F436238

General Info

Members Datasets Scaffolds Average Seq Length
406 210 812 271

Family's Representative Sequence

Representative Sequence 3300027876|Ga0209974_10010591|Ga0209974_100105912
Length 304
Sequence VTAHGAAPAATKVSVTVSPRPPGVGAAIERWLLPLYTLGVVAFLALPVVIMIAFSFNDPTGRSNLVFRHFSFDAWLDPFGRPGLEAAVINSIWVGFGATFVSTVLGTLIALALVRYGFRGRGATNMLIFLPMSTPEVVLGASLLTMFVSTTSMPFVPEGLLFPLNIRTILIAHIMFCISYVVVTVKARLQNFPRHLEEAAMDLGANEWTTFWKITFPLILPGVISAALLAFSLSIDDYVITALTSGQTNTFPLYIYGAQLRGIPVQVNVIGTIIFASAVLLVXVTTLWQRRQAIRDFQPARQVE

Samples

Sample ID Description Type Environment
1 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
130 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
131 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
133 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
208 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
209 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
210 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.17
Rhizosphere 93.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209974_10010591 3300027876 Bacteria 3111
2 JGI24739J22299_10033648 3300001989 Bacteria 1752
3 JGI24735J21928_10006571 3300002067 Bacteria 3821
4 JGI25407J50210_10010304 3300003373 Bacteria 2377
5 Ga0065707_10177918 3300005295 Bacteria 1437
6 Ga0070658_10170008 3300005327 Bacteria 1831
7 Ga0070658_10434785 3300005327 Bacteria 1130
8 Ga0070683_100011294 3300005329 Bacteria 7711
9 Ga0070683_100027920 3300005329 Bacteria 5095
10 Ga0070683_100122014 3300005329 Bacteria 2462
11 Ga0070690_100241621 3300005330 Bacteria 1274
12 Ga0070680_100059516 3300005336 Bacteria 3126
13 Ga0070682_100097043 3300005337 Bacteria 1939
14 Ga0068868_100023087 3300005338 Bacteria 4705
15 Ga0070660_100210126 3300005339 Bacteria 1580
16 Ga0070689_100029796 3300005340 Bacteria 4135
17 Ga0070661_100270793 3300005344 Bacteria 1315
18 Ga0070692_10013730 3300005345 Bacteria 3784
19 Ga0070669_100011151 3300005353 Bacteria 6379
20 Ga0070675_100080313 3300005354 Bacteria 2718
21 Ga0070671_100310962 3300005355 Bacteria 1342
22 Ga0070674_100005271 3300005356 Bacteria 7448
23 Ga0070688_100003657 3300005365 Bacteria 7938
24 Ga0070659_100179795 3300005366 Bacteria 1735
25 Ga0070667_100433936 3300005367 Bacteria 1199
26 Ga0070710_10148237 3300005437 Bacteria 1445
27 Ga0070701_10110267 3300005438 Bacteria 1537
28 Ga0070711_100498146 3300005439 Bacteria 1004
29 Ga0070700_100014457 3300005441 Bacteria 4457
30 Ga0070700_100047078 3300005441 Bacteria 2667
31 Ga0070700_100266923 3300005441 Bacteria 1235
32 Ga0070694_100022462 3300005444 Bacteria 4042
33 Ga0070694_100088859 3300005444 Bacteria 2164
34 Ga0070678_100244858 3300005456 Bacteria 1501
35 Ga0070678_100439956 3300005456 Bacteria 1140
36 Ga0070662_100038617 3300005457 Bacteria 3392
37 Ga0070681_10011244 3300005458 Bacteria 8856
38 Ga0070681_10052975 3300005458 Bacteria 4045
39 Ga0068867_100017275 3300005459 Bacteria 5124
40 Ga0070685_10002816 3300005466 Bacteria 8884
41 Ga0070698_100002559 3300005471 Bacteria 20015
42 Ga0070699_100052439 3300005518 Bacteria 3529
43 Ga0070679_100018416 3300005530 Bacteria 6776
44 Ga0070679_100239780 3300005530 Bacteria 1771
45 Ga0070684_100002378 3300005535 Bacteria 13871
46 Ga0070684_100024065 3300005535 Bacteria 5104
47 Ga0070697_100007361 3300005536 Bacteria 8564
48 Ga0070697_100362480 3300005536 Bacteria 1253
49 Ga0068853_100327980 3300005539 Bacteria 1420
50 Ga0068853_100415431 3300005539 Bacteria 1261
51 Ga0070686_100010278 3300005544 Bacteria 5272
52 Ga0070695_100012528 3300005545 Bacteria 5090
53 Ga0070696_100007240 3300005546 Bacteria 7408
54 Ga0070696_100046863 3300005546 Bacteria 2998
55 Ga0070693_100227167 3300005547 Bacteria 1226
56 Ga0070665_100404135 3300005548 Bacteria 1374
57 Ga0070704_100091493 3300005549 Bacteria 2269
58 Ga0068855_100207641 3300005563 Bacteria 2203
59 Ga0070664_100009909 3300005564 Bacteria 7724
