F436223
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 406 | 247 | 406 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300025921|Ga0207652_10266258|Ga0207652_102662583 |
| Length | 134 |
| Sequence | VADSSKIRVGIVGLSPQRGFASIAHVPALHALSDFEIAADQVHPERAGEAGVARSRTQQFGPVRVRLVEYSAGYRADHWCQKGHILFCVAGELETELADGRQFRLSPGMSYQVADNAEPHRSRTAMGATLFIVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 178 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 181 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 182 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 186 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 187 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 188 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 189 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 190 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 191 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 192 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 193 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 194 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 195 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 196 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 230 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 231 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 232 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 233 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 234 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 235 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 236 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 237 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 238 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 239 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 240 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 241 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 243 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 247 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.43 |
| Nodule | 0 |
| Rhizoplane | 6.65 |
| Rhizosphere | 85.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1757691 | 2162886007 | Bacteria | 2603 |
| 2 | JGI24749J21850_1070346 | 3300002076 | Bacteria | 540 |
| 3 | JGI24742J22300_10018238 | 3300002244 | Bacteria | 1189 |
| 4 | JGI25162J39368_1000003 | 3300002737 | Bacteria | 575218 |
| 5 | JGI25163J39215_1000132 | 3300002771 | Bacteria | 30268 |
| 6 | JGI25164J39214_1000211 | 3300002772 | Bacteria | 48878 |
| 7 | Ga0055538_1000005 | 3300003751 | Bacteria | 575218 |
| 8 | Ga0055539_1000007 | 3300003752 | Bacteria | 575218 |
| 9 | Ga0055533_1000009 | 3300003756 | Bacteria | 575218 |
| 10 | Ga0055525_1000010 | 3300003759 | Bacteria | 575218 |
| 11 | Ga0055541_1000005 | 3300003841 | Bacteria | 575218 |
| 12 | Ga0065704_10000516 | 3300005289 | Bacteria | 17979 |
| 13 | Ga0065715_10261743 | 3300005293 | Bacteria | 1136 |
| 14 | Ga0065715_10416148 | 3300005293 | Bacteria | 845 |
| 15 | Ga0065707_10740671 | 3300005295 | Bacteria | 619 |
| 16 | Ga0070658_11986347 | 3300005327 | Unclassified | 502 |
| 17 | Ga0070676_10001146 | 3300005328 | Bacteria | 13233 |
| 18 | Ga0070676_11210086 | 3300005328 | Unclassified | 574 |
| 19 | Ga0070683_100297899 | 3300005329 | Unclassified | 1534 |
| 20 | Ga0070690_100003661 | 3300005330 | Bacteria | 8462 |
| 21 | Ga0070690_101723853 | 3300005330 | Bacteria | 510 |
| 22 | Ga0070670_100359321 | 3300005331 | Bacteria | 1280 |
| 23 | Ga0070677_10002857 | 3300005333 | Bacteria | 5544 |
| 24 | Ga0068869_100070654 | 3300005334 | Bacteria | 2584 |
| 25 | Ga0068869_100338144 | 3300005334 | Bacteria | 1224 |
| 26 | Ga0070666_10003039 | 3300005335 | Bacteria | 10182 |
| 27 | Ga0070666_10034205 | 3300005335 | Bacteria | 3368 |
| 28 | Ga0070680_100075793 | 3300005336 | Bacteria | 2769 |
| 29 | Ga0068868_100000994 | 3300005338 | Bacteria | 19343 |
| 30 | Ga0068868_100149227 | 3300005338 | Bacteria | 1924 |
| 31 | Ga0068868_101545369 | 3300005338 | Bacteria | 622 |
| 32 | Ga0070660_100154404 | 3300005339 | Bacteria | 1847 |
| 33 | Ga0070689_100060702 | 3300005340 | Bacteria | 2940 |
| 34 | Ga0070687_100121874 | 3300005343 | Bacteria | 1492 |
| 35 | Ga0070661_100001578 | 3300005344 | Bacteria | 15807 |
| 36 | Ga0070661_101182272 | 3300005344 | Bacteria | 639 |
| 37 | Ga0070661_101636987 | 3300005344 | Bacteria | 545 |
| 38 | Ga0070692_10110099 | 3300005345 | Bacteria | 1522 |
| 39 | Ga0070668_100174353 | 3300005347 | Bacteria | 1753 |
| 40 | Ga0070668_100833304 | 3300005347 | Bacteria | 821 |
| 41 | Ga0070668_100947990 | 3300005347 | Unclassified | 771 |
| 42 | Ga0070669_100008035 | 3300005353 | Bacteria | 7531 |
| 43 | Ga0070669_100234886 | 3300005353 | Bacteria | 1454 |
| 44 | Ga0070675_100363248 | 3300005354 | Bacteria | 1286 |
| 45 | Ga0070675_100468099 | 3300005354 | Unclassified | 1132 |
| 46 | Ga0070671_100281164 | 3300005355 | Bacteria | 1415 |
| 47 | Ga0070674_100020327 | 3300005356 | Bacteria | 4239 |
| 48 | Ga0070674_100029314 | 3300005356 | Bacteria | 3623 |
| 49 | Ga0070674_101571970 | 3300005356 | Bacteria | 592 |
| 50 | Ga0070673_100084516 | 3300005364 | Bacteria | 2581 |
| 51 | Ga0070673_100277200 | 3300005364 | Bacteria | 1470 |
| 52 | Ga0070673_100428485 | 3300005364 | Bacteria | 1187 |
| 53 | Ga0070688_100348473 | 3300005365 | Bacteria | 1084 |
| 54 | Ga0070659_100000451 | 3300005366 | Bacteria | 30634 |
| 55 | Ga0070659_100065033 | 3300005366 | Bacteria | 2888 |
| 56 | Ga0070667_100153407 | 3300005367 | Bacteria | 2025 |
| 57 | Ga0070703_10473716 | 3300005406 | Bacteria | 559 |
| 58 | Ga0070701_10003628 | 3300005438 | Bacteria | 6139 |
| 59 | Ga0070701_10069200 | 3300005438 | Bacteria | 1882 |
| 60 | Ga0070711_100457195 | 3300005439 | Bacteria | 1046 |
| 61 | Ga0070711_101400448 | 3300005439 | Bacteria | 608 |
| 62 | Ga0070705_100192625 | 3300005440 | Bacteria | 1391 |
| 63 | Ga0070700_100019649 | 3300005441 | Bacteria | 3903 |
| 64 | Ga0070700_100097176 | 3300005441 | Bacteria | 1934 |
| 65 | Ga0070700_100109027 | 3300005441 | Bacteria | 1837 |
| 66 | Ga0070694_100013836 | 3300005444 | Bacteria | 5046 |
| 67 | Ga0070663_100144381 | 3300005455 | Bacteria | 1820 |
| 68 | Ga0070678_100012869 | 3300005456 | Bacteria | 5220 |
| 69 | Ga0070662_100001037 | 3300005457 | Bacteria | 16977 |
| 70 | Ga0068867_100003424 | 3300005459 | Bacteria | 11157 |
| 71 | Ga0068867_100028083 | 3300005459 | Bacteria | 4049 |
| 72 | Ga0068867_100065544 | 3300005459 | Bacteria | 2703 |
| 73 | Ga0068867_100367649 | 3300005459 | Bacteria | 1205 |
| 74 | Ga0068867_102166976 | 3300005459 | Bacteria | 527 |
| 75 | Ga0070685_10410662 | 3300005466 | Bacteria | 940 |
| 76 | Ga0070707_100547593 | 3300005468 | Bacteria | 1119 |
| 77 | Ga0070684_100455771 | 3300005535 | Bacteria | 1182 |
| 78 | Ga0070672_100262776 | 3300005543 | Bacteria | 1456 |
| 79 | Ga0070672_100937799 | 3300005543 | Bacteria | 766 |
| 80 | Ga0070686_100009840 | 3300005544 | Bacteria | 5372 |
| 81 | Ga0070695_100092044 | 3300005545 | Bacteria | 2026 |
| 82 | Ga0070696_100022656 | 3300005546 | Bacteria | 4269 |
| 83 | Ga0070696_100353285 | 3300005546 | Bacteria | 1139 |
| 84 | Ga0070696_101425068 | 3300005546 | Bacteria | 591 |
