F436426

General Info

Members Datasets Scaffolds Average Seq Length
407 235 814 123

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100067637|Ga0068862_1000676371
Length 115
Sequence MSIPILKQGPLLIATIQGAVTDANLIELRDALAERVGRLRTRGVLVDFATRMLRNIAYTVKLRGAETVIVGIQPDVAFTMVQLGLTLEGVETALDFEEGAELLARKITKDPERVG

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
135 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
139 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
158 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
159 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
160 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
161 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
162 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
163 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.46
Rhizosphere 96.31
Stem 0
Stem Tuber 0
Unclassified 11.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100067637 3300005844 Bacteria 3080
2 SwRhRL3b_contig_3699502 2162886006 Bacteria 836
3 Ga0058862_11747516 3300004803 Bacteria 1851
4 Ga0065707_10087365 3300005295 Bacteria 5058
5 Ga0065707_10209217 3300005295 Bacteria 1273
6 Ga0070658_10134356 3300005327 Bacteria 2063
7 Ga0070683_100661880 3300005329 Bacteria 1000
8 Ga0070683_101879405 3300005329 Bacteria 575
9 Ga0070690_100425420 3300005330 Bacteria 980
10 Ga0070690_100803151 3300005330 Bacteria 730
11 Ga0070670_101099564 3300005331 Bacteria 725
12 Ga0070680_100696335 3300005336 Bacteria 874
13 Ga0070680_101335442 3300005336 Bacteria 621
14 Ga0070680_101937540 3300005336 Bacteria 511
15 Ga0070682_100006881 3300005337 Bacteria 6391
16 Ga0070689_100070615 3300005340 Unclassified 2727
17 Ga0070675_101187582 3300005354 Unclassified 702
18 Ga0070674_100783858 3300005356 Bacteria 822
19 Ga0070673_100572392 3300005364 Bacteria 1028
20 Ga0070673_100917161 3300005364 Bacteria 813
21 Ga0070673_102237494 3300005364 Bacteria 520
22 Ga0070688_100710000 3300005365 Unclassified 779
23 Ga0070688_100796829 3300005365 Bacteria 739
24 Ga0070667_101531469 3300005367 Bacteria 626
25 Ga0070703_10213082 3300005406 Bacteria 765
26 Ga0070701_10487710 3300005438 Bacteria 798
27 Ga0070701_10539068 3300005438 Bacteria 764
28 Ga0070705_100013723 3300005440 Bacteria 4149
29 Ga0070705_100088250 3300005440 Unclassified 1925
30 Ga0070705_100522495 3300005440 Bacteria 905
31 Ga0070694_100088409 3300005444 Bacteria 2169
32 Ga0070694_100243614 3300005444 Bacteria 1357
33 Ga0070694_100426042 3300005444 Unclassified 1043
34 Ga0070708_100019453 3300005445 Bacteria 5705
35 Ga0070708_100098338 3300005445 Bacteria 2676
36 Ga0070708_100734792 3300005445 Bacteria 928
37 Ga0070708_101154743 3300005445 Bacteria 725
38 Ga0070708_101261370 3300005445 Unclassified 691
39 Ga0070681_10198286 3300005458 Bacteria 1926
40 Ga0070685_10116346 3300005466 Bacteria 1655
41 Ga0070685_10856120 3300005466 Bacteria 674
42 Ga0070706_100364733 3300005467 Bacteria 1346
43 Ga0070706_100496950 3300005467 Bacteria 1135
44 Ga0070706_100887391 3300005467 Bacteria 824
45 Ga0070707_100056837 3300005468 Bacteria 3754
46 Ga0070707_100057172 3300005468 Bacteria 3742
47 Ga0070707_100079458 3300005468 Bacteria 3166
48 Ga0070698_100265081 3300005471 Unclassified 1650
49 Ga0070699_100012757 3300005518 Bacteria 7242
50 Ga0070699_100353915 3300005518 Bacteria 1323
51 Ga0070679_100009949 3300005530 Bacteria 9001
52 Ga0070684_100679019 3300005535 Bacteria 960
53 Ga0070697_100157934 3300005536 Bacteria 1915
54 Ga0070697_100308815 3300005536 Bacteria 1360
55 Ga0070697_101749748 3300005536 Bacteria 556
56 Ga0070686_100043792 3300005544 Bacteria 2810
57 Ga0070686_100664911 3300005544 Bacteria 827
58 Ga0070695_100279695 3300005545 Unclassified 1225
59 Ga0070696_100006926 3300005546 Bacteria 7566
60 Ga0070696_100025944 3300005546 Bacteria 3986
61 Ga0070696_100258192 3300005546 Bacteria 1320
62 Ga0070696_100701628 3300005546 Bacteria 825
