F436703

General Info

Members Datasets Scaffolds Average Seq Length
408 254 816 140

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10137374|Ga0105247_101373743
Length 163
Sequence MRMPVAVDTRAAKFYSSDMLSPFHLAIPVHDLAAARQFYGTLFGCPEGRSSSEWVDFDFFGHQLVAHLDPTRQPKHCNEVDGKHVPVPHFGVVLEWDQWHALSSRLTSASGSGGASGEIRFVIEPGIRFRGEVGEQATMFLLDPSGNALEFKAFKDPSKLFAK

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
164 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
165 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
166 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
167 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
168 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
227 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
246 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
247 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
248 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
249 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
254 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.25
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0
Rhizoplane 1.96
Rhizosphere 92.16
Stem 0
Stem Tuber 0
Unclassified 2.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10137374 3300009101 Bacteria 1598
2 Ga0055530_10035994 3300003791 Bacteria 1249
3 Ga0065712_10069946 3300005290 Bacteria 6483
4 Ga0065715_10095284 3300005293 Bacteria 4120
5 Ga0065707_10082600 3300005295 Bacteria 13469
6 Ga0070676_10027754 3300005328 Bacteria 3212
7 Ga0070690_100030128 3300005330 Bacteria 3370
8 Ga0070670_100113822 3300005331 Bacteria 2332
9 Ga0068869_100020046 3300005334 Bacteria 4580
10 Ga0070666_10005086 3300005335 Bacteria 8049
11 Ga0070666_10139076 3300005335 Bacteria 1691
12 Ga0070680_100088847 3300005336 Bacteria 2556
13 Ga0070682_100290650 3300005337 Bacteria 1195
14 Ga0070689_100011544 3300005340 Bacteria 6330
15 Ga0070687_100001184 3300005343 Bacteria 9034
16 Ga0070687_100431593 3300005343 Bacteria 872
17 Ga0070661_100004549 3300005344 Bacteria 9543
18 Ga0070661_100396910 3300005344 Bacteria 1090
19 Ga0070692_10201478 3300005345 Bacteria 1166
20 Ga0070668_100011231 3300005347 Bacteria 6669
21 Ga0070668_100261353 3300005347 Bacteria 1440
22 Ga0070669_100002317 3300005353 Bacteria 13772
23 Ga0070669_100101906 3300005353 Bacteria 2167
24 Ga0070675_100015532 3300005354 Bacteria 6022
25 Ga0070675_100290547 3300005354 Bacteria 1439
26 Ga0070671_100060437 3300005355 Bacteria 3155
27 Ga0070674_100366620 3300005356 Bacteria 1168
28 Ga0070673_100000801 3300005364 Bacteria 17547
29 Ga0070673_101400131 3300005364 Bacteria 658
30 Ga0070688_100001301 3300005365 Bacteria 12442
31 Ga0070659_100165031 3300005366 Bacteria 1812
32 Ga0070667_100010301 3300005367 Bacteria 7726
33 Ga0070714_100015451 3300005435 Bacteria 6143
34 Ga0070701_10079076 3300005438 Bacteria 1776
35 Ga0070711_100025410 3300005439 Bacteria 3875
36 Ga0070711_100385208 3300005439 Bacteria 1135
37 Ga0070711_100748121 3300005439 Bacteria 826
38 Ga0070705_100033631 3300005440 Bacteria 2859
39 Ga0070700_100014397 3300005441 Bacteria 4466
40 Ga0070694_100215186 3300005444 Bacteria 1439
41 Ga0070678_100177620 3300005456 Bacteria 1740
42 Ga0070662_100148787 3300005457 Bacteria 1821
43 Ga0070681_10569129 3300005458 Bacteria 1047
44 Ga0068867_100028170 3300005459 Bacteria 4042
45 Ga0068867_100280078 3300005459 Bacteria 1367
46 Ga0068867_100773545 3300005459 Bacteria 854
47 Ga0070685_10037808 3300005466 Bacteria 2735
48 Ga0070684_100005937 3300005535 Bacteria 9403
49 Ga0070684_101557243 3300005535 Bacteria 623
50 Ga0070672_100441474 3300005543 Bacteria 1120
51 Ga0070686_100007755 3300005544 Bacteria 5999
52 Ga0070695_100230749 3300005545 Bacteria 1338
53 Ga0070665_100013632 3300005548 Bacteria 8176
54 Ga0070704_100071755 3300005549 Bacteria 2517
55 Ga0070664_100001416 3300005564 Bacteria 19136
56 Ga0068857_100160813 3300005577 Bacteria 2038
57 Ga0068857_100347107 3300005577 Bacteria 1374
