulfate transport system permease protein CysT 0.9477 51 230 GO:0005886
GO:0015419
GO:0031969
AF-A0A3N5P484-F1-model_v4 Sulfate transport system permease protein CysT 0.9441 69 276 GO:0005886
GO:0015419
AF-A0A401TWW1-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9413 34 249 GO:0005886
GO:0015419
AF-A0A3B8TSF8-F1-model_v4 deleted 0.9402 17 205

Feature Viewer

pLDDT pTM Quality
80.94 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map