63 Ga0070696_101084470 3300005546 Unclassified 672
64 Ga0070696_101126860 3300005546 Unclassified 660
65 Ga0070693_100243652 3300005547 Bacteria 1188
66 Ga0070693_100748748 3300005547 Bacteria 720
67 Ga0070704_100011723 3300005549 Bacteria 5387
68 Ga0070704_100340635 3300005549 Bacteria 1262
69 Ga0070704_101011841 3300005549 Bacteria 752
70 Ga0068855_100005976 3300005563 Bacteria 14849
71 Ga0068855_100082819 3300005563 Bacteria 3718
72 Ga0070664_101216684 3300005564 Bacteria 711
73 Ga0068857_100501870 3300005577 Bacteria 1139
74 Ga0068857_101167614 3300005577 Bacteria 745
75 Ga0068856_100544226 3300005614 Bacteria 1182
76 Ga0068856_101341800 3300005614 Bacteria 730
77 Ga0068864_100835536 3300005618 Bacteria 907
78 Ga0068864_101893848 3300005618 Bacteria 602
79 Ga0068866_10626151 3300005718 Bacteria 729
80 Ga0068866_10731155 3300005718 Bacteria 682
81 Ga0068851_10694257 3300005834 Bacteria 626
82 Ga0068863_100525755 3300005841 Bacteria 1167
83 Ga0068863_100615757 3300005841 Bacteria 1075
84 Ga0068863_100799196 3300005841 Bacteria 941
85 Ga0068863_101119345 3300005841 Bacteria 792
86 Ga0068860_101017180 3300005843 Bacteria 847
87 Ga0068860_101141924 3300005843 Bacteria 799
88 Ga0081455_10315472 3300005937 Unclassified 1116
89 Ga0081540_1029103 3300005983 Bacteria 3086
90 Ga0070715_10124524 3300006163 Bacteria 1233
91 Ga0070712_100359179 3300006175 Bacteria 1194
92 Ga0097621_101314068 3300006237 Bacteria 683
93 Ga0097621_101963462 3300006237 Bacteria 559
94 Ga0075428_100069766 3300006844 Bacteria 3842
95 Ga0075428_100711528 3300006844 Bacteria 1070
96 Ga0075428_100878639 3300006844 Unclassified 951
97 Ga0075430_100440818 3300006846 Bacteria 1075
98 Ga0075430_101269466 3300006846 Bacteria 606
99 Ga0075433_10001262 3300006852 Bacteria 18490
100 Ga0075433_10002774 3300006852 Bacteria 13401
101 Ga0075433_10014262 3300006852 Bacteria 6490
102 Ga0075433_10029225 3300006852 Bacteria 4694
103 Ga0075433_10152314 3300006852 Bacteria 2057
104 Ga0075433_10199773 3300006852 Bacteria 1778
105 Ga0075433_10243060 3300006852 Bacteria 1598
106 Ga0075433_10452793 3300006852 Unclassified 1131
107 Ga0075433_10494353 3300006852 Bacteria 1077
108 Ga0075434_100000939 3300006871 Bacteria 23447
109 Ga0075434_100005207 3300006871 Bacteria 11812
110 Ga0075434_100224055 3300006871 Bacteria 1900
111 Ga0075434_100327721 3300006871 Bacteria 1552
112 Ga0075434_100666696 3300006871 Bacteria 1058
113 Ga0075429_100218804 3300006880 Bacteria 1668
114 Ga0075429_101464784 3300006880 Unclassified 594
115 Ga0075436_100125185 3300006914 Bacteria 1800
116 Ga0075436_100206914 3300006914 Bacteria 1390
117 Ga0075436_100282469 3300006914 Bacteria 1187
118 Ga0075436_101202303 3300006914 Bacteria 572
119 Ga0075435_100002152 3300007076 Bacteria 12982
120 Ga0075435_100011290 3300007076 Bacteria 6563
121 Ga0075435_100527303 3300007076 Bacteria 1022
122 Ga0075435_101896924 3300007076 Bacteria 523
123 Ga0099795_10627435 3300007788 Unclassified 513
124 Ga0105244_10345495 3300009036 Bacteria 686
125 Ga0105240_10201640 3300009093 Bacteria 2331
126 Ga0111539_10028066 3300009094 Bacteria 6871
127 Ga0111539_10071303 3300009094 Bacteria 4100
128 Ga0111539_10280947 3300009094 Bacteria 1937
129 Ga0111539_10379674 3300009094 Bacteria 1645
130 Ga0111539_11516845 3300009094 Bacteria 777
131 Ga0105245_10702554 3300009098 Bacteria 1044
132 Ga0105245_11330806 3300009098 Bacteria 768
133 Ga0105247_10723778 3300009101 Bacteria 751
134 Ga0114129_10035836 3300009147 Bacteria 7006
135 Ga0114129_10040787 3300009147 Bacteria 6544
136 Ga0114129_12194119 3300009147 Unclassified 665
137 Ga0105243_10755972 3300009148 Bacteria 953
138 Ga0105242_10283901 3300009176 Bacteria 1505
139 Ga0105242_11705780 3300009176 Bacteria 666
140 Ga0105242_12314704 3300009176 Bacteria 584
141 Ga0105248_11536933 3300009177 Unclassified 754
142 Ga0105248_11787026 3300009177 Bacteria 697
143 Ga0105238_10003353 3300009551 Bacteria 15983