58 Ga0068857_101043805 3300005577 Bacteria 788
59 Ga0068854_100512333 3300005578 Bacteria 1012
60 Ga0070702_100004703 3300005615 Bacteria 6263
61 Ga0070702_101299282 3300005615 Bacteria 591
62 Ga0068859_100002605 3300005617 Bacteria 18353
63 Ga0068859_102505647 3300005617 Bacteria 568
64 Ga0068864_100002456 3300005618 Bacteria 15308
65 Ga0068864_100936285 3300005618 Bacteria 857
66 Ga0068866_10263178 3300005718 Bacteria 1061
67 Ga0068861_100000071 3300005719 Bacteria 49027
68 Ga0068861_100004244 3300005719 Bacteria 9608
69 Ga0068870_10020586 3300005840 Bacteria 3215
70 Ga0068863_100001451 3300005841 Bacteria 23527
71 Ga0068858_100021397 3300005842 Bacteria 6042
72 Ga0068860_100087776 3300005843 Bacteria 2961
73 Ga0068862_100000988 3300005844 Bacteria 27194
74 Ga0068862_100004545 3300005844 Bacteria 11696
75 Ga0068862_100135378 3300005844 Bacteria 2183
76 Ga0068862_102379443 3300005844 Bacteria 541
77 Ga0075366_10726312 3300006195 Bacteria 617
78 Ga0097621_100008921 3300006237 Bacteria 7249
79 Ga0075428_100001531 3300006844 Bacteria 24724
80 Ga0075428_100091703 3300006844 Bacteria 3313
81 Ga0075428_100228454 3300006844 Bacteria 2008
82 Ga0075430_100015203 3300006846 Bacteria 6553
83 Ga0075430_100087538 3300006846 Bacteria 2607
84 Ga0075430_100137284 3300006846 Bacteria 2037
85 Ga0075430_100464250 3300006846 Unclassified 1045
86 Ga0075430_101588107 3300006846 Bacteria 537
87 Ga0075431_100000055 3300006847 Bacteria 62773
88 Ga0075431_100000449 3300006847 Bacteria 33807
89 Ga0075431_100021778 3300006847 Bacteria 6553
90 Ga0075431_100279423 3300006847 Bacteria 1691
91 Ga0075434_101624330 3300006871 Bacteria 655
92 Ga0075429_100003438 3300006880 Bacteria 13511
93 Ga0075429_100089331 3300006880 Bacteria 2686
94 Ga0075429_100313632 3300006880 Bacteria 1373
95 Ga0075429_101340591 3300006880 Bacteria 624
96 Ga0068865_100376359 3300006881 Bacteria 1157
97 Ga0075436_101028093 3300006914 Bacteria 619
98 Ga0097620_100002605 3300006931 Bacteria 18353
99 Ga0097620_102506149 3300006931 Bacteria 568
100 Ga0105251_10248960 3300009011 Bacteria 801
101 Ga0105244_10393147 3300009036 Bacteria 638
102 Ga0111539_10008030 3300009094 Bacteria 13459
103 Ga0111539_10051631 3300009094 Bacteria 4897
104 Ga0111539_10059244 3300009094 Bacteria 4541
105 Ga0111539_11663595 3300009094 Bacteria 740
106 Ga0114129_10019674 3300009147 Bacteria 9610
107 Ga0114129_10034867 3300009147 Bacteria 7109
108 Ga0114129_10318079 3300009147 Bacteria 2070
109 Ga0114129_13183291 3300009147 Bacteria 534
110 Ga0105243_10025176 3300009148 Bacteria 4545
111 Ga0105248_10006044 3300009177 Bacteria 13285
112 Ga0105248_10008317 3300009177 Bacteria 11400
113 Ga0105248_10512471 3300009177 Bacteria 1352
114 Ga0105248_10566956 3300009177 Bacteria 1281
115 Ga0105249_10003870 3300009553 Bacteria 12923
116 Ga0105249_10008292 3300009553 Bacteria 9047
117 Ga0105249_12288942 3300009553 Bacteria 613
118 Ga0157374_10419948 3300013296 Bacteria 1336
119 Ga0157378_10369100 3300013297 Bacteria 1406
120 Ga0163162_10052996 3300013306 Bacteria 4077
121 Ga0157375_10526931 3300013308 Bacteria 1344
122 Ga0157375_11829269 3300013308 Bacteria 720
123 Ga0163163_10001368 3300014325 Bacteria 20570
124 Ga0163163_10667801 3300014325 Bacteria 1103
125 Ga0157380_10000110 3300014326 Bacteria 44612
126 Ga0157377_10000928 3300014745 Bacteria 12252
127 Ga0157379_10223469 3300014968 Bacteria 1706
128 Ga0213876_10012267 3300021384 Bacteria 4563
129 Ga0209759_1005704 3300025256 Bacteria 4296
130 Ga0209676_1002511 3300025292 Bacteria 12842
131 Ga0209050_1013534 3300025298 Bacteria 3612
132 Ga0209051_1019868 3300025303 Bacteria 2917
133 Ga0207642_10491080 3300025899 Bacteria 750
134 Ga0207710_10129118 3300025900 Bacteria 1213
135 Ga0207688_10056797 3300025901 Bacteria 2200
136 Ga0207647_10229282 3300025904 Bacteria 1069
137 Ga0207645_10070380 3300025907 Bacteria 2238
138 Ga0207643_10227463 3300025908 Bacteria 1143
139 Ga0207663_10017169 3300025916 Bacteria 4027
140 Ga0207662_10002078 3300025918 Bacteria 9937