60 Ga0068857_100005287 3300005577 Bacteria 10992
61 Ga0068857_100124088 3300005577 Bacteria 2326
62 Ga0068857_100400928 3300005577 Bacteria 1276
63 Ga0068854_100203037 3300005578 Bacteria 1559
64 Ga0068856_100644530 3300005614 Bacteria 1080
65 Ga0068859_100012038 3300005617 Bacteria 8689
66 Ga0068864_100005562 3300005618 Bacteria 10333
67 Ga0068864_100040648 3300005618 Bacteria 3977
68 Ga0068866_10020013 3300005718 Bacteria 3058
69 Ga0068866_10219658 3300005718 Bacteria 1146
70 Ga0068861_100039075 3300005719 Bacteria 3540
71 Ga0068870_10117894 3300005840 Bacteria 1525
72 Ga0068863_100142030 3300005841 Bacteria 2295
73 Ga0068860_100016081 3300005843 Bacteria 7298
74 Ga0068860_100133496 3300005843 Bacteria 2383
75 Ga0068862_100040023 3300005844 Bacteria 3983
76 Ga0081455_10007160 3300005937 Bacteria 11796
77 Ga0081455_10100349 3300005937 Bacteria 2326
78 Ga0081538_10002362 3300005981 Bacteria 18550
79 Ga0081538_10008978 3300005981 Bacteria 8401
80 Ga0081538_10009675 3300005981 Bacteria 8004
81 Ga0081538_10046936 3300005981 Bacteria 2656
82 Ga0081540_1000687 3300005983 Bacteria 31570
83 Ga0075428_100000219 3300006844 Bacteria 55414
84 Ga0075428_100043509 3300006844 Bacteria 4937
85 Ga0075428_100104057 3300006844 Bacteria 3095
86 Ga0075428_100298003 3300006844 Bacteria 1734
87 Ga0075430_100105500 3300006846 Bacteria 2351
88 Ga0075430_100263080 3300006846 Bacteria 1428
89 Ga0075431_100259210 3300006847 Bacteria 1765
90 Ga0075431_100681484 3300006847 Bacteria 1006
91 Ga0068865_100006824 3300006881 Bacteria 6993
92 Ga0097620_100012037 3300006931 Bacteria 8689
93 Ga0105245_10017395 3300009098 Bacteria 6271
94 Ga0105245_10055296 3300009098 Bacteria 3565
95 Ga0114129_10012996 3300009147 Bacteria 11854
96 Ga0114129_10024029 3300009147 Bacteria 8637
97 Ga0114129_10089155 3300009147 Bacteria 4276
98 Ga0114129_10177854 3300009147 Bacteria 2897
99 Ga0114129_10209697 3300009147 Bacteria 2634
100 Ga0114129_10460972 3300009147 Bacteria 1666
101 Ga0105243_10004449 3300009148 Bacteria 11087
102 Ga0105243_10045674 3300009148 Bacteria 3443
103 Ga0105243_10133167 3300009148 Bacteria 2112
104 Ga0105241_10120192 3300009174 Bacteria 2114
105 Ga0105242_10030924 3300009176 Bacteria 4276
106 Ga0105242_10631508 3300009176 Bacteria 1039
107 Ga0105248_10548743 3300009177 Bacteria 1304
108 Ga0105249_10007682 3300009553 Bacteria 9397
109 Ga0105249_10475808 3300009553 Bacteria 1291
110 Ga0105246_10016674 3300011119 Bacteria 4655
111 Ga0105246_10170578 3300011119 Bacteria 1666
112 Ga0157369_10071713 3300013105 Bacteria 3717
113 Ga0163162_10035106 3300013306 Bacteria 4993
114 Ga0157375_10078282 3300013308 Bacteria 3338
115 Ga0163163_10012405 3300014325 Bacteria 7762
116 Ga0163163_10969916 3300014325 Bacteria 913
117 Ga0157380_10056178 3300014326 Bacteria 3130
118 Ga0182008_10172380 3300014497 Bacteria 1093
119 Ga0157377_10008391 3300014745 Bacteria 5037
120 Ga0157377_10059311 3300014745 Bacteria 2181
121 Ga0157379_10107399 3300014968 Bacteria 2506
122 Ga0157379_10129510 3300014968 Bacteria 2271
123 Ga0207653_10040607 3300025885 Bacteria 1526
124 Ga0207692_10179146 3300025898 Bacteria 1233
125 Ga0207688_10071968 3300025901 Bacteria 1964
126 Ga0207647_10004833 3300025904 Bacteria 9964
127 Ga0207647_10047470 3300025904 Bacteria 2671
128 Ga0207643_10036369 3300025908 Bacteria 2761
129 Ga0207707_10050656 3300025912 Bacteria 3617
130 Ga0207707_10135546 3300025912 Bacteria 2153
131 Ga0207660_10152461 3300025917 Bacteria 1777
132 Ga0207662_10029562 3300025918 Bacteria 3176
133 Ga0207657_10199043 3300025919 Bacteria 1613
134 Ga0207649_10057450 3300025920 Bacteria 2433
135 Ga0207652_10196641 3300025921 Bacteria 1814
136 Ga0207681_10030900 3300025923 Bacteria 3495
137 Ga0207650_10089411 3300025925 Bacteria 2350
138 Ga0207659_10019330 3300025926 Bacteria 4482
139 Ga0207659_10177875 3300025926 Bacteria 1683
140 Ga0207687_10013067 3300025927 Bacteria 5426