144 Ga0105238_10863377 3300009551 Bacteria 922
145 Ga0105249_10228896 3300009553 Unclassified 1833
146 Ga0105239_10609139 3300010375 Bacteria 1246
147 Ga0105246_11394657 3300011119 Bacteria 653
148 Ga0157371_10505579 3300013102 Bacteria 893
149 Ga0157369_11144546 3300013105 Bacteria 795
150 Ga0157378_10107545 3300013297 Bacteria 2552
151 Ga0157378_11147926 3300013297 Bacteria 815
152 Ga0157378_11292385 3300013297 Bacteria 771
153 Ga0163162_10705100 3300013306 Bacteria 1131
154 Ga0157372_11740228 3300013307 Bacteria 717
155 Ga0157375_10246024 3300013308 Bacteria 1949
156 Ga0157380_10794222 3300014326 Bacteria 963
157 Ga0157376_10421397 3300014969 Bacteria 1295
158 Ga0157376_11868631 3300014969 Bacteria 637
159 Ga0157376_12680035 3300014969 Bacteria 538
160 Ga0206356_10969911 3300020070 Bacteria 957
161 Ga0213876_10087169 3300021384 Bacteria 1653
162 Ga0207653_10269270 3300025885 Unclassified 656
163 Ga0207642_10055499 3300025899 Bacteria 1812
164 Ga0207688_10212784 3300025901 Bacteria 1162
165 Ga0207685_10431017 3300025905 Unclassified 682
166 Ga0207705_10098834 3300025909 Bacteria 2145
167 Ga0207654_10124971 3300025911 Bacteria 1620
168 Ga0207693_10418857 3300025915 Bacteria 1047
169 Ga0207660_11392619 3300025917 Bacteria 568
170 Ga0207662_10211396 3300025918 Unclassified 1259
171 Ga0207652_10009827 3300025921 Bacteria 7700
172 Ga0207652_11059738 3300025921 Unclassified 710
173 Ga0207646_10023532 3300025922 Bacteria 5657
174 Ga0207646_10087833 3300025922 Bacteria 2782
175 Ga0207646_10411494 3300025922 Bacteria 1221
176 Ga0207681_10079330 3300025923 Bacteria 2313
177 Ga0207694_10038612 3300025924 Bacteria 3672
178 Ga0207694_10677211 3300025924 Bacteria 869
179 Ga0207650_11348863 3300025925 Bacteria 607
180 Ga0207687_10103539 3300025927 Unclassified 2099
181 Ga0207644_10527726 3300025931 Bacteria 976
182 Ga0207690_10453621 3300025932 Bacteria 1031
183 Ga0207706_10732667 3300025933 Bacteria 843
184 Ga0207686_10161312 3300025934 Bacteria 1572
185 Ga0207670_10380623 3300025936 Bacteria 1124
186 Ga0207669_10070090 3300025937 Bacteria 2197
187 Ga0207711_11088848 3300025941 Unclassified 740
188 Ga0207679_10772628 3300025945 Bacteria 875
189 Ga0207679_12026127 3300025945 Bacteria 524
190 Ga0207667_10002189 3300025949 Bacteria 24535
191 Ga0207667_10095818 3300025949 Bacteria 3063
192 Ga0207651_11579395 3300025960 Bacteria 591
193 Ga0207712_11012050 3300025961 Unclassified 737
194 Ga0207668_10848733 3300025972 Bacteria 811
195 Ga0207658_10446077 3300025986 Bacteria 1145
196 Ga0207677_11029173 3300026023 Bacteria 748
197 Ga0207639_11431772 3300026041 Unclassified 649
198 Ga0207702_10580997 3300026078 Bacteria 1098
199 Ga0207702_10713398 3300026078 Bacteria 989
200 Ga0207641_10525285 3300026088 Bacteria 1152
201 Ga0207641_10721526 3300026088 Bacteria 983
202 Ga0207641_10733991 3300026088 Bacteria 974
203 Ga0207641_10821430 3300026088 Bacteria 920
204 Ga0207641_11139771 3300026088 Bacteria 779
205 Ga0207676_12264820 3300026095 Bacteria 541
206 Ga0207674_10468169 3300026116 Bacteria 1218
207 Ga0207674_11328296 3300026116 Bacteria 688
208 Ga0207675_100088391 3300026118 Bacteria 2910
209 Ga0207675_100202910 3300026118 Bacteria 1905
210 Ga0207683_11315921 3300026121 Bacteria 669
211 Ga0209588_1019235 3300027671 Bacteria 2131
212 Ga0209588_1033416 3300027671 Bacteria 1649
213 Ga0207428_10040906 3300027907 Bacteria 3754
214 Ga0207428_10179297 3300027907 Bacteria 1601
215 Ga0268264_11252269 3300028381 Bacteria 752
216 Ga0268264_11879892 3300028381 Unclassified 608
217 Ga0265319_1021297 3300028563 Bacteria 2382
218 Ga0265338_10019853 3300028800 Bacteria 7102
219 Ga0265320_10010114 3300031240 Bacteria 5638
220 Ga0307513_10036422 3300031456 Bacteria 5489
221 Ga0307405_10205779 3300031731 Bacteria 1433
222 Ga0307413_10078696 3300031824 Bacteria 2105
223 Ga0307413_10837608 3300031824 Bacteria 776
224 Ga0307410_10272590 3300031852 Bacteria 1324
225 Ga0307410_10979144 3300031852 Bacteria 728