| 85 | Ga0070693_100052576 | 3300005547 | Bacteria | 2336 |
| 86 | Ga0070704_100023795 | 3300005549 | Bacteria | 4007 |
| 87 | Ga0070704_100202807 | 3300005549 | Bacteria | 1602 |
| 88 | Ga0068855_100360655 | 3300005563 | Bacteria | 1599 |
| 89 | Ga0070664_100373238 | 3300005564 | Bacteria | 1301 |
| 90 | Ga0068857_100066980 | 3300005577 | Bacteria | 3195 |
| 91 | Ga0068857_100169252 | 3300005577 | Bacteria | 1985 |
| 92 | Ga0068854_100000918 | 3300005578 | Bacteria | 17683 |
| 93 | Ga0068854_100094145 | 3300005578 | Bacteria | 2234 |
| 94 | Ga0068854_100932952 | 3300005578 | Bacteria | 765 |
| 95 | Ga0068856_100276709 | 3300005614 | Bacteria | 1695 |
| 96 | Ga0070702_100004718 | 3300005615 | Bacteria | 6258 |
| 97 | Ga0070702_100091052 | 3300005615 | Bacteria | 1850 |
| 98 | Ga0070702_100774424 | 3300005615 | Bacteria | 739 |
| 99 | Ga0068852_101681231 | 3300005616 | Bacteria | 657 |
| 100 | Ga0068859_100007364 | 3300005617 | Bacteria | 11165 |
| 101 | Ga0068859_100565660 | 3300005617 | Bacteria | 1231 |
| 102 | Ga0068864_100010875 | 3300005618 | Bacteria | 7523 |
| 103 | Ga0068864_100052736 | 3300005618 | Bacteria | 3506 |
| 104 | Ga0068864_100063275 | 3300005618 | Bacteria | 3206 |
| 105 | Ga0068864_100148638 | 3300005618 | Bacteria | 2120 |
| 106 | Ga0068866_10000566 | 3300005718 | Bacteria | 16802 |
| 107 | Ga0068866_10002622 | 3300005718 | Bacteria | 7432 |
| 108 | Ga0068861_100338708 | 3300005719 | Bacteria | 1316 |
| 109 | Ga0068870_10015267 | 3300005840 | Unclassified | 3641 |
| 110 | Ga0068863_100029419 | 3300005841 | Bacteria | 5244 |
| 111 | Ga0068863_100189112 | 3300005841 | Bacteria | 1978 |
| 112 | Ga0068858_100031229 | 3300005842 | Bacteria | 4946 |
| 113 | Ga0068858_100168575 | 3300005842 | Bacteria | 2064 |
| 114 | Ga0068860_100020067 | 3300005843 | Bacteria | 6475 |
| 115 | Ga0068860_100080643 | 3300005843 | Bacteria | 3094 |
| 116 | Ga0068862_100120336 | 3300005844 | Bacteria | 2313 |
| 117 | Ga0068862_100651649 | 3300005844 | Bacteria | 1016 |
| 118 | Ga0081455_10000351 | 3300005937 | Bacteria | 60585 |
| 119 | Ga0081455_10283930 | 3300005937 | Bacteria | 1195 |
| 120 | Ga0081455_11007354 | 3300005937 | Bacteria | 515 |
| 121 | Ga0097621_100025871 | 3300006237 | Bacteria | 4597 |
| 122 | Ga0097621_100044215 | 3300006237 | Bacteria | 3593 |
| 123 | Ga0097621_100154791 | 3300006237 | Bacteria | 1967 |
| 124 | Ga0097621_100201160 | 3300006237 | Bacteria | 1729 |
| 125 | Ga0068871_100000178 | 3300006358 | Bacteria | 43025 |
| 126 | Ga0068871_100023387 | 3300006358 | Bacteria | 4779 |
| 127 | Ga0068871_100082490 | 3300006358 | Bacteria | 2666 |
| 128 | Ga0068871_100275875 | 3300006358 | Bacteria | 1469 |
| 129 | Ga0075430_101108069 | 3300006846 | Bacteria | 652 |
| 130 | Ga0075431_100419335 | 3300006847 | Bacteria | 1338 |
| 131 | Ga0075434_100053665 | 3300006871 | Bacteria | 4004 |
| 132 | Ga0068865_100007459 | 3300006881 | Bacteria | 6731 |
| 133 | Ga0068865_101135014 | 3300006881 | Bacteria | 690 |
| 134 | Ga0068865_101625828 | 3300006881 | Bacteria | 581 |
| 135 | Ga0097620_100007364 | 3300006931 | Bacteria | 11165 |
| 136 | Ga0097620_100565585 | 3300006931 | Bacteria | 1231 |
| 137 | Ga0097620_101366246 | 3300006931 | Bacteria | 781 |
| 138 | Ga0105251_10000825 | 3300009011 | Bacteria | 27717 |
| 139 | Ga0105250_10000326 | 3300009092 | Bacteria | 36660 |
| 140 | Ga0105250_10382706 | 3300009092 | Bacteria | 621 |
| 141 | Ga0105240_10527702 | 3300009093 | Bacteria | 1309 |
| 142 | Ga0105245_10081803 | 3300009098 | Bacteria | 2953 |
| 143 | Ga0105245_10479753 | 3300009098 | Bacteria | 1257 |
| 144 | Ga0105247_10964996 | 3300009101 | Bacteria | 663 |
| 145 | Ga0114129_11645158 | 3300009147 | Bacteria | 785 |
| 146 | Ga0105243_10077096 | 3300009148 | Bacteria | 2710 |
| 147 | Ga0105243_10249940 | 3300009148 | Bacteria | 1582 |
| 148 | Ga0105241_10011267 | 3300009174 | Bacteria | 6556 |
| 149 | Ga0105242_10028481 | 3300009176 | Bacteria | 4449 |
| 150 | Ga0105242_10085741 | 3300009176 | Bacteria | 2642 |
| 151 | Ga0105242_11199007 | 3300009176 | Unclassified | 778 |
| 152 | Ga0105248_10005781 | 3300009177 | Bacteria | 13595 |
| 153 | Ga0105248_10011045 | 3300009177 | Bacteria | 9963 |
| 154 | Ga0105248_10870856 | 3300009177 | Bacteria | 1017 |
| 155 | Ga0105248_10887252 | 3300009177 | Bacteria | 1007 |
| 156 | Ga0105237_10610533 | 3300009545 | Bacteria | 1098 |
| 157 | Ga0105238_10033485 | 3300009551 | Bacteria | 5230 |
| 158 | Ga0105249_10005409 | 3300009553 | Bacteria | 11025 |
| 159 | Ga0105249_10076031 | 3300009553 | Bacteria | 3111 |
| 160 | Ga0105249_10207937 | 3300009553 | Bacteria | 1919 |
| 161 | Ga0105249_10638638 | 3300009553 | Bacteria | 1122 |
| 162 | Ga0105239_10023259 | 3300010375 | Bacteria | 6827 |
| 163 | Ga0105239_10370331 | 3300010375 | Bacteria | 1619 |
| 164 | Ga0105246_10021699 | 3300011119 | Unclassified | 4136 |
| 165 | Ga0105246_11850547 | 3300011119 | Bacteria | 578 |
| 166 | Ga0157371_10117232 | 3300013102 | Bacteria | 1893 |
| 167 | Ga0157374_10618758 | 3300013296 | Bacteria | 1093 |
| 168 | Ga0157378_10000730 | 3300013297 | Bacteria | 30701 |
| 169 | Ga0157378_10010351 | 3300013297 | Bacteria | 8141 |
| 170 | Ga0157378_10047759 | 3300013297 | Bacteria | 3806 |
| 171 | Ga0163162_10010483 | 3300013306 | Bacteria | 9011 |
| 172 | Ga0163162_10110532 | 3300013306 | Bacteria | 2845 |
| 173 | Ga0163162_10135015 | 3300013306 | Bacteria | 2578 |
| 174 | Ga0157372_10947207 | 3300013307 | Bacteria | 998 |
| 175 | Ga0157372_13002669 | 3300013307 | Bacteria | 539 |
| 176 | Ga0157375_10001824 | 3300013308 | Bacteria | 18280 |
| 177 | Ga0157375_10170986 | 3300013308 | Bacteria | 2321 |
| 178 | Ga0157375_10223600 | 3300013308 | Bacteria | 2041 |
| 179 | Ga0157375_10255885 | 3300013308 | Bacteria | 1912 |
| 180 | Ga0157375_11603552 | 3300013308 | Bacteria | 769 |
| 181 | Ga0163163_10160500 | 3300014325 | Bacteria | 2293 |
| 182 | Ga0163163_10453234 | 3300014325 | Bacteria | 1343 |
| 183 | Ga0163163_10661776 | 3300014325 | Bacteria | 1108 |
| 184 | Ga0157380_10035693 | 3300014326 | Bacteria | 3841 |
| 185 | Ga0157380_10139874 | 3300014326 | Bacteria | 2078 |
| 186 | Ga0157380_11247964 | 3300014326 | Bacteria | 789 |
| 187 | Ga0157380_12280709 | 3300014326 | Unclassified | 606 |
| 188 | Ga0157377_10002560 | 3300014745 | Bacteria | 8070 |
| 189 | Ga0157379_10053721 | 3300014968 | Bacteria | 3599 |
| 190 | Ga0157379_10085382 | 3300014968 | Bacteria | 2829 |
| 191 | Ga0157376_10123202 | 3300014969 | Bacteria | 2301 |
| 192 | Ga0157376_10226282 | 3300014969 | Bacteria | 1735 |
| 193 | Ga0157376_10593382 | 3300014969 | Bacteria | 1102 |
| 194 | Ga0157376_10744786 | 3300014969 | Bacteria | 988 |
| 195 | Ga0163161_10051305 | 3300017792 | Bacteria | 2987 |
| 196 | Ga0163161_10076421 | 3300017792 | Bacteria | 2458 |
| 197 | Ga0163161_10973045 | 3300017792 | Bacteria | 723 |
| 198 | Ga0209760_100001 | 3300025207 | Bacteria | 348781 |
| 199 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 200 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 201 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 202 | Ga0209563_100008 | 3300025230 | Bacteria | 1554545 |
| 203 | Ga0207427_100002 | 3300025231 | Bacteria | 1355321 |