141 Ga0207649_10205995 3300025920 Bacteria 1392
142 Ga0207652_10111118 3300025921 Bacteria 2430
143 Ga0207681_10001690 3300025923 Bacteria 14197
144 Ga0207681_10069211 3300025923 Bacteria 2454
145 Ga0207650_10124680 3300025925 Bacteria 2009
146 Ga0207659_10005814 3300025926 Bacteria 7517
147 Ga0207659_10245902 3300025926 Bacteria 1449
148 Ga0207700_10068434 3300025928 Bacteria 2721
149 Ga0207664_10013414 3300025929 Bacteria 5881
150 Ga0207664_11286866 3300025929 Bacteria 650
151 Ga0207644_10099176 3300025931 Bacteria 2185
152 Ga0207690_10311313 3300025932 Bacteria 1235
153 Ga0207706_10044490 3300025933 Bacteria 3935
154 Ga0207709_10416354 3300025935 Bacteria 1031
155 Ga0207669_10147843 3300025937 Bacteria 1641
156 Ga0207704_10069307 3300025938 Bacteria 2228
157 Ga0207704_10591272 3300025938 Bacteria 907
158 Ga0207711_10168493 3300025941 Bacteria 1986
159 Ga0207661_11352930 3300025944 Bacteria 654
160 Ga0207679_10004412 3300025945 Bacteria 8763
161 Ga0207651_10040894 3300025960 Bacteria 3072
162 Ga0207712_10003255 3300025961 Bacteria 10308
163 Ga0207712_10010142 3300025961 Bacteria 5974
164 Ga0207712_11044531 3300025961 Bacteria 726
165 Ga0207668_10015657 3300025972 Bacteria 4715
166 Ga0207668_10219095 3300025972 Bacteria 1527
167 Ga0207677_10223941 3300026023 Bacteria 1510
168 Ga0207703_10008255 3300026035 Bacteria 8223
169 Ga0207703_11178873 3300026035 Bacteria 736
170 Ga0207708_10007490 3300026075 Bacteria 8068
171 Ga0207702_10027824 3300026078 Bacteria 4696
172 Ga0207641_10001574 3300026088 Bacteria 22301
173 Ga0207648_10012361 3300026089 Bacteria 7992
174 Ga0207676_10008373 3300026095 Bacteria 7349
175 Ga0207676_11067491 3300026095 Bacteria 797
176 Ga0207674_10603524 3300026116 Bacteria 1060
177 Ga0207675_100000248 3300026118 Bacteria 51521
178 Ga0207675_100009566 3300026118 Bacteria 9065
179 Ga0207683_10042424 3300026121 Bacteria 3974
180 Ga0207698_11687120 3300026142 Bacteria 649
181 Ga0209371_1038607 3300027312 Bacteria 983
182 Ga0207428_10001812 3300027907 Bacteria 21884
183 Ga0207428_10020596 3300027907 Bacteria 5600
184 Ga0207428_10028126 3300027907 Bacteria 4674
185 Ga0268266_10000003 3300028379 Bacteria 1701703
186 Ga0268266_10056955 3300028379 Bacteria 3362
187 Ga0268265_10001324 3300028380 Bacteria 21230
188 Ga0268265_10008484 3300028380 Bacteria 6943
189 Ga0268265_10112724 3300028380 Bacteria 2224
190 Ga0268265_11700995 3300028380 Bacteria 637
191 Ga0268264_11251821 3300028381 Bacteria 752
192 Ga0265334_10000007 3300028573 Bacteria 217454
193 Ga0265334_10004474 3300028573 Bacteria 6200
194 Ga0265338_10005482 3300028800 Bacteria 16548
195 Ga0265338_10088524 3300028800 Bacteria 2569
196 Ga0268256_1043722 3300030500 Bacteria 986
197 Ga0307408_100061553 3300031548 Bacteria 2740
198 Ga0307408_100208886 3300031548 Bacteria 1585
199 Ga0307408_100290346 3300031548 Bacteria 1365
200 Ga0307408_100360671 3300031548 Bacteria 1236
201 Ga0307408_100744858 3300031548 Bacteria 884
202 Ga0307408_101389835 3300031548 Bacteria 661
203 Ga0265313_10000113 3300031595 Bacteria 81921
204 Ga0265313_10002274 3300031595 Bacteria 16848
205 Ga0316575_10005640 3300031665 Bacteria 4467
206 Ga0316576_10530399 3300031727 Bacteria 864
207 Ga0316578_10746263 3300031728 Bacteria 569
208 Ga0307405_10055628 3300031731 Bacteria 2477
209 Ga0307405_10087689 3300031731 Bacteria 2052
210 Ga0307405_11038208 3300031731 Bacteria 701
211 Ga0307413_10003549 3300031824 Bacteria 6596
212 Ga0307410_10020965 3300031852 Bacteria 4011
213 Ga0307410_11293481 3300031852 Bacteria 637
214 Ga0307406_10091781 3300031901 Bacteria 2046
215 Ga0307406_10395883 3300031901 Bacteria 1093
216 Ga0307406_11206960 3300031901 Bacteria 657
217 Ga0307407_10028998 3300031903 Bacteria 2966
218 Ga0307412_10031788 3300031911 Bacteria 3337
219 Ga0307412_10049653 3300031911 Bacteria 2765
220 Ga0307412_10725915 3300031911 Bacteria 855
221 Ga0307409_100022336 3300031995 Bacteria 4360
222 Ga0307416_100002370 3300032002 Bacteria 10784