226 Ga0307406_10294815 3300031901 Bacteria 1243
227 Ga0307406_10510477 3300031901 Bacteria 976
228 Ga0307407_10300547 3300031903 Bacteria 1119
229 Ga0307412_11040029 3300031911 Bacteria 726
230 Ga0307409_100460615 3300031995 Bacteria 1229
231 Ga0307409_101775290 3300031995 Bacteria 646
232 Ga0307416_100275847 3300032002 Bacteria 1654
233 Ga0307416_100302254 3300032002 Bacteria 1591
234 Ga0307416_101028829 3300032002 Bacteria 927
235 Ga0307416_101126629 3300032002 Bacteria 890
236 Ga0307416_101721649 3300032002 Bacteria 731
237 Ga0307411_10599393 3300032005 Bacteria 947
238 Ga0307415_100724156 3300032126 Bacteria 900
239 Ga0373958_0184005 3300034819 Bacteria 539
240 Ga0373938_0013026 3300034957 Bacteria 1571
241 Ga0373934_0000518 3300035086 Bacteria 13566
242 Ga0373944_0083950 3300035089 Bacteria 1056
243 Ga0373951_0107204 3300035091 Bacteria 748
244 Ga0373952_0079843 3300035092 Bacteria 833
245 Ga0373923_0002275 3300035111 Bacteria 5855
246 Ga0373923_0083294 3300035111 Bacteria 1390
247 Ga0373953_0005257 3300035117 Bacteria 4185
248 Ga0373954_0054904 3300035118 Bacteria 1874
249 Ga0373956_0001579 3300035119 Bacteria 9388
250 Ga0373957_0004863 3300035120 Bacteria 4121
251 Ga0373955_0003928 3300035172 Bacteria 6554
252 Ga0373955_0297960 3300035172 Bacteria 972
253 Ga0373931_0508099 3300035691 Bacteria 778
254 Ga0373935_0312980 3300035692 Bacteria 1112
255 Ga0373927_0017122 3300035695 Bacteria 4775
256 Ga0373933_0016257 3300035724 Bacteria 4158
257 Ga0373933_0555836 3300035724 Bacteria 753
258 Ga0373937_0013847 3300036401 Bacteria 7108
259 Ga0373937_0464563 3300036401 Bacteria 1202
260 Ga0373937_1125357 3300036401 Unclassified 734
261 Ga0373925_0373068 3300037068 Bacteria 1161
262 Ga0373925_1134415 3300037068 Unclassified 643
263 Ga0395900_0497207 3300037418 Unclassified 1170
264 Ga0395900_1018395 3300037418 Bacteria 748
265 Ga0395898_0820655 3300037466 Bacteria 870
266 Ga0395905_0330091 3300037471 Bacteria 1416
267 Ga0395901_0059793 3300038443 Bacteria 3965
268 Ga0395901_0437659 3300038443 Bacteria 1339
269 Ga0395901_1198492 3300038443 Bacteria 725
270 Ga0436365_0057957 3300039437 Bacteria 1764
271 Ga0451791_0001596 3300041451 Bacteria 1198
272 Ga0451793_0304576 3300041452 Unclassified 677
273 Ga0451798_0746010 3300041458 Bacteria 2161
274 Ga0451802_1087347 3300041460 Bacteria 599
275 Ga0451835_0933718 3300041492 Unclassified 669
276 Ga0451851_0244292 3300041507 Bacteria 562
277 Ga0450901_032179 3300042533 Bacteria 581
278 Ga0451577_0204236 3300042876 Bacteria 1784
279 Ga0451577_0237487 3300042876 Bacteria 1649
280 Ga0451577_0428410 3300042876 Bacteria 1201
281 Ga0451577_0478422 3300042876 Bacteria 1131
282 Ga0466972_0208862 3300044658 Bacteria 914
283 Ga0453683_0068377 3300044673 Unclassified 2221
284 Ga0466966_0142638 3300044684 Bacteria 1463
285 Ga0466961_0057624 3300044693 Unclassified 2473
286 Ga0466963_0017056 3300044694 Bacteria 4523
287 Ga0453684_0015722 3300044712 Bacteria 11920
288 Ga0453684_0947535 3300044712 Bacteria 919
289 Ga0466959_0038482 3300045049 Bacteria 3535
290 Ga0451576_0014042 3300045051 Bacteria 8926
291 Ga0451576_0033103 3300045051 Bacteria 5495
292 Ga0451576_0059386 3300045051 Bacteria 3992
293 Ga0451576_0077132 3300045051 Bacteria 3468
294 Ga0451576_0167493 3300045051 Unclassified 2293
295 Ga0451576_0636795 3300045051 Bacteria 1120
296 Ga0451576_0807578 3300045051 Bacteria 985
297 Ga0451576_1411199 3300045051 Bacteria 724
298 Ga0466958_0733808 3300045836 Bacteria 644
299 Ga0495592_0026173 3300046454 Bacteria 4425
300 Ga0495603_0302798 3300046455 Bacteria 918
301 Ga0495641_0035065 3300046461 Bacteria 2368
302 Ga0495641_0499862 3300046461 Bacteria 554
303 Ga0495651_0015755 3300046462 Bacteria 5855
304 Ga0495653_0429327 3300046463 Bacteria 835
305 Ga0495580_0002012 3300046472 Bacteria 17896
306 Ga0495580_0636611 3300046472 Unclassified 702
307 Ga0495582_0015289 3300046473 Bacteria 4218