| 204 | Ga0209437_100007 | 3300025233 | Bacteria | 938377 |
| 205 | Ga0209677_100004 | 3300025253 | Bacteria | 1554545 |
| 206 | Ga0207696_1000415 | 3300025711 | Bacteria | 39668 |
| 207 | Ga0207655_1000157 | 3300025728 | Bacteria | 124885 |
| 208 | Ga0207713_1001476 | 3300025735 | Bacteria | 18623 |
| 209 | Ga0207682_10003487 | 3300025893 | Bacteria | 6817 |
| 210 | Ga0207642_10000341 | 3300025899 | Bacteria | 14012 |
| 211 | Ga0207642_10154218 | 3300025899 | Bacteria | 1226 |
| 212 | Ga0207710_10440933 | 3300025900 | Bacteria | 671 |
| 213 | Ga0207680_10007128 | 3300025903 | Bacteria | 5436 |
| 214 | Ga0207680_10055224 | 3300025903 | Bacteria | 2393 |
| 215 | Ga0207645_10001506 | 3300025907 | Bacteria | 19062 |
| 216 | Ga0207645_10915769 | 3300025907 | Bacteria | 595 |
| 217 | Ga0207643_10010349 | 3300025908 | Bacteria | 5023 |
| 218 | Ga0207643_10020540 | 3300025908 | Bacteria | 3626 |
| 219 | Ga0207654_10013267 | 3300025911 | Bacteria | 4237 |
| 220 | Ga0207695_10406363 | 3300025913 | Bacteria | 1246 |
| 221 | Ga0207695_11144045 | 3300025913 | Bacteria | 658 |
| 222 | Ga0207663_10102899 | 3300025916 | Bacteria | 1922 |
| 223 | Ga0207660_10091359 | 3300025917 | Bacteria | 2258 |
| 224 | Ga0207662_10013199 | 3300025918 | Bacteria | 4617 |
| 225 | Ga0207662_10305352 | 3300025918 | Bacteria | 1059 |
| 226 | Ga0207657_10473602 | 3300025919 | Bacteria | 982 |
| 227 | Ga0207649_10010505 | 3300025920 | Bacteria | 5088 |
| 228 | Ga0207652_10266258 | 3300025921 | Bacteria | 1546 |
| 229 | Ga0207646_11768611 | 3300025922 | Bacteria | 529 |
| 230 | Ga0207681_10033172 | 3300025923 | Bacteria | 3383 |
| 231 | Ga0207681_10149717 | 3300025923 | Bacteria | 1747 |
| 232 | Ga0207681_10543368 | 3300025923 | Bacteria | 955 |
| 233 | Ga0207650_10041390 | 3300025925 | Bacteria | 3375 |
| 234 | Ga0207659_10246571 | 3300025926 | Bacteria | 1447 |
| 235 | Ga0207659_10398100 | 3300025926 | Bacteria | 1151 |
| 236 | Ga0207687_10301043 | 3300025927 | Bacteria | 1292 |
| 237 | Ga0207644_10028824 | 3300025931 | Bacteria | 3847 |
| 238 | Ga0207644_10523689 | 3300025931 | Bacteria | 979 |
| 239 | Ga0207690_10001610 | 3300025932 | Bacteria | 14061 |
| 240 | Ga0207690_10562447 | 3300025932 | Bacteria | 928 |
| 241 | Ga0207706_10000153 | 3300025933 | Bacteria | 75743 |
| 242 | Ga0207686_10000197 | 3300025934 | Bacteria | 46584 |
| 243 | Ga0207686_10123639 | 3300025934 | Bacteria | 1765 |
| 244 | Ga0207709_10025741 | 3300025935 | Bacteria | 3371 |
| 245 | Ga0207709_10096276 | 3300025935 | Bacteria | 1947 |
| 246 | Ga0207670_10041278 | 3300025936 | Bacteria | 3033 |
| 247 | Ga0207669_10001843 | 3300025937 | Bacteria | 8985 |
| 248 | Ga0207669_10020755 | 3300025937 | Bacteria | 3452 |
| 249 | Ga0207704_10009049 | 3300025938 | Bacteria | 4787 |
| 250 | Ga0207704_10047400 | 3300025938 | Bacteria | 2568 |
| 251 | Ga0207704_11131915 | 3300025938 | Bacteria | 666 |
| 252 | Ga0207691_10102136 | 3300025940 | Bacteria | 2558 |
| 253 | Ga0207691_10112807 | 3300025940 | Bacteria | 2416 |
| 254 | Ga0207691_10184360 | 3300025940 | Bacteria | 1822 |
| 255 | Ga0207691_10617765 | 3300025940 | Bacteria | 917 |
| 256 | Ga0207711_10004388 | 3300025941 | Bacteria | 12029 |
| 257 | Ga0207711_11191800 | 3300025941 | Bacteria | 703 |
| 258 | Ga0207689_10028157 | 3300025942 | Bacteria | 4699 |
| 259 | Ga0207689_10105328 | 3300025942 | Bacteria | 2317 |
| 260 | Ga0207689_11768117 | 3300025942 | Unclassified | 511 |
| 261 | Ga0207679_10000220 | 3300025945 | Bacteria | 45059 |
| 262 | Ga0207679_11329724 | 3300025945 | Bacteria | 659 |
| 263 | Ga0207667_10376831 | 3300025949 | Bacteria | 1446 |
| 264 | Ga0207651_10040597 | 3300025960 | Bacteria | 3080 |
| 265 | Ga0207651_10282210 | 3300025960 | Bacteria | 1373 |
| 266 | Ga0207712_10004991 | 3300025961 | Bacteria | 8392 |
| 267 | Ga0207712_10124064 | 3300025961 | Bacteria | 1958 |
| 268 | Ga0207712_10127749 | 3300025961 | Bacteria | 1933 |
| 269 | Ga0207712_10218815 | 3300025961 | Bacteria | 1521 |
| 270 | Ga0207668_10090128 | 3300025972 | Bacteria | 2250 |
| 271 | Ga0207668_11609833 | 3300025972 | Bacteria | 586 |
| 272 | Ga0207668_12065304 | 3300025972 | Unclassified | 513 |
| 273 | Ga0207640_10000938 | 3300025981 | Bacteria | 16277 |
| 274 | Ga0207658_10327651 | 3300025986 | Bacteria | 1327 |
| 275 | Ga0207658_10550511 | 3300025986 | Bacteria | 1032 |
| 276 | Ga0207677_10171893 | 3300026023 | Bacteria | 1695 |
| 277 | Ga0207677_11200073 | 3300026023 | Bacteria | 694 |
| 278 | Ga0207677_11442252 | 3300026023 | Bacteria | 635 |
| 279 | Ga0207703_10125602 | 3300026035 | Bacteria | 2208 |
| 280 | Ga0207678_10169072 | 3300026067 | Unclassified | 1866 |
| 281 | Ga0207708_10001433 | 3300026075 | Bacteria | 17876 |
| 282 | Ga0207708_10053026 | 3300026075 | Bacteria | 3089 |
| 283 | Ga0207708_10491582 | 3300026075 | Bacteria | 1027 |
| 284 | Ga0207641_10095510 | 3300026088 | Bacteria | 2609 |
| 285 | Ga0207641_10239481 | 3300026088 | Bacteria | 1690 |
| 286 | Ga0207641_10356328 | 3300026088 | Bacteria | 1395 |
| 287 | Ga0207648_10000028 | 3300026089 | Bacteria | 130116 |
| 288 | Ga0207648_10013533 | 3300026089 | Bacteria | 7585 |
| 289 | Ga0207676_10013597 | 3300026095 | Bacteria | 5841 |
| 290 | Ga0207676_10060095 | 3300026095 | Bacteria | 3004 |
| 291 | Ga0207676_10516458 | 3300026095 | Bacteria | 1136 |
| 292 | Ga0207674_10059169 | 3300026116 | Unclassified | 3879 |
| 293 | Ga0207674_10213978 | 3300026116 | Bacteria | 1876 |
| 294 | Ga0207675_100070552 | 3300026118 | Bacteria | 3266 |
| 295 | Ga0207683_10007020 | 3300026121 | Bacteria | 9660 |
| 296 | Ga0207683_10169800 | 3300026121 | Bacteria | 1975 |
| 297 | Ga0207683_10174768 | 3300026121 | Bacteria | 1946 |
| 298 | Ga0268266_10254822 | 3300028379 | Bacteria | 1624 |
| 299 | Ga0268265_10485662 | 3300028380 | Bacteria | 1161 |
| 300 | Ga0268265_10625453 | 3300028380 | Bacteria | 1032 |
| 301 | Ga0268265_10652631 | 3300028380 | Bacteria | 1011 |
| 302 | Ga0268265_11014117 | 3300028380 | Bacteria | 820 |
| 303 | Ga0268264_10022730 | 3300028381 | Bacteria | 5117 |
| 304 | Ga0268264_10043810 | 3300028381 | Bacteria | 3710 |
| 305 | Ga0268264_11616788 | 3300028381 | Bacteria | 659 |
| 306 | Ga0265323_10176107 | 3300028653 | Bacteria | 678 |
| 307 | Ga0307416_103622513 | 3300032002 | Bacteria | 517 |
| 308 | Ga0373932_0121991 | 3300035112 | Bacteria | 870 |
| 309 | Ga0373939_0246300 | 3300035114 | Bacteria | 694 |
| 310 | Ga0373960_0051999 | 3300035121 | Bacteria | 1219 |
| 311 | Ga0373942_0238392 | 3300035207 | Bacteria | 615 |
| 312 | Ga0373931_0029730 | 3300035691 | Bacteria | 2808 |
| 313 | Ga0395899_0007262 | 3300037312 | Bacteria | 8571 |
| 314 | Ga0395900_0039351 | 3300037418 | Bacteria | 4872 |
| 315 | Ga0395905_0440845 | 3300037471 | Bacteria | 1200 |
| 316 | Ga0395901_0409546 | 3300038443 | Bacteria | 1392 |
| 317 | Ga0242420_002962 | 3300038996 | Bacteria | 2475 |
| 318 | Ga0242420_079139 | 3300038996 | Bacteria | 677 |
| 319 | Ga0451802_0315239 | 3300041460 | Bacteria | 1364 |
| 320 | Ga0451804_0937317 | 3300041463 | Bacteria | 2048 |
| 321 | Ga0451807_1983403 | 3300041486 | Bacteria | 1295 |
| 322 | Ga0451837_0639187 | 3300041494 | Bacteria | 505 |
| 323 | Ga0451845_0487811 | 3300041501 | Bacteria | 752 |