223 Ga0307416_100027066 3300032002 Bacteria 4239
224 Ga0307416_100301159 3300032002 Bacteria 1594
225 Ga0307416_100630977 3300032002 Bacteria 1154
226 Ga0307416_100834314 3300032002 Bacteria 1019
227 Ga0307414_10092862 3300032004 Bacteria 2248
228 Ga0307414_10802879 3300032004 Bacteria 858
229 Ga0307411_10004388 3300032005 Bacteria 6749
230 Ga0307411_10021560 3300032005 Bacteria 3773
231 Ga0307411_10459387 3300032005 Bacteria 1067
232 Ga0307411_10622399 3300032005 Bacteria 931
233 Ga0307411_10834198 3300032005 Bacteria 814
234 Ga0307411_11433668 3300032005 Bacteria 633
235 Ga0307415_100031715 3300032126 Bacteria 3408
236 Ga0307415_101106396 3300032126 Bacteria 742
237 Ga0307415_101649107 3300032126 Bacteria 617
238 Ga0373952_0112101 3300035092 Bacteria 731
239 Ga0373932_0109764 3300035112 Bacteria 908
240 Ga0373960_0227277 3300035121 Bacteria 670
241 Ga0373962_0176519 3300035242 Bacteria 712
242 Ga0316574_0092707 3300035398 Bacteria 1928
243 Ga0316574_0464240 3300035398 Bacteria 792
244 Ga0373931_0057138 3300035691 Bacteria 2092
245 Ga0373935_0128553 3300035692 Bacteria 1700
246 Ga0373935_0150853 3300035692 Bacteria 1577
247 Ga0373935_1179173 3300035692 Bacteria 571
248 Ga0373927_0000001 3300035695 Bacteria 1082160
249 Ga0373937_0057111 3300036401 Bacteria 3585
250 Ga0316584_0636165 3300036712 Bacteria 737
251 Ga0395899_0000849 3300037312 Bacteria 29423
252 Ga0395900_0061696 3300037418 Bacteria 3854
253 Ga0395905_0013496 3300037471 Bacteria 7827
254 Ga0395905_0063602 3300037471 Bacteria 3452
255 Ga0395901_0557808 3300038443 Bacteria 1160
256 Ga0436361_0045151 3300039447 Bacteria 2359
257 Ga0451802_0579992 3300041460 Bacteria 649
258 Ga0451845_0292791 3300041501 Bacteria 729
259 Ga0439442_085442 3300042002 Bacteria 677
260 Ga0439442_100851 3300042002 Bacteria 625
261 Ga0439448_0192136 3300042005 Bacteria 715
262 Ga0450898_005073 3300042134 Bacteria 1973
263 Ga0439446_0206689 3300042156 Bacteria 665
264 Ga0439446_0260337 3300042156 Bacteria 600
265 Ga0439434_0002117 3300042435 Bacteria 5743
266 Ga0439464_0033164 3300042439 Bacteria 1453
267 Ga0453684_0703290 3300044712 Bacteria 1098
268 Ga0451576_0237981 3300045051 Bacteria 1901
269 Ga0466967_0130531 3300045976 Bacteria 2332
270 Ga0495638_0002422 3300046460 Bacteria 15247
271 Ga0495638_0037854 3300046460 Bacteria 3068
272 Ga0495653_0634758 3300046463 Bacteria 654
273 Ga0495584_0005102 3300046491 Bacteria 6974
274 Ga0495643_0011185 3300046522 Bacteria 5483
275 Ga0495642_0006010 3300046528 Bacteria 4662
276 Ga0495597_0168429 3300046542 Bacteria 890
277 Ga0495633_0578367 3300046558 Bacteria 505
278 Ga0495668_0013491 3300046616 Bacteria 4816
279 Ga0495668_0066897 3300046616 Bacteria 1977
280 Ga0495668_0292314 3300046616 Bacteria 893
281 Ga0495625_0006147 3300046660 Bacteria 10751
282 Ga0495661_0007036 3300046665 Bacteria 7863
283 Ga0495588_0021007 3300046674 Bacteria 3213
284 Ga0495669_0000353 3300046684 Bacteria 23496
285 Ga0495636_0449673 3300047318 Bacteria 619
286 Ga0495672_0022092 3300047320 Bacteria 4141
287 Ga0495687_011195 3300047443 Bacteria 4841
288 Ga0496101_0176493 3300048904 Bacteria 1643
289 Ga0496104_0772690 3300048907 Bacteria 867
290 Ga0496107_0233140 3300048910 Bacteria 1370
291 Ga0496108_0055754 3300048911 Bacteria 3319
292 Ga0496110_0078894 3300048913 Bacteria 2931
293 Ga0496112_0075389 3300048915 Bacteria 3336
294 Ga0496113_0126207 3300048916 Bacteria 2004
295 Ga0496116_0004368 3300048919 Bacteria 13515
296 Ga0496121_0031958 3300048924 Bacteria 4797
297 Ga0496121_0093121 3300048924 Bacteria 2347
298 Ga0496122_0000497 3300048925 Bacteria 81763
299 Ga0496123_0000345 3300048926 Bacteria 87307
300 Ga0496124_0085977 3300048927 Bacteria 2575
301 Ga0496125_0037112 3300048928 Bacteria 4241
302 Ga0496126_0604650 3300048929 Bacteria 863
303 Ga0501297_021591 3300049520 Bacteria 809
304 Ga0501032_0370001 3300049569 Bacteria 922
305 Ga0501032_0415587 3300049569 Bacteria 863
306 Ga0501033_0145454 3300049570 Bacteria 1712