308 Ga0495582_0381664 3300046473 Bacteria 812
309 Ga0495582_0904652 3300046473 Unclassified 510
310 Ga0495639_0089984 3300046475 Bacteria 1439
311 Ga0495662_0032189 3300046476 Bacteria 2533
312 Ga0495664_0323559 3300046477 Unclassified 930
313 Ga0495594_0011705 3300046499 Bacteria 4562
314 Ga0495608_0005764 3300046511 Bacteria 8827
315 Ga0495608_0220007 3300046511 Bacteria 1192
316 Ga0495618_0071472 3300046514 Bacteria 2208
317 Ga0495618_0363380 3300046514 Bacteria 890
318 Ga0495618_0599420 3300046514 Bacteria 656
319 Ga0495628_0000665 3300046516 Bacteria 31450
320 Ga0495628_0118704 3300046516 Bacteria 2030
321 Ga0495630_0013483 3300046517 Bacteria 5944
322 Ga0495630_0403537 3300046517 Unclassified 1047
323 Ga0495630_0405410 3300046517 Bacteria 1045
324 Ga0495637_0248545 3300046520 Bacteria 641
325 Ga0495666_0021223 3300046526 Bacteria 3214
326 Ga0495652_0069649 3300046529 Bacteria 2944
327 Ga0495665_0198033 3300046531 Bacteria 1041
328 Ga0495640_0022036 3300046533 Bacteria 4664
329 Ga0495586_0005522 3300046535 Bacteria 6758
330 Ga0495586_0087445 3300046535 Bacteria 1718
331 Ga0495587_0002775 3300046536 Bacteria 11692
332 Ga0495621_0190329 3300046539 Bacteria 822
333 Ga0495667_0517986 3300046559 Unclassified 746
334 Ga0495634_0035108 3300046642 Bacteria 3436
335 Ga0495634_0479944 3300046642 Bacteria 731
336 Ga0495635_1061978 3300046663 Unclassified 514
337 Ga0495657_0049163 3300046675 Bacteria 2841
338 Ga0495599_0051133 3300046678 Bacteria 2590
339 Ga0495599_0763395 3300046678 Bacteria 554
340 Ga0495647_0004768 3300046681 Bacteria 4427
341 Ga0495647_0138533 3300046681 Bacteria 1036
342 Ga0495658_0001249 3300046683 Bacteria 13349
343 Ga0495658_0021419 3300046683 Bacteria 3408
344 Ga0495624_0283934 3300046690 Bacteria 999
345 Ga0495600_0063332 3300046809 Bacteria 2416
346 Ga0495600_0466365 3300046809 Bacteria 779
347 Ga0495676_0639336 3300047321 Bacteria 691
348 Ga0495680_0011404 3300047322 Bacteria 7868
349 Ga0495675_0008256 3300047444 Bacteria 6442
350 Ga0495684_0192670 3300047471 Bacteria 1506
351 Ga0495684_0260955 3300047471 Bacteria 1257
352 Ga0495593_0179000 3300047673 Bacteria 1068
353 Ga0495602_0116572 3300048088 Bacteria 2158
354 Ga0495614_0165697 3300048089 Bacteria 990
355 Ga0496100_0773050 3300048903 Bacteria 752
356 Ga0496110_0427225 3300048913 Bacteria 1208
357 Ga0496110_1468663 3300048913 Bacteria 591
358 Ga0496111_1083362 3300048914 Bacteria 572
359 Ga0496114_0292724 3300048917 Bacteria 1437
360 Ga0496115_0662585 3300048918 Bacteria 824
361 Ga0501034_0053328 3300049571 Bacteria 4072
362 Ga0501034_0436720 3300049571 Bacteria 1228
363 Ga0501047_0374981 3300049581 Bacteria 1258
364 Ga0501070_1425194 3300049586 Unclassified 526
365 Ga0501080_0421392 3300049742 Bacteria 1199
366 Ga0501083_0030733 3300049744 Bacteria 3688
367 Ga0501044_0012317 3300049823 Bacteria 9259
368 nmdc:mga05p37_1247239_c1 3300050507 Bacteria 763
369 nmdc:mga05p37_1520874_c1 3300050507 Unclassified 665
370 nmdc:mga05p37_23415_c1 3300050507 Bacteria 7493
371 nmdc:mga05p37_25527_c1 3300050507 Bacteria 7188
372 nmdc:mga09592_1389421_c1 3300050508 Bacteria 574
373 nmdc:mga09592_349017_c1 3300050508 Bacteria 1281
374 nmdc:mga09592_673084_c1 3300050508 Unclassified 882
375 nmdc:mga0qj67_1110348_c1 3300050509 Unclassified 617
376 nmdc:mga0qj67_726532_c1 3300050509 Bacteria 789
377 nmdc:mga08y16_1114718_c1 3300050511 Bacteria 763
378 nmdc:mga08y16_206714_c1 3300050511 Bacteria 2034
379 nmdc:mga08y16_363296_c1 3300050511 Bacteria 1486
380 nmdc:mga08y16_74017_c1 3300050511 Bacteria 3549
381 nmdc:mga08y16_87844_c1 3300050511 Bacteria 3239
382 nmdc:mga0n895_1302630_c1 3300050512 Bacteria 697
383 nmdc:mga0n895_195799_c1 3300050512 Bacteria 2052
384 nmdc:mga0n895_56246_c1 3300050512 Bacteria 3875
385 nmdc:mga0n895_65045_c1 3300050512 Bacteria 3609
386 nmdc:mga0n895_73097_c1 3300050512 Bacteria 3404
387 nmdc:mga0n895_775084_c1 3300050512 Bacteria 951
388 nmdc:mga0n895_90326_c1 3300050512 Bacteria 3065