141 Ga0207687_10159015 3300025927 Bacteria 1732
142 Ga0207690_10258856 3300025932 Bacteria 1347
143 Ga0207686_10023020 3300025934 Bacteria 3594
144 Ga0207669_10022752 3300025937 Bacteria 3335
145 Ga0207704_10006171 3300025938 Bacteria 5564
146 Ga0207661_10024412 3300025944 Bacteria 4582
147 Ga0207661_10043196 3300025944 Bacteria 3556
148 Ga0207661_10267674 3300025944 Bacteria 1524
149 Ga0207712_10066964 3300025961 Bacteria 2569
150 Ga0207712_10115582 3300025961 Bacteria 2020
151 Ga0207712_10163584 3300025961 Bacteria 1732
152 Ga0207668_10234385 3300025972 Bacteria 1482
153 Ga0207640_10131285 3300025981 Bacteria 1811
154 Ga0207703_10311956 3300026035 Bacteria 1438
155 Ga0207708_10055282 3300026075 Bacteria 3026
156 Ga0207708_10137343 3300026075 Bacteria 1915
157 Ga0207708_10308579 3300026075 Bacteria 1288
158 Ga0207648_10102007 3300026089 Bacteria 2515
159 Ga0207676_10007481 3300026095 Bacteria 7751
160 Ga0207676_10171955 3300026095 Bacteria 1889
161 Ga0207674_10004750 3300026116 Bacteria 16287
162 Ga0207674_10009105 3300026116 Bacteria 11395
163 Ga0207674_10126015 3300026116 Bacteria 2526
164 Ga0207675_100028697 3300026118 Bacteria 5183
165 Ga0207675_100042285 3300026118 Bacteria 4254
166 Ga0207675_100069245 3300026118 Bacteria 3298
167 Ga0207683_10375715 3300026121 Bacteria 1306
168 Ga0209966_1018127 3300027695 Bacteria 1347
169 Ga0209974_10006971 3300027876 Bacteria 3913
170 Ga0207428_10159412 3300027907 Bacteria 1714
171 Ga0207428_10160849 3300027907 Bacteria 1705
172 Ga0268266_10096920 3300028379 Bacteria 2594
173 Ga0268265_10169521 3300028380 Bacteria 1864
174 Ga0268264_10139653 3300028381 Bacteria 2159
175 Ga0316575_10001676 3300031665 Bacteria 7243
176 Ga0316579_10029860 3300031691 Bacteria 2488
177 Ga0316579_10085470 3300031691 Bacteria 1505
178 Ga0316576_10011499 3300031727 Bacteria 5802
179 Ga0316576_10099481 3300031727 Bacteria 2172
180 Ga0316578_10078776 3300031728 Bacteria 1958
181 Ga0307405_10117139 3300031731 Bacteria 1816
182 Ga0307410_10059453 3300031852 Bacteria 2609
183 Ga0307406_10043055 3300031901 Bacteria 2822
184 Ga0307409_100037573 3300031995 Bacteria 3571
185 Ga0307409_100337348 3300031995 Bacteria 1417
186 Ga0307416_100145680 3300032002 Bacteria 2162
187 Ga0307414_10064594 3300032004 Bacteria 2607
188 Ga0307411_10024060 3300032005 Bacteria 3623
189 Ga0307411_10098155 3300032005 Bacteria 2064
190 Ga0307415_100004850 3300032126 Bacteria 7056
191 Ga0307415_100143386 3300032126 Bacteria 1828
192 Ga0316583_10017238 3300032133 Bacteria 2597
193 Ga0316585_10014495 3300032137 Bacteria 2356
194 Ga0316580_10038459 3300032139 Bacteria 1479
195 Ga0316574_0001582 3300035398 Bacteria 10884
196 Ga0316574_0020118 3300035398 Bacteria 3948
197 Ga0316574_0187678 3300035398 Bacteria 1329
198 Ga0316582_0003449 3300036647 Bacteria 7760
199 Ga0316582_0027112 3300036647 Bacteria 3456
200 Ga0316584_0143712 3300036712 Bacteria 1778
201 Ga0395900_0040799 3300037418 Bacteria 4784
202 Ga0395900_0115345 3300037418 Bacteria 2756
203 Ga0395898_0036272 3300037466 Bacteria 4896
204 Ga0395898_0039347 3300037466 Bacteria 4681
205 Ga0395898_0185733 3300037466 Bacteria 1986
206 Ga0395905_0081044 3300037471 Bacteria 3042
207 Ga0316581_0056310 3300037588 Bacteria 1205
208 Ga0395901_0055739 3300038443 Bacteria 4111
209 Ga0395901_0101535 3300038443 Bacteria 3018
210 Ga0395901_0146536 3300038443 Bacteria 2481
211 Ga0395901_0249759 3300038443 Bacteria 1848
212 Ga0451853_0004109 3300041512 Bacteria 3418
213 Ga0451853_2915666 3300041512 Bacteria 1255
214 Ga0439456_052329 3300042013 Bacteria 893
215 Ga0466967_0011074 3300045976 Bacteria 6809
216 Ga0495639_0050417 3300046475 Bacteria 1891
217 Ga0495606_0003114 3300046507 Bacteria 18010
218 Ga0495644_0043362 3300046523 Bacteria 1693
219 Ga0495668_0000182 3300046616 Bacteria 93763
220 Ga0495625_0000464 3300046660 Bacteria 60878
221 Ga0495581_0155924 3300047315 Bacteria 1334
222 Ga0495614_0093198 3300048089 Bacteria 1312