307 Ga0501036_0004289 3300049572 Bacteria 11519
308 Ga0501036_0189243 3300049572 Bacteria 1732
309 Ga0501037_0087821 3300049573 Bacteria 2250
310 Ga0501037_0164913 3300049573 Bacteria 1578
311 Ga0501038_0013970 3300049574 Bacteria 7318
312 Ga0501038_0257195 3300049574 Bacteria 1381
313 Ga0501039_0000428 3300049575 Bacteria 30396
314 Ga0501039_0148939 3300049575 Bacteria 1839
315 Ga0501039_0422366 3300049575 Bacteria 1047
316 Ga0501040_0079694 3300049576 Bacteria 2267
317 Ga0501040_0269581 3300049576 Bacteria 1215
318 Ga0501041_0000067 3300049577 Bacteria 39230
319 Ga0501041_0086117 3300049577 Bacteria 1938
320 Ga0501041_0408016 3300049577 Bacteria 861
321 Ga0501042_0001275 3300049578 Bacteria 14681
322 Ga0501042_0040523 3300049578 Bacteria 3311
323 Ga0501042_0362470 3300049578 Bacteria 1049
324 Ga0501043_0025943 3300049579 Bacteria 4598
325 Ga0501043_0073715 3300049579 Bacteria 2681
326 Ga0501046_0022735 3300049580 Bacteria 5163
327 Ga0501046_0144110 3300049580 Unclassified 1800
328 Ga0501047_0579367 3300049581 Bacteria 945
329 Ga0501048_0004405 3300049582 Bacteria 10721
330 Ga0501048_0271451 3300049582 Bacteria 1205
331 Ga0501048_1189523 3300049582 Bacteria 548
332 Ga0501068_0003672 3300049584 Bacteria 8307
333 Ga0501068_0081618 3300049584 Bacteria 1985
334 Ga0501069_0026199 3300049585 Bacteria 3193
335 Ga0501071_0001783 3300049587 Bacteria 12698
336 Ga0501071_0171007 3300049587 Unclassified 1626
337 Ga0501071_1342306 3300049587 Bacteria 552
338 Ga0501072_0006246 3300049588 Bacteria 9081
339 Ga0501072_0018849 3300049588 Bacteria 5323
340 Ga0501072_0584503 3300049588 Bacteria 881
341 Ga0501072_0630667 3300049588 Bacteria 844
342 Ga0501073_0199747 3300049589 Unclassified 1383
343 Ga0501073_0430795 3300049589 Bacteria 911
344 Ga0501074_0041852 3300049590 Bacteria 3315
345 Ga0501074_0633871 3300049590 Bacteria 755
346 Ga0501075_0015802 3300049591 Bacteria 5426
347 Ga0501075_0253769 3300049591 Bacteria 1340
348 Ga0501076_0001333 3300049592 Bacteria 16506
349 Ga0501076_0014674 3300049592 Bacteria 5906
350 Ga0501076_0690815 3300049592 Bacteria 842
351 Ga0501076_0951530 3300049592 Bacteria 708
352 Ga0501077_0009227 3300049593 Bacteria 6123
353 Ga0501077_0127937 3300049593 Bacteria 1610
354 Ga0501077_0652420 3300049593 Bacteria 676
355 Ga0501217_251056 3300049661 Bacteria 570
356 Ga0501249_003804 3300049679 Bacteria 3048
357 Ga0501079_0000665 3300049741 Bacteria 23026
358 Ga0501079_0649656 3300049741 Bacteria 830
359 Ga0501079_0850072 3300049741 Bacteria 718
360 Ga0501080_0007422 3300049742 Bacteria 9894
361 Ga0501080_0431080 3300049742 Unclassified 1183
362 Ga0501081_0000277 3300049743 Bacteria 27024
363 Ga0501081_0377310 3300049743 Unclassified 1047
364 Ga0501083_0014099 3300049744 Bacteria 5589
365 Ga0501278_008516 3300049774 Bacteria 793
366 Ga0501035_0002190 3300049822 Bacteria 19394
367 Ga0501035_0043350 3300049822 Unclassified 4055
368 Ga0501035_0408727 3300049822 Bacteria 1128
369 Ga0501044_0617549 3300049823 Unclassified 976
370 Ga0501045_0001768 3300049824 Bacteria 14587
371 Ga0501045_0019231 3300049824 Bacteria 4866
372 Ga0501045_0032982 3300049824 Bacteria 3754
373 nmdc:mga00v17_568674_c1 3300050491 Bacteria 732
374 nmdc:mga0yw44_269435_c1 3300050492 Bacteria 1136
375 nmdc:mga05p37_4788_c1 3300050507 Bacteria 6598
376 nmdc:mga05p37_54049_c1 3300050507 Bacteria 4941
377 nmdc:mga09592_25907_c1 3300050508 Bacteria 4857
378 nmdc:mga09592_334857_c1 3300050508 Bacteria 1310
379 nmdc:mga09592_48706_c1 3300050508 Bacteria 3573
380 nmdc:mga0qj67_108379_c1 3300050509 Bacteria 2241
381 nmdc:mga0qj67_230332_c1 3300050509 Bacteria 1503
382 nmdc:mga0qj67_3555_c1 3300050509 Bacteria 11250
383 nmdc:mga0qj67_42621_c1 3300050509 Bacteria 3573
384 nmdc:mga06r32_100_c1 3300050510 Bacteria 59347
385 nmdc:mga06r32_1522088_c1 3300050510 Bacteria 609
386 nmdc:mga06r32_465_c1 3300050510 Bacteria 34675
387 nmdc:mga06r32_560_c1 3300050510 Bacteria 32295
388 nmdc:mga08y16_158330_c1 3300050511 Bacteria 2353