| 324 | Ga0451853_1859943 | 3300041512 | Bacteria | 1329 |
| 325 | Ga0439441_082583 | 3300042001 | Bacteria | 702 |
| 326 | Ga0439448_0071472 | 3300042005 | Bacteria | 1156 |
| 327 | Ga0439435_0070183 | 3300042436 | Bacteria | 1036 |
| 328 | Ga0451577_0093540 | 3300042876 | Bacteria | 2684 |
| 329 | Ga0451577_0432286 | 3300042876 | Unclassified | 1195 |
| 330 | Ga0453683_0683977 | 3300044673 | Bacteria | 672 |
| 331 | Ga0453683_0768831 | 3300044673 | Bacteria | 633 |
| 332 | Ga0453684_0088492 | 3300044712 | Bacteria | 3835 |
| 333 | Ga0453684_0343549 | 3300044712 | Unclassified | 1684 |
| 334 | Ga0453684_0515703 | 3300044712 | Unclassified | 1321 |
| 335 | Ga0453684_0541134 | 3300044712 | Bacteria | 1284 |
| 336 | Ga0453684_0686398 | 3300044712 | Unclassified | 1114 |
| 337 | Ga0453684_1738329 | 3300044712 | Unclassified | 636 |
| 338 | Ga0451576_0069325 | 3300045051 | Bacteria | 3669 |
| 339 | Ga0451576_1061786 | 3300045051 | Bacteria | 848 |
| 340 | Ga0466958_0015759 | 3300045836 | Bacteria | 4340 |
| 341 | Ga0495603_0235033 | 3300046455 | Bacteria | 1056 |
| 342 | Ga0495590_0439035 | 3300046457 | Bacteria | 504 |
| 343 | Ga0495650_0000016 | 3300046471 | Bacteria | 554693 |
| 344 | Ga0495580_0700238 | 3300046472 | Bacteria | 663 |
| 345 | Ga0495584_0018635 | 3300046491 | Bacteria | 3528 |
| 346 | Ga0495585_0297773 | 3300046492 | Unclassified | 794 |
| 347 | Ga0495607_0082709 | 3300046501 | Bacteria | 1760 |
| 348 | Ga0495648_0134886 | 3300046524 | Bacteria | 1307 |
| 349 | Ga0495621_0021560 | 3300046539 | Bacteria | 2125 |
| 350 | Ga0495597_0000087 | 3300046542 | Bacteria | 81275 |
| 351 | Ga0495622_0066012 | 3300046557 | Bacteria | 1673 |
| 352 | Ga0495656_0246132 | 3300046615 | Bacteria | 902 |
| 353 | Ga0495659_0220161 | 3300046664 | Bacteria | 784 |
| 354 | Ga0495661_0069145 | 3300046665 | Bacteria | 2070 |
| 355 | Ga0495588_0392253 | 3300046674 | Bacteria | 729 |
| 356 | Ga0495670_0000551 | 3300046691 | Bacteria | 17851 |
| 357 | Ga0495671_0000402 | 3300046692 | Bacteria | 35090 |
| 358 | Ga0495660_0000007 | 3300046810 | Bacteria | 485295 |
| 359 | Ga0495636_0072508 | 3300047318 | Bacteria | 1472 |
| 360 | Ga0495672_0093098 | 3300047320 | Bacteria | 1651 |
| 361 | Ga0495683_0006643 | 3300047323 | Bacteria | 6306 |
| 362 | Ga0496102_0089084 | 3300048905 | Unclassified | 2854 |
| 363 | Ga0496104_0015892 | 3300048907 | Bacteria | 6830 |
| 364 | Ga0496104_0112855 | 3300048907 | Bacteria | 2606 |
| 365 | Ga0496104_0296909 | 3300048907 | Bacteria | 1528 |
| 366 | Ga0496105_0125179 | 3300048908 | Bacteria | 2119 |
| 367 | Ga0496105_0137242 | 3300048908 | Bacteria | 2014 |
| 368 | Ga0496106_0100927 | 3300048909 | Bacteria | 2238 |
| 369 | Ga0496106_0362471 | 3300048909 | Bacteria | 1164 |
| 370 | Ga0496107_0255755 | 3300048910 | Bacteria | 1303 |
| 371 | Ga0496108_0002661 | 3300048911 | Bacteria | 14312 |
| 372 | Ga0496108_0060920 | 3300048911 | Bacteria | 3175 |
| 373 | Ga0496108_0134286 | 3300048911 | Bacteria | 2128 |
| 374 | Ga0496109_0002792 | 3300048912 | Bacteria | 14625 |
| 375 | Ga0496109_0011693 | 3300048912 | Bacteria | 7550 |
| 376 | Ga0496109_0412546 | 3300048912 | Bacteria | 1276 |
| 377 | Ga0496110_0038016 | 3300048913 | Bacteria | 4186 |
| 378 | Ga0496110_0041029 | 3300048913 | Bacteria | 4036 |
| 379 | Ga0496111_0066590 | 3300048914 | Bacteria | 2616 |
| 380 | Ga0496111_0245519 | 3300048914 | Bacteria | 1329 |
| 381 | Ga0496112_0000330 | 3300048915 | Bacteria | 30627 |
| 382 | Ga0496112_0056191 | 3300048915 | Bacteria | 3873 |
| 383 | Ga0496113_0000113 | 3300048916 | Bacteria | 35005 |
| 384 | Ga0496113_0328387 | 3300048916 | Bacteria | 1226 |
| 385 | Ga0496114_0153623 | 3300048917 | Bacteria | 1997 |
| 386 | Ga0496116_0000127 | 3300048919 | Bacteria | 158773 |
| 387 | Ga0496117_0009530 | 3300048920 | Bacteria | 9016 |
| 388 | Ga0496118_0000464 | 3300048921 | Bacteria | 67368 |
| 389 | Ga0496118_0007304 | 3300048921 | Bacteria | 11754 |
| 390 | Ga0496119_0008158 | 3300048922 | Bacteria | 9270 |
| 391 | Ga0496120_0001260 | 3300048923 | Bacteria | 31828 |
| 392 | Ga0496122_0000013 | 3300048925 | Bacteria | 501039 |
| 393 | Ga0496123_0000010 | 3300048926 | Bacteria | 501039 |
| 394 | Ga0496124_0000152 | 3300048927 | Bacteria | 140118 |
| 395 | Ga0496124_0000308 | 3300048927 | Bacteria | 90566 |
| 396 | Ga0496125_0000019 | 3300048928 | Bacteria | 474989 |
| 397 | Ga0496126_0000736 | 3300048929 | Bacteria | 59445 |
| 398 | Ga0501223_142009 | 3300049663 | Bacteria | 517 |
| 399 | Ga0501266_008644 | 3300049763 | Bacteria | 1282 |
| 400 | Ga0501045_1068442 | 3300049824 | Bacteria | 591 |
| 401 | Ga0501226_022469 | 3300049853 | Bacteria | 700 |
| 402 | nmdc:mga0qj67_1013327_c1 | 3300050509 | Bacteria | 651 |
| 403 | nmdc:mga06r32_905437_c1 | 3300050510 | Bacteria | 838 |
| 404 | nmdc:mga0n895_119474_c1 | 3300050512 | Bacteria | 2656 |
| 405 | Ga0500651_0094147 | 3300053093 | Bacteria | 1842 |
| 406 | Ga0500641_0150077 | 3300053096 | Bacteria | 1006 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002076 | JGI24749J21850_1070346 | JGI24749J21850_10703461 | 109 |
| 2 | 3300002244 | JGI24742J22300_10018238 | JGI24742J22300_100182382 | 109 |
| 3 | 3300002737 | JGI25162J39368_1000003 | JGI25162J39368_1000003530 | 109 |
| 4 | 3300002771 | JGI25163J39215_1000132 | JGI25163J39215_100013216 | 109 |
| 5 | 3300002772 | JGI25164J39214_1000211 | JGI25164J39214_100021118 | 109 |
| 6 | 3300003751 | Ga0055538_1000005 | Ga0055538_1000005530 | 109 |
| 7 | 3300003752 | Ga0055539_1000007 | Ga0055539_1000007530 | 109 |
| 8 | 3300003756 | Ga0055533_1000009 | Ga0055533_1000009530 | 109 |
| 9 | 3300003759 | Ga0055525_1000010 | Ga0055525_1000010530 | 109 |
| 10 | 3300003841 | Ga0055541_1000005 | Ga0055541_100000535 | 109 |
| 11 | 3300005289 | Ga0065704_10000516 | Ga0065704_1000051613 | 109 |
| 12 | 3300005293 | Ga0065715_10261743 | Ga0065715_102617432 | 109 |
| 13 | 3300005293 | Ga0065715_10416148 | Ga0065715_104161481 | 109 |
| 14 | 3300005295 | Ga0065707_10740671 | Ga0065707_107406711 | 109 |
| 15 | 3300005327 | Ga0070658_11986347 | Ga0070658_119863471 | 109 |
| 16 | 3300005328 | Ga0070676_10001146 | Ga0070676_1000114612 | 109 |
| 17 | 3300005328 | Ga0070676_11210086 | Ga0070676_112100861 | 109 |
| 18 | 3300005329 | Ga0070683_100297899 | Ga0070683_1002978992 | 109 |
| 19 | 3300005330 | Ga0070690_100003661 | Ga0070690_1000036617 | 109 |
| 20 | 3300005330 | Ga0070690_101723853 | Ga0070690_1017238531 | 109 |
| 21 | 3300005331 | Ga0070670_100359321 | Ga0070670_1003593212 | 109 |
| 22 | 3300005333 | Ga0070677_10002857 | Ga0070677_100028577 | 109 |
| 23 | 3300005334 | Ga0068869_100070654 | Ga0068869_1000706542 | 109 |
| 24 | 3300005334 | Ga0068869_100338144 | Ga0068869_1003381441 | 109 |
| 25 | 3300005335 | Ga0070666_10003039 | Ga0070666_100030399 | 109 |
| 26 | 3300005335 | Ga0070666_10034205 | Ga0070666_100342052 | 109 |
| 27 | 3300005336 | Ga0070680_100075793 | Ga0070680_1000757931 | 109 |
| 28 | 3300005338 | Ga0068868_100000994 | Ga0068868_10000099419 | 109 |
| 29 | 3300005338 | Ga0068868_100149227 | Ga0068868_1001492272 | 109 |
| 30 | 3300005338 | Ga0068868_101545369 | Ga0068868_1015453692 | 109 |