223 Ga0495626_0000286 3300048091 Bacteria 54819
224 Ga0496100_0031088 3300048903 Bacteria 3316
225 Ga0496101_0006280 3300048904 Bacteria 7650
226 Ga0496102_0015740 3300048905 Bacteria 6590
227 Ga0496102_0175972 3300048905 Bacteria 2015
228 Ga0496102_0223482 3300048905 Bacteria 1775
229 Ga0496104_0020972 3300048907 Bacteria 5995
230 Ga0496105_0024290 3300048908 Bacteria 4925
231 Ga0496106_0019419 3300048909 Bacteria 5040
232 Ga0496106_0022722 3300048909 Bacteria 4661
233 Ga0496107_0008800 3300048910 Bacteria 6994
234 Ga0496108_0009676 3300048911 Bacteria 7813
235 Ga0496108_0012791 3300048911 Bacteria 6834
236 Ga0496108_0123053 3300048911 Bacteria 2226
237 Ga0496108_0353832 3300048911 Bacteria 1282
238 Ga0496109_0023657 3300048912 Bacteria 5453
239 Ga0496109_0241632 3300048912 Bacteria 1699
240 Ga0496109_0375351 3300048912 Bacteria 1343
241 Ga0496112_0168672 3300048915 Bacteria 2155
242 Ga0496114_0022858 3300048917 Bacteria 5096
243 Ga0496114_0174103 3300048917 Bacteria 1877
244 Ga0496114_0716690 3300048917 Bacteria 876
245 Ga0496119_0001300 3300048922 Bacteria 30877
246 Ga0496120_0036438 3300048923 Bacteria 2927
247 Ga0496121_0000040 3300048924 Bacteria 348494
248 Ga0501031_0002766 3300049568 Bacteria 11176
249 Ga0501031_0010018 3300049568 Bacteria 6173
250 Ga0501031_0106608 3300049568 Bacteria 1829
251 Ga0501031_0116964 3300049568 Bacteria 1742
252 Ga0501031_0171502 3300049568 Bacteria 1418
253 Ga0501032_0000805 3300049569 Bacteria 25528
254 Ga0501032_0209583 3300049569 Bacteria 1271
255 Ga0501033_0000239 3300049570 Bacteria 52812
256 Ga0501033_0016763 3300049570 Bacteria 5542
257 Ga0501034_0099103 3300049571 Bacteria 2909
258 Ga0501036_0000107 3300049572 Bacteria 51071
259 Ga0501036_0020051 3300049572 Bacteria 5614
260 Ga0501036_0288646 3300049572 Bacteria 1373
261 Ga0501036_0291731 3300049572 Bacteria 1365
262 Ga0501036_0420970 3300049572 Bacteria 1113
263 Ga0501037_0000246 3300049573 Bacteria 46138
264 Ga0501037_0342191 3300049573 Bacteria 1033
265 Ga0501038_0000367 3300049574 Bacteria 39046
266 Ga0501038_0008785 3300049574 Bacteria 9265
267 Ga0501038_0035307 3300049574 Bacteria 4390
268 Ga0501038_0067380 3300049574 Bacteria 3045
269 Ga0501038_0259025 3300049574 Bacteria 1375
270 Ga0501039_0001144 3300049575 Bacteria 19565
271 Ga0501039_0014012 3300049575 Bacteria 6134
272 Ga0501039_0017725 3300049575 Bacteria 5462
273 Ga0501039_0162998 3300049575 Bacteria 1753
274 Ga0501040_0004432 3300049576 Bacteria 9117
275 Ga0501040_0028275 3300049576 Bacteria 3778
276 Ga0501040_0075042 3300049576 Bacteria 2337
277 Ga0501040_0201428 3300049576 Bacteria 1413
278 Ga0501041_0000011 3300049577 Bacteria 58729
279 Ga0501041_0028276 3300049577 Bacteria 3382
280 Ga0501041_0156187 3300049577 Bacteria 1425
281 Ga0501041_0194885 3300049577 Bacteria 1269
282 Ga0501042_0000099 3300049578 Bacteria 34541
283 Ga0501042_0008022 3300049578 Bacteria 6947
284 Ga0501042_0009041 3300049578 Bacteria 6622
285 Ga0501042_0120166 3300049578 Bacteria 1891
286 Ga0501043_0000477 3300049579 Bacteria 35754
287 Ga0501046_0002422 3300049580 Bacteria 17482
288 Ga0501046_0002435 3300049580 Bacteria 17438
289 Ga0501046_0131933 3300049580 Bacteria 1894
290 Ga0501046_0132651 3300049580 Bacteria 1889
291 Ga0501047_0010496 3300049581 Bacteria 8764
292 Ga0501048_0001998 3300049582 Bacteria 15497
293 Ga0501048_0386571 3300049582 Bacteria 999
294 Ga0501067_0004282 3300049583 Bacteria 7865
295 Ga0501067_0091929 3300049583 Bacteria 1684
296 Ga0501068_0000503 3300049584 Bacteria 19894
297 Ga0501068_0004704 3300049584 Bacteria 7431
298 Ga0501068_0033119 3300049584 Bacteria 3076
299 Ga0501068_0194329 3300049584 Bacteria 1286
300 Ga0501068_0240858 3300049584 Bacteria 1151
301 Ga0501069_0009224 3300049585 Bacteria 5206
302 Ga0501069_0026230 3300049585 Bacteria 3191
303 Ga0501069_0036616 3300049585 Bacteria 2707
304 Ga0501070_0002846 3300049586 Bacteria 15099