389 nmdc:mga08y16_269_c1 3300050511 Bacteria 47187
390 nmdc:mga08y16_70867_c1 3300050511 Bacteria 3633
391 nmdc:mga08y16_7154_c1 3300050511 Bacteria 11712
392 nmdc:mga0n895_205052_c1 3300050512 Bacteria 2002
393 nmdc:mga08x19_365254_c1 3300050514 Bacteria 1009
394 Ga0500651_0017652 3300053093 Bacteria 4408
395 Ga0500650_0120761 3300053098 Bacteria 1221
396 Ga0500562_000434 3300053108 Bacteria 10164
397 Ga0500628_018596 3300053129 Bacteria 1372
398 Ga0500604_0062846 3300053151 Bacteria 1170
399 Ga0501084_0029195 3300054114 Bacteria 4613
400 Ga0501084_0093504 3300054114 Bacteria 2524
401 Ga0501084_0715574 3300054114 Bacteria 844
402 Ga0587077_030777 3300059493 Bacteria 1020
403 Ga0501082_0000933 3300060353 Bacteria 25877
404 Ga0501082_0079905 3300060353 Bacteria 2822
405 Ga0501082_0777777 3300060353 Bacteria 837
406 Ga0530510_0001695 3300061734 Bacteria 14940
407 Ga0530510_0081336 3300061734 Unclassified 2358
408 3007419644 3007419365 Bacteria 7026924
409 Ga0105247_10137374
410 Ga0055530_10035994
411 Ga0065712_10069946
412 Ga0065715_10095284
413 Ga0065707_10082600
414 Ga0070676_10027754
415 Ga0070690_100030128
416 Ga0070670_100113822
417 Ga0068869_100020046
418 Ga0070666_10005086
419 Ga0070666_10139076
420 Ga0070680_100088847
421 Ga0070682_100290650
422 Ga0070689_100011544
423 Ga0070687_100001184
424 Ga0070687_100431593
425 Ga0070661_100004549
426 Ga0070661_100396910
427 Ga0070692_10201478
428 Ga0070668_100011231
429 Ga0070668_100261353
430 Ga0070669_100002317
431 Ga0070669_100101906
432 Ga0070675_100015532
433 Ga0070675_100290547
434 Ga0070671_100060437
435 Ga0070674_100366620
436 Ga0070673_100000801
437 Ga0070673_101400131
438 Ga0070688_100001301
439 Ga0070659_100165031
440 Ga0070667_100010301
441 Ga0070714_100015451
442 Ga0070701_10079076
443 Ga0070711_100025410
444 Ga0070711_100385208
445 Ga0070711_100748121
446 Ga0070705_100033631
447 Ga0070700_100014397
448 Ga0070694_100215186
449 Ga0070678_100177620
450 Ga0070662_100148787
451 Ga0070681_10569129
452 Ga0068867_100028170
453 Ga0068867_100280078
454 Ga0068867_100773545
455 Ga0070685_10037808
456 Ga0070684_100005937
457 Ga0070684_101557243
458 Ga0070672_100441474
459 Ga0070686_100007755
460 Ga0070695_100230749
461 Ga0070665_100013632
462 Ga0070704_100071755
463 Ga0070664_100001416
464 Ga0068857_100160813
465 Ga0068857_100347107
466 Ga0068857_101043805
467 Ga0068854_100512333
468 Ga0070702_100004703
469 Ga0070702_101299282
470 Ga0068859_100002605
471 Ga0068859_102505647
472 Ga0068864_100002456
473 Ga0068864_100936285
474 Ga0068866_10263178
475 Ga0068861_100000071
476 Ga0068861_100004244
477 Ga0068870_10020586
478 Ga0068863_100001451
479 Ga0068858_100021397
480 Ga0068860_100087776
481 Ga0068862_100000988
482 Ga0068862_100004545
483 Ga0068862_100135378
484 Ga0068862_102379443
485 Ga0075366_10726312
486 Ga0097621_100008921
487 Ga0075428_100001531
488 Ga0075428_100091703
489 Ga0075428_100228454
490 Ga0075430_100015203
491 Ga0075430_100087538
492 Ga0075430_100137284
493 Ga0075430_100464250
494 Ga0075430_101588107
495 Ga0075431_100000055
496 Ga0075431_100000449
497 Ga0075431_100021778
498 Ga0075431_100279423
499 Ga0075434_101624330
500 Ga0075429_100003438
501 Ga0075429_100089331
502 Ga0075429_100313632
503 Ga0075429_101340591
504 Ga0068865_100376359
505 Ga0075436_101028093
506 Ga0097620_100002605
507 Ga0097620_102506149
508 Ga0105251_10248960
509 Ga0105244_10393147
510 Ga0111539_10008030
511 Ga0111539_10051631
512 Ga0111539_10059244
513 Ga0111539_11663595
514 Ga0114129_10019674
515 Ga0114129_10034867
516 Ga0114129_10318079
517 Ga0114129_13183291
518 Ga0105243_10025176
519 Ga0105248_10006044
520 Ga0105248_10008317
521 Ga0105248_10512471
522 Ga0105248_10566956
523 Ga0105249_10003870
524 Ga0105249_10008292
525 Ga0105249_12288942
526 Ga0157374_10419948
527 Ga0157378_10369100
528 Ga0163162_10052996
529 Ga0157375_10526931
530 Ga0157375_11829269
531 Ga0163163_10001368
532 Ga0163163_10667801
533 Ga0157380_10000110