| 31 | 3300005339 | Ga0070660_100154404 | Ga0070660_1001544041 | 109 |
| 32 | 3300005340 | Ga0070689_100060702 | Ga0070689_1000607025 | 109 |
| 33 | 3300005343 | Ga0070687_100121874 | Ga0070687_1001218742 | 109 |
| 34 | 3300005344 | Ga0070661_100001578 | Ga0070661_1000015785 | 109 |
| 35 | 3300005344 | Ga0070661_101182272 | Ga0070661_1011822722 | 109 |
| 36 | 3300005344 | Ga0070661_101636987 | Ga0070661_1016369871 | 109 |
| 37 | 3300005345 | Ga0070692_10110099 | Ga0070692_101100993 | 109 |
| 38 | 3300005347 | Ga0070668_100174353 | Ga0070668_1001743533 | 109 |
| 39 | 3300005347 | Ga0070668_100833304 | Ga0070668_1008333042 | 109 |
| 40 | 3300005347 | Ga0070668_100947990 | Ga0070668_1009479902 | 109 |
| 41 | 3300005353 | Ga0070669_100008035 | Ga0070669_1000080354 | 109 |
| 42 | 3300005353 | Ga0070669_100234886 | Ga0070669_1002348862 | 109 |
| 43 | 3300005354 | Ga0070675_100363248 | Ga0070675_1003632482 | 109 |
| 44 | 3300005354 | Ga0070675_100468099 | Ga0070675_1004680992 | 109 |
| 45 | 3300005355 | Ga0070671_100281164 | Ga0070671_1002811642 | 109 |
| 46 | 3300005356 | Ga0070674_100020327 | Ga0070674_1000203272 | 109 |
| 47 | 3300005356 | Ga0070674_100029314 | Ga0070674_1000293142 | 109 |
| 48 | 3300005356 | Ga0070674_101571970 | Ga0070674_1015719701 | 109 |
| 49 | 3300005364 | Ga0070673_100084516 | Ga0070673_1000845163 | 109 |
| 50 | 3300005364 | Ga0070673_100277200 | Ga0070673_1002772001 | 109 |
| 51 | 3300005364 | Ga0070673_100428485 | Ga0070673_1004284852 | 109 |
| 52 | 3300005365 | Ga0070688_100348473 | Ga0070688_1003484732 | 109 |
| 53 | 3300005366 | Ga0070659_100000451 | Ga0070659_1000004519 | 109 |
| 54 | 3300005366 | Ga0070659_100065033 | Ga0070659_1000650334 | 109 |
| 55 | 3300005367 | Ga0070667_100153407 | Ga0070667_1001534073 | 109 |
| 56 | 3300005406 | Ga0070703_10473716 | Ga0070703_104737162 | 109 |
| 57 | 3300005438 | Ga0070701_10003628 | Ga0070701_100036281 | 109 |
| 58 | 3300005438 | Ga0070701_10069200 | Ga0070701_100692002 | 109 |
| 59 | 3300005439 | Ga0070711_100457195 | Ga0070711_1004571952 | 109 |
| 60 | 3300005439 | Ga0070711_101400448 | Ga0070711_1014004481 | 109 |
| 61 | 3300005440 | Ga0070705_100192625 | Ga0070705_1001926251 | 109 |
| 62 | 3300005441 | Ga0070700_100019649 | Ga0070700_1000196492 | 109 |
| 63 | 3300005441 | Ga0070700_100097176 | Ga0070700_1000971764 | 109 |
| 64 | 3300005441 | Ga0070700_100109027 | Ga0070700_1001090273 | 109 |
| 65 | 3300005444 | Ga0070694_100013836 | Ga0070694_1000138364 | 109 |
| 66 | 3300005455 | Ga0070663_100144381 | Ga0070663_1001443812 | 109 |
| 67 | 3300005456 | Ga0070678_100012869 | Ga0070678_1000128695 | 109 |
| 68 | 3300005457 | Ga0070662_100001037 | Ga0070662_1000010373 | 109 |
| 69 | 3300005459 | Ga0068867_100003424 | Ga0068867_10000342411 | 109 |
| 70 | 3300005459 | Ga0068867_100028083 | Ga0068867_1000280833 | 109 |
| 71 | 3300005459 | Ga0068867_100065544 | Ga0068867_1000655443 | 109 |
| 72 | 3300005459 | Ga0068867_100367649 | Ga0068867_1003676493 | 109 |
| 73 | 3300005459 | Ga0068867_102166976 | Ga0068867_1021669761 | 109 |
| 74 | 3300005466 | Ga0070685_10410662 | Ga0070685_104106621 | 109 |
| 75 | 3300005468 | Ga0070707_100547593 | Ga0070707_1005475931 | 109 |
| 76 | 3300005535 | Ga0070684_100455771 | Ga0070684_1004557712 | 109 |
| 77 | 3300005543 | Ga0070672_100262776 | Ga0070672_1002627763 | 109 |
| 78 | 3300005543 | Ga0070672_100937799 | Ga0070672_1009377993 | 109 |
| 79 | 3300005544 | Ga0070686_100009840 | Ga0070686_1000098405 | 109 |
| 80 | 3300005545 | Ga0070695_100092044 | Ga0070695_1000920443 | 109 |
| 81 | 3300005546 | Ga0070696_100022656 | Ga0070696_1000226565 | 109 |
| 82 | 3300005546 | Ga0070696_101425068 | Ga0070696_1014250681 | 109 |
| 83 | 3300005547 | Ga0070693_100052576 | Ga0070693_1000525764 | 109 |
| 84 | 3300005549 | Ga0070704_100023795 | Ga0070704_1000237955 | 109 |
| 85 | 3300005549 | Ga0070704_100202807 | Ga0070704_1002028072 | 109 |
| 86 | 3300005563 | Ga0068855_100360655 | Ga0068855_1003606552 | 109 |
| 87 | 3300005564 | Ga0070664_100373238 | Ga0070664_1003732382 | 109 |
| 88 | 3300005577 | Ga0068857_100066980 | Ga0068857_1000669802 | 109 |
| 89 | 3300005577 | Ga0068857_100169252 | Ga0068857_1001692521 | 109 |
| 90 | 3300005578 | Ga0068854_100000918 | Ga0068854_10000091813 | 109 |
| 91 | 3300005578 | Ga0068854_100094145 | Ga0068854_1000941452 | 109 |
| 92 | 3300005578 | Ga0068854_100932952 | Ga0068854_1009329521 | 109 |
| 93 | 3300005614 | Ga0068856_100276709 | Ga0068856_1002767093 | 109 |
| 94 | 3300005615 | Ga0070702_100004718 | Ga0070702_1000047188 | 109 |
| 95 | 3300005615 | Ga0070702_100091052 | Ga0070702_1000910524 | 109 |
| 96 | 3300005615 | Ga0070702_100774424 | Ga0070702_1007744242 | 109 |
| 97 | 3300005616 | Ga0068852_101681231 | Ga0068852_1016812311 | 109 |
| 98 | 3300005617 | Ga0068859_100007364 | Ga0068859_1000073644 | 109 |
| 99 | 3300005617 | Ga0068859_100565660 | Ga0068859_1005656602 | 109 |
| 100 | 3300005618 | Ga0068864_100010875 | Ga0068864_1000108756 | 109 |
| 101 | 3300005618 | Ga0068864_100052736 | Ga0068864_1000527362 | 109 |
| 102 | 3300005618 | Ga0068864_100063275 | Ga0068864_1000632752 | 109 |
| 103 | 3300005618 | Ga0068864_100148638 | Ga0068864_1001486382 | 109 |
| 104 | 3300005718 | Ga0068866_10000566 | Ga0068866_100005663 | 109 |
| 105 | 3300005718 | Ga0068866_10002622 | Ga0068866_100026226 | 109 |
| 106 | 3300005719 | Ga0068861_100338708 | Ga0068861_1003387083 | 109 |
| 107 | 3300005840 | Ga0068870_10015267 | Ga0068870_100152676 | 109 |
| 108 | 3300005841 | Ga0068863_100029419 | Ga0068863_1000294195 | 109 |
| 109 | 3300005841 | Ga0068863_100189112 | Ga0068863_1001891122 | 109 |
| 110 | 3300005842 | Ga0068858_100031229 | Ga0068858_1000312295 | 109 |
| 111 | 3300005842 | Ga0068858_100168575 | Ga0068858_1001685754 | 109 |
| 112 | 3300005843 | Ga0068860_100020067 | Ga0068860_1000200672 | 109 |
| 113 | 3300005843 | Ga0068860_100080643 | Ga0068860_1000806432 | 109 |
| 114 | 3300005844 | Ga0068862_100120336 | Ga0068862_1001203362 | 109 |
| 115 | 3300005844 | Ga0068862_100651649 | Ga0068862_1006516492 | 109 |
| 116 | 3300005937 | Ga0081455_10000351 | Ga0081455_1000035193 | 109 |
| 117 | 3300005937 | Ga0081455_10283930 | Ga0081455_102839303 | 109 |
| 118 | 3300005937 | Ga0081455_11007354 | Ga0081455_110073541 | 109 |
| 119 | 3300006237 | Ga0097621_100025871 | Ga0097621_1000258712 | 109 |
| 120 | 3300006237 | Ga0097621_100044215 | Ga0097621_1000442151 | 109 |
| 121 | 3300006237 | Ga0097621_100154791 | Ga0097621_1001547912 | 109 |
| 122 | 3300006237 | Ga0097621_100201160 | Ga0097621_1002011602 | 109 |
| 123 | 3300006358 | Ga0068871_100000178 | Ga0068871_10000017819 | 109 |
| 124 | 3300006358 | Ga0068871_100023387 | Ga0068871_1000233873 | 109 |
| 125 | 3300006358 | Ga0068871_100082490 | Ga0068871_1000824904 | 109 |
| 126 | 3300006358 | Ga0068871_100275875 | Ga0068871_1002758752 | 109 |
| 127 | 3300006846 | Ga0075430_101108069 | Ga0075430_1011080692 | 109 |
| 128 | 3300006847 | Ga0075431_100419335 | Ga0075431_1004193352 | 109 |
| 129 | 3300006871 | Ga0075434_100053665 | Ga0075434_1000536654 | 109 |
| 130 | 3300006881 | Ga0068865_100007459 | Ga0068865_1000074599 | 109 |
| 131 | 3300006881 | Ga0068865_101135014 | Ga0068865_1011350142 | 109 |