305 Ga0501070_0003761 3300049586 Bacteria 13104
306 Ga0501070_0138347 3300049586 Bacteria 2011
307 Ga0501071_0000110 3300049587 Bacteria 32049
308 Ga0501071_0006457 3300049587 Bacteria 7611
309 Ga0501071_0047280 3300049587 Bacteria 3091
310 Ga0501071_0114318 3300049587 Bacteria 1996
311 Ga0501072_0001797 3300049588 Bacteria 15967
312 Ga0501072_0014183 3300049588 Bacteria 6106
313 Ga0501072_0036362 3300049588 Bacteria 3860
314 Ga0501072_0157352 3300049588 Bacteria 1812
315 Ga0501072_0169883 3300049588 Bacteria 1740
316 Ga0501072_0196247 3300049588 Bacteria 1610
317 Ga0501072_0286167 3300049588 Bacteria 1311
318 Ga0501073_0001339 3300049589 Bacteria 18158
319 Ga0501073_0317680 3300049589 Bacteria 1075
320 Ga0501074_0000158 3300049590 Bacteria 35682
321 Ga0501074_0153987 3300049590 Bacteria 1643
322 Ga0501075_0000778 3300049591 Bacteria 19920
323 Ga0501075_0009421 3300049591 Bacteria 6830
324 Ga0501075_0030279 3300049591 Bacteria 4008
325 Ga0501075_0334174 3300049591 Bacteria 1155
326 Ga0501075_0422701 3300049591 Bacteria 1016
327 Ga0501076_0000289 3300049592 Bacteria 31371
328 Ga0501076_0003100 3300049592 Bacteria 11572
329 Ga0501076_0013348 3300049592 Bacteria 6160
330 Ga0501076_0078330 3300049592 Bacteria 2652
331 Ga0501076_0097413 3300049592 Bacteria 2369
332 Ga0501076_0255329 3300049592 Bacteria 1435
333 Ga0501077_0000076 3300049593 Bacteria 49484
334 Ga0501077_0067365 3300049593 Bacteria 2270
335 Ga0501077_0183144 3300049593 Bacteria 1331
336 Ga0501077_0194495 3300049593 Bacteria 1288
337 Ga0501079_0000053 3300049741 Bacteria 51071
338 Ga0501079_0005125 3300049741 Bacteria 9739
339 Ga0501079_0006216 3300049741 Bacteria 8962
340 Ga0501079_0041348 3300049741 Bacteria 3558
341 Ga0501079_0066305 3300049741 Bacteria 2785
342 Ga0501079_0179952 3300049741 Bacteria 1650
343 Ga0501079_0190713 3300049741 Bacteria 1599
344 Ga0501079_0245178 3300049741 Bacteria 1400
345 Ga0501079_0427028 3300049741 Bacteria 1040
346 Ga0501080_0000136 3300049742 Bacteria 52047
347 Ga0501080_0075281 3300049742 Bacteria 3140
348 Ga0501080_0197621 3300049742 Bacteria 1847
349 Ga0501080_0321854 3300049742 Bacteria 1400
350 Ga0501080_0534327 3300049742 Bacteria 1045
351 Ga0501081_0000025 3300049743 Bacteria 54545
352 Ga0501081_0004345 3300049743 Bacteria 9087
353 Ga0501081_0027384 3300049743 Bacteria 3845
354 Ga0501081_0059752 3300049743 Bacteria 2640
355 Ga0501081_0084884 3300049743 Bacteria 2221
356 Ga0501081_0090574 3300049743 Bacteria 2150
357 Ga0501081_0205072 3300049743 Bacteria 1431
358 Ga0501083_0000234 3300049744 Bacteria 35676
359 Ga0501035_0002153 3300049822 Bacteria 19556
360 Ga0501044_0404765 3300049823 Bacteria 1277
361 Ga0501045_0000035 3300049824 Bacteria 58729
362 Ga0501045_0007470 3300049824 Bacteria 7589
363 Ga0501045_0008760 3300049824 Bacteria 7060
364 Ga0501045_0028050 3300049824 Bacteria 4060
365 Ga0501045_0137850 3300049824 Bacteria 1814
366 Ga0501045_0305243 3300049824 Bacteria 1185
367 nmdc:mga05p37_11762_c1 3300050507 Bacteria 10433
368 nmdc:mga05p37_33709_c1 3300050507 Bacteria 6272
369 nmdc:mga05p37_371739_c1 3300050507 Bacteria 1677
370 nmdc:mga05p37_449339_c1 3300050507 Bacteria 1492
371 nmdc:mga05p37_81044_c1 3300050507 Bacteria 3998
372 nmdc:mga05p37_910066_c1 3300050507 Bacteria 947
373 nmdc:mga09592_18622_c1 3300050508 Bacteria 5695
374 nmdc:mga0qj67_165548_c1 3300050509 Bacteria 1795
375 nmdc:mga0qj67_85903_c1 3300050509 Bacteria 1461
376 nmdc:mga06r32_380179_c1 3300050510 Bacteria 1395
377 nmdc:mga06r32_9061_c1 3300050510 Bacteria 8969
378 nmdc:mga08y16_158375_c1 3300050511 Bacteria 2353
379 nmdc:mga0a205_301821_c1 3300050515 Bacteria 1474
380 Ga0501084_0000336 3300054114 Bacteria 35754
381 Ga0501084_0002253 3300054114 Bacteria 15487
382 Ga0501084_0022980 3300054114 Bacteria 5205
383 Ga0501084_0090201 3300054114 Bacteria 2573
384 Ga0501084_0106244 3300054114 Bacteria 2358
385 Ga0501084_0249882 3300054114 Bacteria 1497