534 Ga0157377_10000928
535 Ga0157379_10223469
536 Ga0213876_10012267
537 Ga0209759_1005704
538 Ga0209676_1002511
539 Ga0209050_1013534
540 Ga0209051_1019868
541 Ga0207642_10491080
542 Ga0207710_10129118
543 Ga0207688_10056797
544 Ga0207647_10229282
545 Ga0207645_10070380
546 Ga0207643_10227463
547 Ga0207663_10017169
548 Ga0207662_10002078
549 Ga0207649_10205995
550 Ga0207652_10111118
551 Ga0207681_10001690
552 Ga0207681_10069211
553 Ga0207650_10124680
554 Ga0207659_10005814
555 Ga0207659_10245902
556 Ga0207700_10068434
557 Ga0207664_10013414
558 Ga0207664_11286866
559 Ga0207644_10099176
560 Ga0207690_10311313
561 Ga0207706_10044490
562 Ga0207709_10416354
563 Ga0207669_10147843
564 Ga0207704_10069307
565 Ga0207704_10591272
566 Ga0207711_10168493
567 Ga0207661_11352930
568 Ga0207679_10004412
569 Ga0207651_10040894
570 Ga0207712_10003255
571 Ga0207712_10010142
572 Ga0207712_11044531
573 Ga0207668_10015657
574 Ga0207668_10219095
575 Ga0207677_10223941
576 Ga0207703_10008255
577 Ga0207703_11178873
578 Ga0207708_10007490
579 Ga0207702_10027824
580 Ga0207641_10001574
581 Ga0207648_10012361
582 Ga0207676_10008373
583 Ga0207676_11067491
584 Ga0207674_10603524
585 Ga0207675_100000248
586 Ga0207675_100009566
587 Ga0207683_10042424
588 Ga0207698_11687120
589 Ga0209371_1038607
590 Ga0207428_10001812
591 Ga0207428_10020596
592 Ga0207428_10028126
593 Ga0268266_10000003
594 Ga0268266_10056955
595 Ga0268265_10001324
596 Ga0268265_10008484
597 Ga0268265_10112724
598 Ga0268265_11700995
599 Ga0268264_11251821
600 Ga0265334_10000007
601 Ga0265334_10004474
602 Ga0265338_10005482
603 Ga0265338_10088524
604 Ga0268256_1043722
605 Ga0307408_100061553
606 Ga0307408_100208886
607 Ga0307408_100290346
608 Ga0307408_100360671
609 Ga0307408_100744858
610 Ga0307408_101389835
611 Ga0265313_10000113
612 Ga0265313_10002274
613 Ga0316575_10005640
614 Ga0316576_10530399
615 Ga0316578_10746263
616 Ga0307405_10055628
617 Ga0307405_10087689
618 Ga0307405_11038208
619 Ga0307413_10003549
620 Ga0307410_10020965
621 Ga0307410_11293481
622 Ga0307406_10091781
623 Ga0307406_10395883
624 Ga0307406_11206960
625 Ga0307407_10028998
626 Ga0307412_10031788
627 Ga0307412_10049653
628 Ga0307412_10725915
629 Ga0307409_100022336
630 Ga0307416_100002370
631 Ga0307416_100027066
632 Ga0307416_100301159
633 Ga0307416_100630977
634 Ga0307416_100834314
635 Ga0307414_10092862
636 Ga0307414_10802879
637 Ga0307411_10004388
638 Ga0307411_10021560
639 Ga0307411_10459387
640 Ga0307411_10622399
641 Ga0307411_10834198
642 Ga0307411_11433668
643 Ga0307415_100031715
644 Ga0307415_101106396
645 Ga0307415_101649107
646 Ga0373952_0112101
647 Ga0373932_0109764
648 Ga0373960_0227277
649 Ga0373962_0176519
650 Ga0316574_0092707
651 Ga0316574_0464240
652 Ga0373931_0057138
653 Ga0373935_0128553
654 Ga0373935_0150853
655 Ga0373935_1179173
656 Ga0373927_0000001
657 Ga0373937_0057111
658 Ga0316584_0636165
659 Ga0395899_0000849
660 Ga0395900_0061696
661 Ga0395905_0013496
662 Ga0395905_0063602
663 Ga0395901_0557808
664 Ga0436361_0045151
665 Ga0451802_0579992
666 Ga0451845_0292791
667 Ga0439442_085442
668 Ga0439442_100851
669 Ga0439448_0192136
670 Ga0450898_005073
671 Ga0439446_0206689
672 Ga0439446_0260337
673 Ga0439434_0002117
674 Ga0439464_0033164
675 Ga0453684_0703290
676 Ga0451576_0237981
677 Ga0466967_0130531
678 Ga0495638_0002422
679 Ga0495638_0037854
680 Ga0495653_0634758
681 Ga0495584_0005102
682 Ga0495643_0011185
683 Ga0495642_0006010
684 Ga0495597_0168429
685 Ga0495633_0578367
686 Ga0495668_0013491
687 Ga0495668_0066897
688 Ga0495668_0292314
689 Ga0495625_0006147
690 Ga0495661_0007036
691 Ga0495588_0021007
692 Ga0495669_0000353
693 Ga0495636_0449673
694 Ga0495672_0022092
695 Ga0495687_011195
696 Ga0496101_0176493
697 Ga0496104_0772690
698 Ga0496107_0233140
699 Ga0496108_0055754
700 Ga0496110_0078894
701 Ga0496112_0075389
702 Ga0496113_0126207
703 Ga0496116_0004368
704 Ga0496121_0031958
705 Ga0496121_0093121
706 Ga0496122_0000497
707 Ga0496123_0000345