| 132 | 3300006881 | Ga0068865_101625828 | Ga0068865_1016258281 | 109 |
| 133 | 3300006931 | Ga0097620_100007364 | Ga0097620_1000073644 | 109 |
| 134 | 3300006931 | Ga0097620_100565585 | Ga0097620_1005655852 | 109 |
| 135 | 3300006931 | Ga0097620_101366246 | Ga0097620_1013662462 | 109 |
| 136 | 3300009011 | Ga0105251_10000825 | Ga0105251_1000082518 | 109 |
| 137 | 3300009092 | Ga0105250_10382706 | Ga0105250_103827061 | 109 |
| 138 | 3300009093 | Ga0105240_10527702 | Ga0105240_105277022 | 109 |
| 139 | 3300009098 | Ga0105245_10081803 | Ga0105245_100818035 | 109 |
| 140 | 3300009098 | Ga0105245_10479753 | Ga0105245_104797532 | 109 |
| 141 | 3300009101 | Ga0105247_10964996 | Ga0105247_109649962 | 109 |
| 142 | 3300009147 | Ga0114129_11645158 | Ga0114129_116451581 | 109 |
| 143 | 3300009148 | Ga0105243_10077096 | Ga0105243_100770963 | 109 |
| 144 | 3300009148 | Ga0105243_10249940 | Ga0105243_102499403 | 109 |
| 145 | 3300009174 | Ga0105241_10011267 | Ga0105241_100112676 | 109 |
| 146 | 3300009176 | Ga0105242_10028481 | Ga0105242_100284812 | 109 |
| 147 | 3300009176 | Ga0105242_10085741 | Ga0105242_100857413 | 109 |
| 148 | 3300009176 | Ga0105242_11199007 | Ga0105242_111990072 | 109 |
| 149 | 3300009177 | Ga0105248_10005781 | Ga0105248_100057819 | 109 |
| 150 | 3300009177 | Ga0105248_10011045 | Ga0105248_100110458 | 109 |
| 151 | 3300009177 | Ga0105248_10870856 | Ga0105248_108708561 | 109 |
| 152 | 3300009177 | Ga0105248_10887252 | Ga0105248_108872522 | 109 |
| 153 | 3300009545 | Ga0105237_10610533 | Ga0105237_106105332 | 109 |
| 154 | 3300009551 | Ga0105238_10033485 | Ga0105238_100334852 | 109 |
| 155 | 3300009553 | Ga0105249_10005409 | Ga0105249_1000540914 | 109 |
| 156 | 3300009553 | Ga0105249_10076031 | Ga0105249_100760314 | 109 |
| 157 | 3300009553 | Ga0105249_10207937 | Ga0105249_102079372 | 109 |
| 158 | 3300009553 | Ga0105249_10638638 | Ga0105249_106386382 | 109 |
| 159 | 3300010375 | Ga0105239_10023259 | Ga0105239_100232592 | 109 |
| 160 | 3300010375 | Ga0105239_10370331 | Ga0105239_103703313 | 109 |
| 161 | 3300011119 | Ga0105246_10021699 | Ga0105246_100216996 | 109 |
| 162 | 3300011119 | Ga0105246_11850547 | Ga0105246_118505471 | 109 |
| 163 | 3300013102 | Ga0157371_10117232 | Ga0157371_101172323 | 109 |
| 164 | 3300013296 | Ga0157374_10618758 | Ga0157374_106187582 | 109 |
| 165 | 3300013297 | Ga0157378_10000730 | Ga0157378_1000073016 | 109 |
| 166 | 3300013297 | Ga0157378_10010351 | Ga0157378_100103516 | 109 |
| 167 | 3300013297 | Ga0157378_10047759 | Ga0157378_100477593 | 109 |
| 168 | 3300013306 | Ga0163162_10010483 | Ga0163162_1001048310 | 109 |
| 169 | 3300013306 | Ga0163162_10110532 | Ga0163162_101105322 | 109 |
| 170 | 3300013307 | Ga0157372_10947207 | Ga0157372_109472072 | 109 |
| 171 | 3300013307 | Ga0157372_13002669 | Ga0157372_130026691 | 109 |
| 172 | 3300013308 | Ga0157375_10001824 | Ga0157375_100018242 | 109 |
| 173 | 3300013308 | Ga0157375_10170986 | Ga0157375_101709862 | 109 |
| 174 | 3300013308 | Ga0157375_10223600 | Ga0157375_102236003 | 109 |
| 175 | 3300013308 | Ga0157375_10255885 | Ga0157375_102558853 | 109 |
| 176 | 3300013308 | Ga0157375_11603552 | Ga0157375_116035522 | 109 |
| 177 | 3300014325 | Ga0163163_10160500 | Ga0163163_101605003 | 109 |
| 178 | 3300014325 | Ga0163163_10453234 | Ga0163163_104532342 | 109 |
| 179 | 3300014325 | Ga0163163_10661776 | Ga0163163_106617762 | 109 |
| 180 | 3300014326 | Ga0157380_10035693 | Ga0157380_100356935 | 109 |
| 181 | 3300014326 | Ga0157380_10139874 | Ga0157380_101398744 | 109 |
| 182 | 3300014326 | Ga0157380_11247964 | Ga0157380_112479641 | 109 |
| 183 | 3300014326 | Ga0157380_12280709 | Ga0157380_122807092 | 109 |
| 184 | 3300014745 | Ga0157377_10002560 | Ga0157377_100025602 | 109 |
| 185 | 3300014968 | Ga0157379_10053721 | Ga0157379_100537214 | 109 |
| 186 | 3300014968 | Ga0157379_10085382 | Ga0157379_100853824 | 109 |
| 187 | 3300014969 | Ga0157376_10123202 | Ga0157376_101232024 | 109 |
| 188 | 3300014969 | Ga0157376_10226282 | Ga0157376_102262822 | 109 |
| 189 | 3300014969 | Ga0157376_10593382 | Ga0157376_105933822 | 109 |
| 190 | 3300014969 | Ga0157376_10744786 | Ga0157376_107447862 | 109 |
| 191 | 3300017792 | Ga0163161_10051305 | Ga0163161_100513052 | 109 |
| 192 | 3300017792 | Ga0163161_10076421 | Ga0163161_100764212 | 109 |
| 193 | 3300017792 | Ga0163161_10973045 | Ga0163161_109730452 | 109 |
| 194 | 3300025207 | Ga0209760_100001 | Ga0209760_100001204 | 109 |
| 195 | 3300025224 | Ga0209784_100001 | Ga0209784_1000011072 | 109 |
| 196 | 3300025225 | Ga0209566_100001 | Ga0209566_1000011072 | 109 |
| 197 | 3300025226 | Ga0209674_100002 | Ga0209674_1000021072 | 109 |
| 198 | 3300025230 | Ga0209563_100008 | Ga0209563_1000081073 | 109 |
| 199 | 3300025231 | Ga0207427_100002 | Ga0207427_100002204 | 109 |
| 200 | 3300025233 | Ga0209437_100007 | Ga0209437_100007525 | 109 |
| 201 | 3300025253 | Ga0209677_100004 | Ga0209677_1000041073 | 109 |
| 202 | 3300025711 | Ga0207696_1000415 | Ga0207696_100041532 | 109 |
| 203 | 3300025728 | Ga0207655_1000157 | Ga0207655_100015723 | 109 |
| 204 | 3300025735 | Ga0207713_1001476 | Ga0207713_100147610 | 109 |
| 205 | 3300025893 | Ga0207682_10003487 | Ga0207682_100034875 | 109 |
| 206 | 3300025899 | Ga0207642_10000341 | Ga0207642_1000034117 | 109 |
| 207 | 3300025899 | Ga0207642_10154218 | Ga0207642_101542182 | 109 |
| 208 | 3300025900 | Ga0207710_10440933 | Ga0207710_104409332 | 109 |
| 209 | 3300025903 | Ga0207680_10007128 | Ga0207680_100071282 | 109 |
| 210 | 3300025903 | Ga0207680_10055224 | Ga0207680_100552242 | 109 |
| 211 | 3300025907 | Ga0207645_10001506 | Ga0207645_1000150613 | 109 |
| 212 | 3300025907 | Ga0207645_10915769 | Ga0207645_109157691 | 109 |
| 213 | 3300025908 | Ga0207643_10010349 | Ga0207643_100103492 | 109 |
| 214 | 3300025908 | Ga0207643_10020540 | Ga0207643_100205402 | 109 |
| 215 | 3300025911 | Ga0207654_10013267 | Ga0207654_100132675 | 109 |
| 216 | 3300025913 | Ga0207695_10406363 | Ga0207695_104063632 | 109 |
| 217 | 3300025913 | Ga0207695_11144045 | Ga0207695_111440452 | 109 |
| 218 | 3300025916 | Ga0207663_10102899 | Ga0207663_101028991 | 109 |
| 219 | 3300025917 | Ga0207660_10091359 | Ga0207660_100913592 | 109 |
| 220 | 3300025918 | Ga0207662_10013199 | Ga0207662_100131996 | 109 |
| 221 | 3300025918 | Ga0207662_10305352 | Ga0207662_103053521 | 109 |
| 222 | 3300025919 | Ga0207657_10473602 | Ga0207657_104736021 | 109 |
| 223 | 3300025920 | Ga0207649_10010505 | Ga0207649_1001050511 | 109 |
| 224 | 3300025922 | Ga0207646_11768611 | Ga0207646_117686111 | 109 |
| 225 | 3300025923 | Ga0207681_10033172 | Ga0207681_100331726 | 109 |
| 226 | 3300025923 | Ga0207681_10149717 | Ga0207681_101497172 | 109 |
| 227 | 3300025923 | Ga0207681_10543368 | Ga0207681_105433682 | 109 |
| 228 | 3300025925 | Ga0207650_10041390 | Ga0207650_100413904 | 109 |
| 229 | 3300025926 | Ga0207659_10246571 | Ga0207659_102465712 | 109 |
| 230 | 3300025926 | Ga0207659_10398100 | Ga0207659_103981001 | 109 |
| 231 | 3300025927 | Ga0207687_10301043 | Ga0207687_103010432 | 109 |
| 232 | 3300025931 | Ga0207644_10028824 | Ga0207644_100288245 | 109 |
| 233 | 3300025931 | Ga0207644_10523689 | Ga0207644_105236892 | 109 |
| 234 | 3300025932 | Ga0207690_10001610 | Ga0207690_100016104 | 109 |