386 Ga0501084_0250718 3300054114 Bacteria 1494
387 Ga0501084_0310590 3300054114 Bacteria 1331
388 Ga0590075_024568 3300059424 Bacteria 1513
389 Ga0501082_0002617 3300060353 Bacteria 15723
390 Ga0501082_0025534 3300060353 Bacteria 5091
391 Ga0501082_0033002 3300060353 Bacteria 4464
392 Ga0501082_0156223 3300060353 Bacteria 1982
393 Ga0501082_0273445 3300060353 Bacteria 1470
394 Ga0501082_0366280 3300060353 Bacteria 1257
395 Ga0530510_0000905 3300061734 Bacteria 19569
396 Ga0530510_0000918 3300061734 Bacteria 19421
397 Ga0530510_0004398 3300061734 Bacteria 9757
398 Ga0530510_0030187 3300061734 Bacteria 3892
399 Ga0530510_0117174 3300061734 Bacteria 1953
400 Ga0530510_0122433 3300061734 Bacteria 1910
401 Ga0530510_0123689 3300061734 Bacteria 1900
402 Ga0530510_0125069 3300061734 Bacteria 1890
403 2887483995 2887478801 Bacteria 8972725
404 2919449766 2919446982 Bacteria 3994487
405 8001783745 8001781756 Bacteria 9586736
406 8001784865 8001781756 Bacteria 9586736
407 Ga0209974_10010591
408 JGI24739J22299_10033648
409 JGI24735J21928_10006571
410 JGI25407J50210_10010304
411 Ga0065707_10177918
412 Ga0070658_10170008
413 Ga0070658_10434785
414 Ga0070683_100011294
415 Ga0070683_100027920
416 Ga0070683_100122014
417 Ga0070690_100241621
418 Ga0070680_100059516
419 Ga0070682_100097043
420 Ga0068868_100023087
421 Ga0070660_100210126
422 Ga0070689_100029796
423 Ga0070661_100270793
424 Ga0070692_10013730
425 Ga0070669_100011151
426 Ga0070675_100080313
427 Ga0070671_100310962
428 Ga0070674_100005271
429 Ga0070688_100003657
430 Ga0070659_100179795
431 Ga0070667_100433936
432 Ga0070710_10148237
433 Ga0070701_10110267
434 Ga0070711_100498146
435 Ga0070700_100014457
436 Ga0070700_100047078
437 Ga0070700_100266923
438 Ga0070694_100022462
439 Ga0070694_100088859
440 Ga0070678_100244858
441 Ga0070678_100439956
442 Ga0070662_100038617
443 Ga0070681_10011244
444 Ga0070681_10052975
445 Ga0068867_100017275
446 Ga0070685_10002816
447 Ga0070698_100002559
448 Ga0070699_100052439
449 Ga0070679_100018416
450 Ga0070679_100239780
451 Ga0070684_100002378
452 Ga0070684_100024065
453 Ga0070697_100007361
454 Ga0070697_100362480
455 Ga0068853_100327980
456 Ga0068853_100415431
457 Ga0070686_100010278
458 Ga0070695_100012528
459 Ga0070696_100007240
460 Ga0070696_100046863
461 Ga0070693_100227167
462 Ga0070665_100404135
463 Ga0070704_100091493
464 Ga0068855_100207641
465 Ga0070664_100009909
466 Ga0068857_100005287
467 Ga0068857_100124088
468 Ga0068857_100400928
469 Ga0068854_100203037
470 Ga0068856_100644530
471 Ga0068859_100012038
472 Ga0068864_100005562
473 Ga0068864_100040648
474 Ga0068866_10020013
475 Ga0068866_10219658
476 Ga0068861_100039075
477 Ga0068870_10117894
478 Ga0068863_100142030
479 Ga0068860_100016081
480 Ga0068860_100133496
481 Ga0068862_100040023
482 Ga0081455_10007160
483 Ga0081455_10100349
484 Ga0081538_10002362
485 Ga0081538_10008978
486 Ga0081538_10009675
487 Ga0081538_10046936
488 Ga0081540_1000687
489 Ga0075428_100000219
490 Ga0075428_100043509
491 Ga0075428_100104057
492 Ga0075428_100298003
493 Ga0075430_100105500
494 Ga0075430_100263080
495 Ga0075431_100259210
496 Ga0075431_100681484
497 Ga0068865_100006824
498 Ga0097620_100012037
499 Ga0105245_10017395
500 Ga0105245_10055296
501 Ga0114129_10012996
502 Ga0114129_10024029
503 Ga0114129_10089155
504 Ga0114129_10177854
505 Ga0114129_10209697
506 Ga0114129_10460972
507 Ga0105243_10004449
508 Ga0105243_10045674
509 Ga0105243_10133167
510 Ga0105241_10120192
511 Ga0105242_10030924
512 Ga0105242_10631508
513 Ga0105248_10548743
514 Ga0105249_10007682
515 Ga0105249_10475808
516 Ga0105246_10016674
517 Ga0105246_10170578
518 Ga0157369_10071713
519 Ga0163162_10035106
520 Ga0157375_10078282
521 Ga0163163_10012405
522 Ga0163163_10969916
523 Ga0157380_10056178
524 Ga0182008_10172380
525 Ga0157377_10008391
526 Ga0157377_10059311
527 Ga0157379_10107399
528 Ga0157379_10129510