708 Ga0496124_0085977
709 Ga0496125_0037112
710 Ga0496126_0604650
711 Ga0501297_021591
712 Ga0501032_0370001
713 Ga0501032_0415587
714 Ga0501033_0145454
715 Ga0501036_0004289
716 Ga0501036_0189243
717 Ga0501037_0087821
718 Ga0501037_0164913
719 Ga0501038_0013970
720 Ga0501038_0257195
721 Ga0501039_0000428
722 Ga0501039_0148939
723 Ga0501039_0422366
724 Ga0501040_0079694
725 Ga0501040_0269581
726 Ga0501041_0000067
727 Ga0501041_0086117
728 Ga0501041_0408016
729 Ga0501042_0001275
730 Ga0501042_0040523
731 Ga0501042_0362470
732 Ga0501043_0025943
733 Ga0501043_0073715
734 Ga0501046_0022735
735 Ga0501046_0144110
736 Ga0501047_0579367
737 Ga0501048_0004405
738 Ga0501048_0271451
739 Ga0501048_1189523
740 Ga0501068_0003672
741 Ga0501068_0081618
742 Ga0501069_0026199
743 Ga0501071_0001783
744 Ga0501071_0171007
745 Ga0501071_1342306
746 Ga0501072_0006246
747 Ga0501072_0018849
748 Ga0501072_0584503
749 Ga0501072_0630667
750 Ga0501073_0199747
751 Ga0501073_0430795
752 Ga0501074_0041852
753 Ga0501074_0633871
754 Ga0501075_0015802
755 Ga0501075_0253769
756 Ga0501076_0001333
757 Ga0501076_0014674
758 Ga0501076_0690815
759 Ga0501076_0951530
760 Ga0501077_0009227
761 Ga0501077_0127937
762 Ga0501077_0652420
763 Ga0501217_251056
764 Ga0501249_003804
765 Ga0501079_0000665
766 Ga0501079_0649656
767 Ga0501079_0850072
768 Ga0501080_0007422
769 Ga0501080_0431080
770 Ga0501081_0000277
771 Ga0501081_0377310
772 Ga0501083_0014099
773 Ga0501278_008516
774 Ga0501035_0002190
775 Ga0501035_0043350
776 Ga0501035_0408727
777 Ga0501044_0617549
778 Ga0501045_0001768
779 Ga0501045_0019231
780 Ga0501045_0032982
781 nmdc:mga00v17_568674_c1
782 nmdc:mga0yw44_269435_c1
783 nmdc:mga05p37_4788_c1
784 nmdc:mga05p37_54049_c1
785 nmdc:mga09592_25907_c1
786 nmdc:mga09592_334857_c1
787 nmdc:mga09592_48706_c1
788 nmdc:mga0qj67_108379_c1
789 nmdc:mga0qj67_230332_c1
790 nmdc:mga0qj67_3555_c1
791 nmdc:mga0qj67_42621_c1
792 nmdc:mga06r32_100_c1
793 nmdc:mga06r32_1522088_c1
794 nmdc:mga06r32_465_c1
795 nmdc:mga06r32_560_c1
796 nmdc:mga08y16_158330_c1
797 nmdc:mga08y16_269_c1
798 nmdc:mga08y16_70867_c1
799 nmdc:mga08y16_7154_c1
800 nmdc:mga0n895_205052_c1
801 nmdc:mga08x19_365254_c1
802 Ga0500651_0017652
803 Ga0500650_0120761
804 Ga0500562_000434
805 Ga0500628_018596
806 Ga0500604_0062846
807 Ga0501084_0029195
808 Ga0501084_0093504
809 Ga0501084_0715574
810 Ga0587077_030777
811 Ga0501082_0000933
812 Ga0501082_0079905
813 Ga0501082_0777777
814 Ga0530510_0001695
815 Ga0530510_0081336
816 3007419644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

23

45

0.95

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

151

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rri-assembly1.cif.gz_A crystal structure of glyoxalase/bleomycin resistance protein/dioxygenase from alicyclobacillus acidocaldarius 0.8483 7 141
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.848 6 131
4nb1-assembly1.cif.gz_B crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8263 8 140
4nb2-assembly1.cif.gz_B crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8244 8 140
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8227 8 143
ID Description Score Start End Superfamily
3rriB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8548 7 137 3.10.180.10
3rriB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8179 7 137 3.10.180.10
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8149 8 139 3.10.180.10
af_Q2FYM3_1_61_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8128 11 59 3.10.180.10
5irbB02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8041 114 132 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A0C4YJM0-F1-model_v4 Putative dioxygenase 0.9947 10 143 GO:0051213
AF-A0A7C4E557-F1-model_v4 Glyoxalase 0.9892 4 143
AF-B1G047-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9825 2 143 GO:0051213
AF-A0A6J4C0Q1-F1-model_v4 Glyoxalase 0.9818 4 143
AF-A0A0C4YJM0-F1-model_v4 Putative dioxygenase 0.9802 10 143 GO:0051213

Map