389 nmdc:mga0rr50_1090_c1 3300050513 Bacteria 14751
390 nmdc:mga0rr50_435502_c1 3300050513 Bacteria 1110
391 nmdc:mga0rr50_58888_c1 3300050513 Bacteria 2881
392 nmdc:mga08x19_32366_c1 3300050514 Bacteria 1187
393 nmdc:mga08x19_73430_c1 3300050514 Bacteria 2233
394 nmdc:mga0a205_1068336_c1 3300050515 Bacteria 654
395 nmdc:mga0a205_134049_c1 3300050515 Bacteria 2377
396 nmdc:mga0a205_23976_c1 3300050515 Bacteria 5793
397 nmdc:mga0a205_260248_c1 3300050515 Bacteria 1613
398 nmdc:mga0a205_377207_c1 3300050515 Bacteria 1284
399 nmdc:mga0a205_564438_c1 3300050515 Unclassified 993
400 nmdc:mga0a205_59875_c1 3300050515 Bacteria 3678
401 nmdc:mga0a205_7610_c1 3300050515 Bacteria 9820
402 nmdc:mga0a205_89856_c1 3300050515 Bacteria 2969
403 nmdc:mga0a205_9443_c1 3300050515 Bacteria 8918
404 Ga0495612_0278920 3300053078 Unclassified 747
405 Ga0495595_0004071 3300053084 Bacteria 5854
406 Ga0495619_0030020 3300053085 Bacteria 3517
407 Ga0501082_0529938 3300060353 Bacteria 1030
408 Ga0068862_100067637
409 SwRhRL3b_contig_3699502
410 Ga0058862_11747516
411 Ga0065707_10087365
412 Ga0065707_10209217
413 Ga0070658_10134356
414 Ga0070683_100661880
415 Ga0070683_101879405
416 Ga0070690_100425420
417 Ga0070690_100803151
418 Ga0070670_101099564
419 Ga0070680_100696335
420 Ga0070680_101335442
421 Ga0070680_101937540
422 Ga0070682_100006881
423 Ga0070689_100070615
424 Ga0070675_101187582
425 Ga0070674_100783858
426 Ga0070673_100572392
427 Ga0070673_100917161
428 Ga0070673_102237494
429 Ga0070688_100710000
430 Ga0070688_100796829
431 Ga0070667_101531469
432 Ga0070703_10213082
433 Ga0070701_10487710
434 Ga0070701_10539068
435 Ga0070705_100013723
436 Ga0070705_100088250
437 Ga0070705_100522495
438 Ga0070694_100088409
439 Ga0070694_100243614
440 Ga0070694_100426042
441 Ga0070708_100019453
442 Ga0070708_100098338
443 Ga0070708_100734792
444 Ga0070708_101154743
445 Ga0070708_101261370
446 Ga0070681_10198286
447 Ga0070685_10116346
448 Ga0070685_10856120
449 Ga0070706_100364733
450 Ga0070706_100496950
451 Ga0070706_100887391
452 Ga0070707_100056837
453 Ga0070707_100057172
454 Ga0070707_100079458
455 Ga0070698_100265081
456 Ga0070699_100012757
457 Ga0070699_100353915
458 Ga0070679_100009949
459 Ga0070684_100679019
460 Ga0070697_100157934
461 Ga0070697_100308815
462 Ga0070697_101749748
463 Ga0070686_100043792
464 Ga0070686_100664911
465 Ga0070695_100279695
466 Ga0070696_100006926
467 Ga0070696_100025944
468 Ga0070696_100258192
469 Ga0070696_100701628
470 Ga0070696_101084470
471 Ga0070696_101126860
472 Ga0070693_100243652
473 Ga0070693_100748748
474 Ga0070704_100011723
475 Ga0070704_100340635
476 Ga0070704_101011841
477 Ga0068855_100005976
478 Ga0068855_100082819
479 Ga0070664_101216684
480 Ga0068857_100501870
481 Ga0068857_101167614
482 Ga0068856_100544226
483 Ga0068856_101341800
484 Ga0068864_100835536
485 Ga0068864_101893848
486 Ga0068866_10626151
487 Ga0068866_10731155
488 Ga0068851_10694257
489 Ga0068863_100525755
490 Ga0068863_100615757
491 Ga0068863_100799196
492 Ga0068863_101119345
493 Ga0068860_101017180
494 Ga0068860_101141924
495 Ga0081455_10315472
496 Ga0081540_1029103
497 Ga0070715_10124524
498 Ga0070712_100359179
499 Ga0097621_101314068
500 Ga0097621_101963462
501 Ga0075428_100069766
502 Ga0075428_100711528
503 Ga0075428_100878639
504 Ga0075430_100440818
505 Ga0075430_101269466
506 Ga0075433_10001262
507 Ga0075433_10002774
508 Ga0075433_10014262
509 Ga0075433_10029225
510 Ga0075433_10152314
511 Ga0075433_10199773
512 Ga0075433_10243060
513 Ga0075433_10452793
514 Ga0075433_10494353
515 Ga0075434_100000939
516 Ga0075434_100005207
517 Ga0075434_100224055
518 Ga0075434_100327721
519 Ga0075434_100666696
520 Ga0075429_100218804
521 Ga0075429_101464784
522 Ga0075436_100125185
523 Ga0075436_100206914
524 Ga0075436_100282469
525 Ga0075436_101202303
526 Ga0075435_100002152
527 Ga0075435_100011290
528 Ga0075435_100527303
529 Ga0075435_101896924