529 Ga0207653_10040607
530 Ga0207692_10179146
531 Ga0207688_10071968
532 Ga0207647_10004833
533 Ga0207647_10047470
534 Ga0207643_10036369
535 Ga0207707_10050656
536 Ga0207707_10135546
537 Ga0207660_10152461
538 Ga0207662_10029562
539 Ga0207657_10199043
540 Ga0207649_10057450
541 Ga0207652_10196641
542 Ga0207681_10030900
543 Ga0207650_10089411
544 Ga0207659_10019330
545 Ga0207659_10177875
546 Ga0207687_10013067
547 Ga0207687_10159015
548 Ga0207690_10258856
549 Ga0207686_10023020
550 Ga0207669_10022752
551 Ga0207704_10006171
552 Ga0207661_10024412
553 Ga0207661_10043196
554 Ga0207661_10267674
555 Ga0207712_10066964
556 Ga0207712_10115582
557 Ga0207712_10163584
558 Ga0207668_10234385
559 Ga0207640_10131285
560 Ga0207703_10311956
561 Ga0207708_10055282
562 Ga0207708_10137343
563 Ga0207708_10308579
564 Ga0207648_10102007
565 Ga0207676_10007481
566 Ga0207676_10171955
567 Ga0207674_10004750
568 Ga0207674_10009105
569 Ga0207674_10126015
570 Ga0207675_100028697
571 Ga0207675_100042285
572 Ga0207675_100069245
573 Ga0207683_10375715
574 Ga0209966_1018127
575 Ga0209974_10006971
576 Ga0207428_10159412
577 Ga0207428_10160849
578 Ga0268266_10096920
579 Ga0268265_10169521
580 Ga0268264_10139653
581 Ga0316575_10001676
582 Ga0316579_10029860
583 Ga0316579_10085470
584 Ga0316576_10011499
585 Ga0316576_10099481
586 Ga0316578_10078776
587 Ga0307405_10117139
588 Ga0307410_10059453
589 Ga0307406_10043055
590 Ga0307409_100037573
591 Ga0307409_100337348
592 Ga0307416_100145680
593 Ga0307414_10064594
594 Ga0307411_10024060
595 Ga0307411_10098155
596 Ga0307415_100004850
597 Ga0307415_100143386
598 Ga0316583_10017238
599 Ga0316585_10014495
600 Ga0316580_10038459
601 Ga0316574_0001582
602 Ga0316574_0020118
603 Ga0316574_0187678
604 Ga0316582_0003449
605 Ga0316582_0027112
606 Ga0316584_0143712
607 Ga0395900_0040799
608 Ga0395900_0115345
609 Ga0395898_0036272
610 Ga0395898_0039347
611 Ga0395898_0185733
612 Ga0395905_0081044
613 Ga0316581_0056310
614 Ga0395901_0055739
615 Ga0395901_0101535
616 Ga0395901_0146536
617 Ga0395901_0249759
618 Ga0451853_0004109
619 Ga0451853_2915666
620 Ga0439456_052329
621 Ga0466967_0011074
622 Ga0495639_0050417
623 Ga0495606_0003114
624 Ga0495644_0043362
625 Ga0495668_0000182
626 Ga0495625_0000464
627 Ga0495581_0155924
628 Ga0495614_0093198
629 Ga0495626_0000286
630 Ga0496100_0031088
631 Ga0496101_0006280
632 Ga0496102_0015740
633 Ga0496102_0175972
634 Ga0496102_0223482
635 Ga0496104_0020972
636 Ga0496105_0024290
637 Ga0496106_0019419
638 Ga0496106_0022722
639 Ga0496107_0008800
640 Ga0496108_0009676
641 Ga0496108_0012791
642 Ga0496108_0123053
643 Ga0496108_0353832
644 Ga0496109_0023657
645 Ga0496109_0241632
646 Ga0496109_0375351
647 Ga0496112_0168672
648 Ga0496114_0022858
649 Ga0496114_0174103
650 Ga0496114_0716690
651 Ga0496119_0001300
652 Ga0496120_0036438
653 Ga0496121_0000040
654 Ga0501031_0002766
655 Ga0501031_0010018
656 Ga0501031_0106608
657 Ga0501031_0116964
658 Ga0501031_0171502
659 Ga0501032_0000805
660 Ga0501032_0209583
661 Ga0501033_0000239
662 Ga0501033_0016763
663 Ga0501034_0099103
664 Ga0501036_0000107
665 Ga0501036_0020051
666 Ga0501036_0288646
667 Ga0501036_0291731
668 Ga0501036_0420970
669 Ga0501037_0000246
670 Ga0501037_0342191
671 Ga0501038_0000367
672 Ga0501038_0008785
673 Ga0501038_0035307
674 Ga0501038_0067380
675 Ga0501038_0259025
676 Ga0501039_0001144
677 Ga0501039_0014012
678 Ga0501039_0017725
679 Ga0501039_0162998
680 Ga0501040_0004432
681 Ga0501040_0028275
682 Ga0501040_0075042
683 Ga0501040_0201428
684 Ga0501041_0000011
685 Ga0501041_0028276
686 Ga0501041_0156187
687 Ga0501041_0194885
688 Ga0501042_0000099
689 Ga0501042_0008022
690 Ga0501042_0009041
691 Ga0501042_0120166
692 Ga0501043_0000477
693 Ga0501046_0002422
694 Ga0501046_0002435
695 Ga0501046_0131933
696 Ga0501046_0132651
697 Ga0501047_0010496
698 Ga0501048_0001998
699 Ga0501048_0386571
700 Ga0501067_0004282
701 Ga0501067_0091929