| 235 | 3300025932 | Ga0207690_10562447 | Ga0207690_105624471 | 109 |
| 236 | 3300025933 | Ga0207706_10000153 | Ga0207706_1000015316 | 109 |
| 237 | 3300025934 | Ga0207686_10000197 | Ga0207686_1000019761 | 109 |
| 238 | 3300025934 | Ga0207686_10123639 | Ga0207686_101236393 | 109 |
| 239 | 3300025935 | Ga0207709_10025741 | Ga0207709_100257411 | 109 |
| 240 | 3300025935 | Ga0207709_10096276 | Ga0207709_100962763 | 109 |
| 241 | 3300025936 | Ga0207670_10041278 | Ga0207670_100412781 | 109 |
| 242 | 3300025937 | Ga0207669_10001843 | Ga0207669_100018436 | 109 |
| 243 | 3300025937 | Ga0207669_10020755 | Ga0207669_100207554 | 109 |
| 244 | 3300025938 | Ga0207704_10009049 | Ga0207704_100090495 | 109 |
| 245 | 3300025938 | Ga0207704_10047400 | Ga0207704_100474002 | 109 |
| 246 | 3300025938 | Ga0207704_11131915 | Ga0207704_111319152 | 109 |
| 247 | 3300025940 | Ga0207691_10102136 | Ga0207691_101021365 | 109 |
| 248 | 3300025940 | Ga0207691_10112807 | Ga0207691_101128075 | 109 |
| 249 | 3300025940 | Ga0207691_10184360 | Ga0207691_101843602 | 109 |
| 250 | 3300025940 | Ga0207691_10617765 | Ga0207691_106177652 | 109 |
| 251 | 3300025941 | Ga0207711_10004388 | Ga0207711_1000438813 | 109 |
| 252 | 3300025941 | Ga0207711_11191800 | Ga0207711_111918002 | 109 |
| 253 | 3300025942 | Ga0207689_10028157 | Ga0207689_100281575 | 109 |
| 254 | 3300025942 | Ga0207689_10105328 | Ga0207689_101053282 | 109 |
| 255 | 3300025942 | Ga0207689_11768117 | Ga0207689_117681171 | 109 |
| 256 | 3300025945 | Ga0207679_10000220 | Ga0207679_100002201 | 109 |
| 257 | 3300025945 | Ga0207679_11329724 | Ga0207679_113297242 | 109 |
| 258 | 3300025949 | Ga0207667_10376831 | Ga0207667_103768313 | 109 |
| 259 | 3300025960 | Ga0207651_10040597 | Ga0207651_100405974 | 109 |
| 260 | 3300025960 | Ga0207651_10282210 | Ga0207651_102822103 | 109 |
| 261 | 3300025961 | Ga0207712_10004991 | Ga0207712_100049919 | 109 |
| 262 | 3300025961 | Ga0207712_10124064 | Ga0207712_101240643 | 109 |
| 263 | 3300025961 | Ga0207712_10127749 | Ga0207712_101277492 | 109 |
| 264 | 3300025961 | Ga0207712_10218815 | Ga0207712_102188152 | 109 |
| 265 | 3300025972 | Ga0207668_10090128 | Ga0207668_100901282 | 109 |
| 266 | 3300025972 | Ga0207668_11609833 | Ga0207668_116098332 | 109 |
| 267 | 3300025972 | Ga0207668_12065304 | Ga0207668_120653042 | 109 |
| 268 | 3300025981 | Ga0207640_10000938 | Ga0207640_1000093811 | 109 |
| 269 | 3300025986 | Ga0207658_10327651 | Ga0207658_103276512 | 109 |
| 270 | 3300025986 | Ga0207658_10550511 | Ga0207658_105505112 | 109 |
| 271 | 3300026023 | Ga0207677_10171893 | Ga0207677_101718933 | 109 |
| 272 | 3300026023 | Ga0207677_11200073 | Ga0207677_112000732 | 109 |
| 273 | 3300026023 | Ga0207677_11442252 | Ga0207677_114422521 | 109 |
| 274 | 3300026035 | Ga0207703_10125602 | Ga0207703_101256023 | 109 |
| 275 | 3300026067 | Ga0207678_10169072 | Ga0207678_101690722 | 109 |
| 276 | 3300026075 | Ga0207708_10001433 | Ga0207708_1000143320 | 109 |
| 277 | 3300026075 | Ga0207708_10053026 | Ga0207708_100530265 | 109 |
| 278 | 3300026075 | Ga0207708_10491582 | Ga0207708_104915823 | 109 |
| 279 | 3300026088 | Ga0207641_10095510 | Ga0207641_100955101 | 109 |
| 280 | 3300026088 | Ga0207641_10239481 | Ga0207641_102394812 | 109 |
| 281 | 3300026088 | Ga0207641_10356328 | Ga0207641_103563282 | 109 |
| 282 | 3300026089 | Ga0207648_10000028 | Ga0207648_1000002888 | 109 |
| 283 | 3300026089 | Ga0207648_10013533 | Ga0207648_100135335 | 109 |
| 284 | 3300026095 | Ga0207676_10013597 | Ga0207676_100135973 | 109 |
| 285 | 3300026095 | Ga0207676_10060095 | Ga0207676_100600951 | 109 |
| 286 | 3300026095 | Ga0207676_10516458 | Ga0207676_105164582 | 109 |
| 287 | 3300026116 | Ga0207674_10059169 | Ga0207674_100591695 | 109 |
| 288 | 3300026116 | Ga0207674_10213978 | Ga0207674_102139782 | 109 |
| 289 | 3300026118 | Ga0207675_100070552 | Ga0207675_1000705524 | 109 |
| 290 | 3300026121 | Ga0207683_10007020 | Ga0207683_1000702010 | 109 |
| 291 | 3300026121 | Ga0207683_10169800 | Ga0207683_101698002 | 109 |
| 292 | 3300026121 | Ga0207683_10174768 | Ga0207683_101747682 | 109 |
| 293 | 3300028379 | Ga0268266_10254822 | Ga0268266_102548221 | 109 |
| 294 | 3300028380 | Ga0268265_10485662 | Ga0268265_104856623 | 109 |
| 295 | 3300028380 | Ga0268265_10625453 | Ga0268265_106254532 | 109 |
| 296 | 3300028380 | Ga0268265_10652631 | Ga0268265_106526311 | 109 |
| 297 | 3300028380 | Ga0268265_11014117 | Ga0268265_110141172 | 109 |
| 298 | 3300028381 | Ga0268264_10022730 | Ga0268264_100227301 | 109 |
| 299 | 3300028381 | Ga0268264_10043810 | Ga0268264_100438103 | 109 |
| 300 | 3300028381 | Ga0268264_11616788 | Ga0268264_116167882 | 109 |
| 301 | 3300028653 | Ga0265323_10176107 | Ga0265323_101761072 | 109 |
| 302 | 3300032002 | Ga0307416_103622513 | Ga0307416_1036225131 | 109 |
| 303 | 3300035112 | Ga0373932_0121991 | Ga0373932_0121991_418_747 | 109 |
| 304 | 3300035114 | Ga0373939_0246300 | Ga0373939_0246300_254_583 | 109 |
| 305 | 3300035121 | Ga0373960_0051999 | Ga0373960_0051999_708_1037 | 109 |
| 306 | 3300035207 | Ga0373942_0238392 | Ga0373942_0238392_69_398 | 109 |
| 307 | 3300035691 | Ga0373931_0029730 | Ga0373931_0029730_2329_2658 | 109 |
| 308 | 3300037312 | Ga0395899_0007262 | Ga0395899_0007262_4521_4850 | 109 |
| 309 | 3300037418 | Ga0395900_0039351 | Ga0395900_0039351_3345_3674 | 109 |
| 310 | 3300037471 | Ga0395905_0440845 | Ga0395905_0440845_693_1022 | 109 |
| 311 | 3300038443 | Ga0395901_0409546 | Ga0395901_0409546_451_792 | 109 |
| 312 | 3300038996 | Ga0242420_002962 | Ga0242420_002962_536_865 | 109 |
| 313 | 3300038996 | Ga0242420_079139 | Ga0242420_079139_101_430 | 109 |
| 314 | 3300041460 | Ga0451802_0315239 | Ga0451802_0315239_188_517 | 109 |
| 315 | 3300041463 | Ga0451804_0937317 | Ga0451804_0937317_458_787 | 109 |
| 316 | 3300041486 | Ga0451807_1983403 | Ga0451807_1983403_610_939 | 109 |
| 317 | 3300041494 | Ga0451837_0639187 | Ga0451837_0639187_26_355 | 109 |
| 318 | 3300041501 | Ga0451845_0487811 | Ga0451845_0487811_11_340 | 109 |
| 319 | 3300041512 | Ga0451853_1859943 | Ga0451853_1859943_138_467 | 109 |
| 320 | 3300042001 | Ga0439441_082583 | Ga0439441_082583_334_663 | 109 |
| 321 | 3300042005 | Ga0439448_0071472 | Ga0439448_0071472_803_1132 | 109 |
| 322 | 3300042436 | Ga0439435_0070183 | Ga0439435_0070183_55_384 | 109 |
| 323 | 3300042876 | Ga0451577_0093540 | Ga0451577_0093540_698_1027 | 109 |
| 324 | 3300042876 | Ga0451577_0432286 | Ga0451577_0432286_113_442 | 109 |
| 325 | 3300044673 | Ga0453683_0683977 | Ga0453683_0683977_186_515 | 109 |
| 326 | 3300044673 | Ga0453683_0768831 | Ga0453683_0768831_243_572 | 109 |
| 327 | 3300044712 | Ga0453684_0088492 | Ga0453684_0088492_1450_1779 | 109 |
| 328 | 3300044712 | Ga0453684_0343549 | Ga0453684_0343549_529_858 | 109 |
| 329 | 3300044712 | Ga0453684_0515703 | Ga0453684_0515703_132_461 | 109 |
| 330 | 3300044712 | Ga0453684_0541134 | Ga0453684_0541134_401_730 | 109 |
| 331 | 3300044712 | Ga0453684_0686398 | Ga0453684_0686398_663_992 | 109 |
| 332 | 3300044712 | Ga0453684_1738329 | Ga0453684_1738329_142_471 | 109 |
| 333 | 3300045051 | Ga0451576_0069325 | Ga0451576_0069325_855_1184 | 109 |
| 334 | 3300045051 | Ga0451576_1061786 | Ga0451576_1061786_59_388 | 109 |