530 Ga0099795_10627435
531 Ga0105244_10345495
532 Ga0105240_10201640
533 Ga0111539_10028066
534 Ga0111539_10071303
535 Ga0111539_10280947
536 Ga0111539_10379674
537 Ga0111539_11516845
538 Ga0105245_10702554
539 Ga0105245_11330806
540 Ga0105247_10723778
541 Ga0114129_10035836
542 Ga0114129_10040787
543 Ga0114129_12194119
544 Ga0105243_10755972
545 Ga0105242_10283901
546 Ga0105242_11705780
547 Ga0105242_12314704
548 Ga0105248_11536933
549 Ga0105248_11787026
550 Ga0105238_10003353
551 Ga0105238_10863377
552 Ga0105249_10228896
553 Ga0105239_10609139
554 Ga0105246_11394657
555 Ga0157371_10505579
556 Ga0157369_11144546
557 Ga0157378_10107545
558 Ga0157378_11147926
559 Ga0157378_11292385
560 Ga0163162_10705100
561 Ga0157372_11740228
562 Ga0157375_10246024
563 Ga0157380_10794222
564 Ga0157376_10421397
565 Ga0157376_11868631
566 Ga0157376_12680035
567 Ga0206356_10969911
568 Ga0213876_10087169
569 Ga0207653_10269270
570 Ga0207642_10055499
571 Ga0207688_10212784
572 Ga0207685_10431017
573 Ga0207705_10098834
574 Ga0207654_10124971
575 Ga0207693_10418857
576 Ga0207660_11392619
577 Ga0207662_10211396
578 Ga0207652_10009827
579 Ga0207652_11059738
580 Ga0207646_10023532
581 Ga0207646_10087833
582 Ga0207646_10411494
583 Ga0207681_10079330
584 Ga0207694_10038612
585 Ga0207694_10677211
586 Ga0207650_11348863
587 Ga0207687_10103539
588 Ga0207644_10527726
589 Ga0207690_10453621
590 Ga0207706_10732667
591 Ga0207686_10161312
592 Ga0207670_10380623
593 Ga0207669_10070090
594 Ga0207711_11088848
595 Ga0207679_10772628
596 Ga0207679_12026127
597 Ga0207667_10002189
598 Ga0207667_10095818
599 Ga0207651_11579395
600 Ga0207712_11012050
601 Ga0207668_10848733
602 Ga0207658_10446077
603 Ga0207677_11029173
604 Ga0207639_11431772
605 Ga0207702_10580997
606 Ga0207702_10713398
607 Ga0207641_10525285
608 Ga0207641_10721526
609 Ga0207641_10733991
610 Ga0207641_10821430
611 Ga0207641_11139771
612 Ga0207676_12264820
613 Ga0207674_10468169
614 Ga0207674_11328296
615 Ga0207675_100088391
616 Ga0207675_100202910
617 Ga0207683_11315921
618 Ga0209588_1019235
619 Ga0209588_1033416
620 Ga0207428_10040906
621 Ga0207428_10179297
622 Ga0268264_11252269
623 Ga0268264_11879892
624 Ga0265319_1021297
625 Ga0265338_10019853
626 Ga0265320_10010114
627 Ga0307513_10036422
628 Ga0307405_10205779
629 Ga0307413_10078696
630 Ga0307413_10837608
631 Ga0307410_10272590
632 Ga0307410_10979144
633 Ga0307406_10294815
634 Ga0307406_10510477
635 Ga0307407_10300547
636 Ga0307412_11040029
637 Ga0307409_100460615
638 Ga0307409_101775290
639 Ga0307416_100275847
640 Ga0307416_100302254
641 Ga0307416_101028829
642 Ga0307416_101126629
643 Ga0307416_101721649
644 Ga0307411_10599393
645 Ga0307415_100724156
646 Ga0373958_0184005
647 Ga0373938_0013026
648 Ga0373934_0000518
649 Ga0373944_0083950
650 Ga0373951_0107204
651 Ga0373952_0079843
652 Ga0373923_0002275
653 Ga0373923_0083294
654 Ga0373953_0005257
655 Ga0373954_0054904
656 Ga0373956_0001579
657 Ga0373957_0004863
658 Ga0373955_0003928
659 Ga0373955_0297960
660 Ga0373931_0508099
661 Ga0373935_0312980
662 Ga0373927_0017122
663 Ga0373933_0016257
664 Ga0373933_0555836
665 Ga0373937_0013847
666 Ga0373937_0464563
667 Ga0373937_1125357
668 Ga0373925_0373068
669 Ga0373925_1134415
670 Ga0395900_0497207
671 Ga0395900_1018395
672 Ga0395898_0820655
673 Ga0395905_0330091
674 Ga0395901_0059793
675 Ga0395901_0437659
676 Ga0395901_1198492
677 Ga0436365_0057957
678 Ga0451791_0001596
679 Ga0451793_0304576
680 Ga0451798_0746010
681 Ga0451802_1087347
682 Ga0451835_0933718
683 Ga0451851_0244292
684 Ga0450901_032179
685 Ga0451577_0204236
686 Ga0451577_0237487
687 Ga0451577_0428410
688 Ga0451577_0478422
689 Ga0466972_0208862
690 Ga0453683_0068377
691 Ga0466966_0142638
692 Ga0466961_0057624
693 Ga0466963_0017056
694 Ga0453684_0015722
695 Ga0453684_0947535
696 Ga0466959_0038482
697 Ga0451576_0014042
698 Ga0451576_0033103
699 Ga0451576_0059386
700 Ga0451576_0077132
701 Ga0451576_0167493
702 Ga0451576_0636795
703 Ga0451576_0807578
704 Ga0451576_1411199
705 Ga0466958_0733808
706 Ga0495592_0026173
707 Ga0495603_0302798
708 Ga0495641_0035065
709 Ga0495641_0499862
710 Ga0495651_0015755
711 Ga0495653_0429327
712 Ga0495580_0002012
713 Ga0495580_0636611
714 Ga0495582_0015289
715 Ga0495582_0381664
716 Ga0495582_0904652
717 Ga0495639_0089984
718 Ga0495662_0032189
719 Ga0495664_0323559
720 Ga0495594_0011705
721 Ga0495608_0005764
722 Ga0495608_0220007
723 Ga0495618_0071472
724 Ga0495618_0363380
725 Ga0495618_0599420
726 Ga0495628_0000665
727 Ga0495628_0118704
728 Ga0495630_0013483
729 Ga0495630_0403537
730 Ga0495630_0405410
731 Ga0495637_0248545
732 Ga0495666_0021223
733 Ga0495652_0069649
734 Ga0495665_0198033
735 Ga0495640_0022036
736 Ga0495586_0005522
737 Ga0495586_0087445
738 Ga0495587_0002775
739 Ga0495621_0190329
740 Ga0495667_0517986
741 Ga0495634_0035108
742 Ga0495634_0479944
743 Ga0495635_1061978
744 Ga0495657_0049163
745 Ga0495599_0051133
746 Ga0495599_0763395
747 Ga0495647_0004768
748 Ga0495647_0138533
749 Ga0495658_0001249
750 Ga0495658_0021419
751 Ga0495624_0283934
752 Ga0495600_0063332
753 Ga0495600_0466365
754 Ga0495676_0639336
755 Ga0495680_0011404
756 Ga0495675_0008256
757 Ga0495684_0192670
758 Ga0495684_0260955
759 Ga0495593_0179000
760 Ga0495602_0116572
761 Ga0495614_0165697
762 Ga0496100_0773050
763 Ga0496110_0427225
764 Ga0496110_1468663
765 Ga0496111_1083362
766 Ga0496114_0292724
767 Ga0496115_0662585
768 Ga0501034_0053328
769 Ga0501034_0436720
770 Ga0501047_0374981
771 Ga0501070_1425194
772 Ga0501080_0421392
773 Ga0501083_0030733
774 Ga0501044_0012317
775 nmdc:mga05p37_1247239_c1
776 nmdc:mga05p37_1520874_c1
777 nmdc:mga05p37_23415_c1
778 nmdc:mga05p37_25527_c1
779 nmdc:mga09592_1389421_c1
780 nmdc:mga09592_349017_c1
781 nmdc:mga09592_673084_c1
782 nmdc:mga0qj67_1110348_c1
783 nmdc:mga0qj67_726532_c1
784 nmdc:mga08y16_1114718_c1
785 nmdc:mga08y16_206714_c1
786 nmdc:mga08y16_363296_c1
787 nmdc:mga08y16_74017_c1
788 nmdc:mga08y16_87844_c1
789 nmdc:mga0n895_1302630_c1
790 nmdc:mga0n895_195799_c1
791 nmdc:mga0n895_56246_c1
792 nmdc:mga0n895_65045_c1
793 nmdc:mga0n895_73097_c1
794 nmdc:mga0n895_775084_c1
795 nmdc:mga0n895_90326_c1
796 nmdc:mga0rr50_1090_c1
797 nmdc:mga0rr50_435502_c1
798 nmdc:mga0rr50_58888_c1
799 nmdc:mga08x19_32366_c1
800 nmdc:mga08x19_73430_c1
801 nmdc:mga0a205_1068336_c1
802 nmdc:mga0a205_134049_c1
803 nmdc:mga0a205_23976_c1
804 nmdc:mga0a205_260248_c1
805 nmdc:mga0a205_377207_c1
806 nmdc:mga0a205_564438_c1
807 nmdc:mga0a205_59875_c1
808 nmdc:mga0a205_7610_c1
809 nmdc:mga0a205_89856_c1
810 nmdc:mga0a205_9443_c1
811 Ga0495612_0278920
812 Ga0495595_0004071
813 Ga0495619_0030020
814 Ga0501082_0529938

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.8896 2 115
6qcm-assembly1.cif.gz_d cryo em structure of the listeria stressosome 0.8775 1 114
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.8683 2 115
6qcm-assembly1.cif.gz_I cryo em structure of the listeria stressosome 0.8673 1 115
7b0u-assembly1.cif.gz_A stressosome complex from listeria innocua 0.8667 3 116
ID Description Score Start End Superfamily
3if5A02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8236 5 78 3.30.750.24
af_Q10QI4_508_648_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8134 6 115 3.30.750.24
af_Q80ZD3_447_566_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8078 2 112 3.30.750.24
af_Q54BU3_26_271_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.801 22 79 3.20.20.80
4xs5B00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7928 4 120 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A533BIA8-F1-model_v4 Anti-sigma factor antagonist 0.9693 1 119
AF-A0A2V7FHM0-F1-model_v4 STAS domain-containing protein 0.969 1 112
AF-A0A2T1A8M4-F1-model_v4 RsbT antagonist protein RsbS 0.9645 1 111
AF-A0A2V9KEL9-F1-model_v4 Anti-anti-sigma factor 0.9603 1 119
AF-A0A2V7N4W5-F1-model_v4 Anti-anti-sigma factor 0.96 1 118

Map