702 Ga0501068_0000503
703 Ga0501068_0004704
704 Ga0501068_0033119
705 Ga0501068_0194329
706 Ga0501068_0240858
707 Ga0501069_0009224
708 Ga0501069_0026230
709 Ga0501069_0036616
710 Ga0501070_0002846
711 Ga0501070_0003761
712 Ga0501070_0138347
713 Ga0501071_0000110
714 Ga0501071_0006457
715 Ga0501071_0047280
716 Ga0501071_0114318
717 Ga0501072_0001797
718 Ga0501072_0014183
719 Ga0501072_0036362
720 Ga0501072_0157352
721 Ga0501072_0169883
722 Ga0501072_0196247
723 Ga0501072_0286167
724 Ga0501073_0001339
725 Ga0501073_0317680
726 Ga0501074_0000158
727 Ga0501074_0153987
728 Ga0501075_0000778
729 Ga0501075_0009421
730 Ga0501075_0030279
731 Ga0501075_0334174
732 Ga0501075_0422701
733 Ga0501076_0000289
734 Ga0501076_0003100
735 Ga0501076_0013348
736 Ga0501076_0078330
737 Ga0501076_0097413
738 Ga0501076_0255329
739 Ga0501077_0000076
740 Ga0501077_0067365
741 Ga0501077_0183144
742 Ga0501077_0194495
743 Ga0501079_0000053
744 Ga0501079_0005125
745 Ga0501079_0006216
746 Ga0501079_0041348
747 Ga0501079_0066305
748 Ga0501079_0179952
749 Ga0501079_0190713
750 Ga0501079_0245178
751 Ga0501079_0427028
752 Ga0501080_0000136
753 Ga0501080_0075281
754 Ga0501080_0197621
755 Ga0501080_0321854
756 Ga0501080_0534327
757 Ga0501081_0000025
758 Ga0501081_0004345
759 Ga0501081_0027384
760 Ga0501081_0059752
761 Ga0501081_0084884
762 Ga0501081_0090574
763 Ga0501081_0205072
764 Ga0501083_0000234
765 Ga0501035_0002153
766 Ga0501044_0404765
767 Ga0501045_0000035
768 Ga0501045_0007470
769 Ga0501045_0008760
770 Ga0501045_0028050
771 Ga0501045_0137850
772 Ga0501045_0305243
773 nmdc:mga05p37_11762_c1
774 nmdc:mga05p37_33709_c1
775 nmdc:mga05p37_371739_c1
776 nmdc:mga05p37_449339_c1
777 nmdc:mga05p37_81044_c1
778 nmdc:mga05p37_910066_c1
779 nmdc:mga09592_18622_c1
780 nmdc:mga0qj67_165548_c1
781 nmdc:mga0qj67_85903_c1
782 nmdc:mga06r32_380179_c1
783 nmdc:mga06r32_9061_c1
784 nmdc:mga08y16_158375_c1
785 nmdc:mga0a205_301821_c1
786 Ga0501084_0000336
787 Ga0501084_0002253
788 Ga0501084_0022980
789 Ga0501084_0090201
790 Ga0501084_0106244
791 Ga0501084_0249882
792 Ga0501084_0250718
793 Ga0501084_0310590
794 Ga0590075_024568
795 Ga0501082_0002617
796 Ga0501082_0025534
797 Ga0501082_0033002
798 Ga0501082_0156223
799 Ga0501082_0273445
800 Ga0501082_0366280
801 Ga0530510_0000905
802 Ga0530510_0000918
803 Ga0530510_0004398
804 Ga0530510_0030187
805 Ga0530510_0117174
806 Ga0530510_0122433
807 Ga0530510_0123689
808 Ga0530510_0125069
809 2887483995
810 2919449766
811 8001783745
812 8001784865

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

102

295

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.7467 67 207
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6994 44 258
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6937 44 258
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.6912 1 255
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.6869 8 249
ID Description Score Start End Superfamily
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7683 55 214 1.10.3720.10
af_P0AFK6_8_259_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7667 13 263 1.10.3720.10
af_Q2G2A9_6_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7637 11 263 1.10.3720.10
af_P75798_87_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7594 64 209 1.10.3720.10
af_P0AFL1_11_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7591 10 262 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A0R2X0P8-F1-model_v4 ABC transporter permease 0.8817 2 202 GO:0005886
GO:0055085
AF-A0A0R2X0P8-F1-model_v4 ABC transporter permease 0.8699 2 202 GO:0005886
GO:0055085
AF-A0A349HNE7-F1-model_v4 Spermidine/putrescine ABC transporter permease 0.8629 31 200 GO:0005886
GO:0055085
AF-A0A524AML1-F1-model_v4 ABC transporter permease 0.8621 1 204 GO:0005886
GO:0055085
AF-A0A0U2R4V0-F1-model_v4 3a0106s02: sulfate ABC transporter, permease 0.86 32 210 GO:0005886
GO:0055085

Map