| 335 | 3300045836 | Ga0466958_0015759 | Ga0466958_0015759_2794_3123 | 109 |
| 336 | 3300046455 | Ga0495603_0235033 | Ga0495603_0235033_536_865 | 109 |
| 337 | 3300046457 | Ga0495590_0439035 | Ga0495590_0439035_128_457 | 109 |
| 338 | 3300046472 | Ga0495580_0700238 | Ga0495580_0700238_155_484 | 109 |
| 339 | 3300046491 | Ga0495584_0018635 | Ga0495584_0018635_662_991 | 109 |
| 340 | 3300046492 | Ga0495585_0297773 | Ga0495585_0297773_176_505 | 109 |
| 341 | 3300046501 | Ga0495607_0082709 | Ga0495607_0082709_1252_1581 | 109 |
| 342 | 3300046524 | Ga0495648_0134886 | Ga0495648_0134886_298_627 | 109 |
| 343 | 3300046539 | Ga0495621_0021560 | Ga0495621_0021560_484_813 | 109 |
| 344 | 3300046542 | Ga0495597_0000087 | Ga0495597_0000087_71886_72215 | 109 |
| 345 | 3300046557 | Ga0495622_0066012 | Ga0495622_0066012_952_1281 | 109 |
| 346 | 3300046615 | Ga0495656_0246132 | Ga0495656_0246132_333_662 | 109 |
| 347 | 3300046664 | Ga0495659_0220161 | Ga0495659_0220161_387_716 | 109 |
| 348 | 3300046665 | Ga0495661_0069145 | Ga0495661_0069145_400_729 | 109 |
| 349 | 3300046691 | Ga0495670_0000551 | Ga0495670_0000551_6795_7124 | 109 |
| 350 | 3300046692 | Ga0495671_0000402 | Ga0495671_0000402_34100_34429 | 109 |
| 351 | 3300047318 | Ga0495636_0072508 | Ga0495636_0072508_433_762 | 109 |
| 352 | 3300047320 | Ga0495672_0093098 | Ga0495672_0093098_119_448 | 109 |
| 353 | 3300047323 | Ga0495683_0006643 | Ga0495683_0006643_5473_5802 | 109 |
| 354 | 3300048907 | Ga0496104_0112855 | Ga0496104_0112855_469_798 | 109 |
| 355 | 3300048908 | Ga0496105_0137242 | Ga0496105_0137242_1391_1720 | 109 |
| 356 | 3300048909 | Ga0496106_0100927 | Ga0496106_0100927_148_477 | 109 |
| 357 | 3300048909 | Ga0496106_0362471 | Ga0496106_0362471_390_719 | 109 |
| 358 | 3300048911 | Ga0496108_0002661 | Ga0496108_0002661_13745_14074 | 109 |
| 359 | 3300048911 | Ga0496108_0134286 | Ga0496108_0134286_1167_1496 | 109 |
| 360 | 3300048912 | Ga0496109_0002792 | Ga0496109_0002792_13756_14085 | 109 |
| 361 | 3300048912 | Ga0496109_0412546 | Ga0496109_0412546_396_725 | 109 |
| 362 | 3300048913 | Ga0496110_0041029 | Ga0496110_0041029_3419_3748 | 109 |
| 363 | 3300048914 | Ga0496111_0066590 | Ga0496111_0066590_317_646 | 109 |
| 364 | 3300048915 | Ga0496112_0000330 | Ga0496112_0000330_374_703 | 109 |
| 365 | 3300048916 | Ga0496113_0000113 | Ga0496113_0000113_7799_8128 | 109 |
| 366 | 3300048917 | Ga0496114_0153623 | Ga0496114_0153623_374_703 | 109 |
| 367 | 3300048927 | Ga0496124_0000308 | Ga0496124_0000308_47552_47881 | 109 |
| 368 | 3300049663 | Ga0501223_142009 | Ga0501223_142009_85_414 | 109 |
| 369 | 3300049763 | Ga0501266_008644 | Ga0501266_008644_295_624 | 109 |
| 370 | 3300049824 | Ga0501045_1068442 | Ga0501045_1068442_24_353 | 109 |
| 371 | 3300049853 | Ga0501226_022469 | Ga0501226_022469_351_680 | 109 |
| 372 | 3300050509 | nmdc:mga0qj67_1013327_c1 | nmdc:mga0qj67_1013327_c1_267_596 | 109 |
| 373 | 3300050510 | nmdc:mga06r32_905437_c1 | nmdc:mga06r32_905437_c1_88_417 | 109 |
| 374 | 3300050512 | nmdc:mga0n895_119474_c1 | nmdc:mga0n895_119474_c1_1593_1922 | 109 |
| 375 | 3300053093 | Ga0500651_0094147 | Ga0500651_0094147_388_717 | 109 |
| 376 | 3300053096 | Ga0500641_0150077 | Ga0500641_0150077_605_934 | 109 |
| 377 | 3300046674 | Ga0495588_0392253 | Ga0495588_0392253_245_583 | 112 |
| 378 | 3300005546 | Ga0070696_100353285 | Ga0070696_1003532851 | 118 |
| 379 | 3300048905 | Ga0496102_0089084 | Ga0496102_0089084_1815_2198 | 121 |
| 380 | 3300048910 | Ga0496107_0255755 | Ga0496107_0255755_384_767 | 121 |
| 381 | 2162886007 | SwRhRL2b_contig_1757691 | SwRhRL2b_0988.00001830 | 122 |
| 382 | 3300009092 | Ga0105250_10000326 | Ga0105250_1000032612 | 122 |
| 383 | 3300013306 | Ga0163162_10135015 | Ga0163162_101350152 | 122 |
| 384 | 3300025921 | Ga0207652_10266258 | Ga0207652_102662583 | 122 |
| 385 | 3300046471 | Ga0495650_0000016 | Ga0495650_0000016_118860_119228 | 122 |
| 386 | 3300046810 | Ga0495660_0000007 | Ga0495660_0000007_75093_75461 | 122 |
| 387 | 3300048907 | Ga0496104_0015892 | Ga0496104_0015892_3302_3670 | 122 |
| 388 | 3300048907 | Ga0496104_0296909 | Ga0496104_0296909_702_1085 | 122 |
| 389 | 3300048908 | Ga0496105_0125179 | Ga0496105_0125179_337_720 | 122 |
| 390 | 3300048911 | Ga0496108_0060920 | Ga0496108_0060920_1388_1771 | 122 |
| 391 | 3300048912 | Ga0496109_0011693 | Ga0496109_0011693_4493_4876 | 122 |
| 392 | 3300048913 | Ga0496110_0038016 | Ga0496110_0038016_1963_2346 | 122 |
| 393 | 3300048914 | Ga0496111_0245519 | Ga0496111_0245519_325_708 | 122 |
| 394 | 3300048915 | Ga0496112_0056191 | Ga0496112_0056191_529_912 | 122 |
| 395 | 3300048916 | Ga0496113_0328387 | Ga0496113_0328387_31_414 | 122 |
| 396 | 3300048919 | Ga0496116_0000127 | Ga0496116_0000127_75079_75447 | 122 |
| 397 | 3300048920 | Ga0496117_0009530 | Ga0496117_0009530_972_1340 | 122 |
| 398 | 3300048921 | Ga0496118_0000464 | Ga0496118_0000464_61961_62329 | 122 |
| 399 | 3300048921 | Ga0496118_0007304 | Ga0496118_0007304_3203_3571 | 122 |
| 400 | 3300048922 | Ga0496119_0008158 | Ga0496119_0008158_2287_2655 | 122 |
| 401 | 3300048923 | Ga0496120_0001260 | Ga0496120_0001260_26740_27108 | 122 |
| 402 | 3300048925 | Ga0496122_0000013 | Ga0496122_0000013_123158_123526 | 122 |
| 403 | 3300048926 | Ga0496123_0000010 | Ga0496123_0000010_377514_377882 | 122 |
| 404 | 3300048927 | Ga0496124_0000152 | Ga0496124_0000152_138081_138449 | 122 |
| 405 | 3300048928 | Ga0496125_0000019 | Ga0496125_0000019_64879_65247 | 122 |
| 406 | 3300048929 | Ga0496126_0000736 | Ga0496126_0000736_29406_29774 | 122 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2i45-assembly1.cif.gz_A | crystal structure of protein nmb1881 from neisseria meningitidis | 0.8549 | 43 | 122 |
| 4fag-assembly1.cif.gz_A | crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate | 0.8538 | 41 | 121 |
| 5i0u-assembly1.cif.gz_A | incompletely interpreted d-cysteine soak of cysteine dioxygenase at ph 7.0 | 0.8532 | 41 | 121 |
| 4e2g-assembly3.cif.gz_E | crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus | 0.8522 | 20 | 121 |
| 6u4l-assembly1.cif.gz_A | cysteine dioxygenase variant - c93e | 0.8519 | 41 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P24174_373_472_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8612 | 43 | 121 | 2.60.120.10 |
| af_Q9USR9_537_626_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8569 | 41 | 121 | 2.60.120.10 |
| 1o5uB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8507 | 55 | 120 | 2.60.120.10 |
| 3elnA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.849 | 41 | 121 | 2.60.120.10 |
| af_E7FAC3_1039_1126_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8468 | 41 | 121 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A8B6KSK9-F1-model_v4 | deleted | 1.003 | 57 | 122 |
|
| AF-F4MYE7-F1-model_v4 | Cupin 2 conserved barrel domain-containing protein | 1.002 | 31 | 122 |
|
| AF-A0A4Q5TGD2-F1-model_v4 | ChrR-like cupin domain-containing protein | 1 | 18 | 122 |
|
| AF-A0A127Q2B0-F1-model_v4 | Cupin domain protein | 0.9996 | 17 | 122 |
|
| AF-A0A176XVP2-F1-model_v4 | DHCW motif cupin fold protein | 0.999 | 14 | 122 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar