F436223

General Info

Members Datasets Scaffolds Average Seq Length
406 247 406 110

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10266258|Ga0207652_102662583
Length 134
Sequence VADSSKIRVGIVGLSPQRGFASIAHVPALHALSDFEIAADQVHPERAGEAGVARSRTQQFGPVRVRLVEYSAGYRADHWCQKGHILFCVAGELETELADGRQFRLSPGMSYQVADNAEPHRSRTAMGATLFIVD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
186 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
189 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
190 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
198 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
240 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
247 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.43
Nodule 0
Rhizoplane 6.65
Rhizosphere 85.22
Stem 0
Stem Tuber 0
Unclassified 3.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1757691 2162886007 Bacteria 2603
2 JGI24749J21850_1070346 3300002076 Bacteria 540
3 JGI24742J22300_10018238 3300002244 Bacteria 1189
4 JGI25162J39368_1000003 3300002737 Bacteria 575218
5 JGI25163J39215_1000132 3300002771 Bacteria 30268
6 JGI25164J39214_1000211 3300002772 Bacteria 48878
7 Ga0055538_1000005 3300003751 Bacteria 575218
8 Ga0055539_1000007 3300003752 Bacteria 575218
9 Ga0055533_1000009 3300003756 Bacteria 575218
10 Ga0055525_1000010 3300003759 Bacteria 575218
11 Ga0055541_1000005 3300003841 Bacteria 575218
12 Ga0065704_10000516 3300005289 Bacteria 17979
13 Ga0065715_10261743 3300005293 Bacteria 1136
14 Ga0065715_10416148 3300005293 Bacteria 845
15 Ga0065707_10740671 3300005295 Bacteria 619
16 Ga0070658_11986347 3300005327 Unclassified 502
17 Ga0070676_10001146 3300005328 Bacteria 13233
18 Ga0070676_11210086 3300005328 Unclassified 574
19 Ga0070683_100297899 3300005329 Unclassified 1534
20 Ga0070690_100003661 3300005330 Bacteria 8462
21 Ga0070690_101723853 3300005330 Bacteria 510
22 Ga0070670_100359321 3300005331 Bacteria 1280
23 Ga0070677_10002857 3300005333 Bacteria 5544
24 Ga0068869_100070654 3300005334 Bacteria 2584
25 Ga0068869_100338144 3300005334 Bacteria 1224
26 Ga0070666_10003039 3300005335 Bacteria 10182
27 Ga0070666_10034205 3300005335 Bacteria 3368
28 Ga0070680_100075793 3300005336 Bacteria 2769
29 Ga0068868_100000994 3300005338 Bacteria 19343
30 Ga0068868_100149227 3300005338 Bacteria 1924
31 Ga0068868_101545369 3300005338 Bacteria 622
32 Ga0070660_100154404 3300005339 Bacteria 1847
33 Ga0070689_100060702 3300005340 Bacteria 2940
34 Ga0070687_100121874 3300005343 Bacteria 1492
35 Ga0070661_100001578 3300005344 Bacteria 15807
36 Ga0070661_101182272 3300005344 Bacteria 639
37 Ga0070661_101636987 3300005344 Bacteria 545
38 Ga0070692_10110099 3300005345 Bacteria 1522
39 Ga0070668_100174353 3300005347 Bacteria 1753
40 Ga0070668_100833304 3300005347 Bacteria 821
41 Ga0070668_100947990 3300005347 Unclassified 771
42 Ga0070669_100008035 3300005353 Bacteria 7531
43 Ga0070669_100234886 3300005353 Bacteria 1454
44 Ga0070675_100363248 3300005354 Bacteria 1286
45 Ga0070675_100468099 3300005354 Unclassified 1132
46 Ga0070671_100281164 3300005355 Bacteria 1415
47 Ga0070674_100020327 3300005356 Bacteria 4239
48 Ga0070674_100029314 3300005356 Bacteria 3623
49 Ga0070674_101571970 3300005356 Bacteria 592
50 Ga0070673_100084516 3300005364 Bacteria 2581
51 Ga0070673_100277200 3300005364 Bacteria 1470
52 Ga0070673_100428485 3300005364 Bacteria 1187
53 Ga0070688_100348473 3300005365 Bacteria 1084
54 Ga0070659_100000451 3300005366 Bacteria 30634
55 Ga0070659_100065033 3300005366 Bacteria 2888
56 Ga0070667_100153407 3300005367 Bacteria 2025
57 Ga0070703_10473716 3300005406 Bacteria 559
58 Ga0070701_10003628 3300005438 Bacteria 6139
59 Ga0070701_10069200 3300005438 Bacteria 1882
60 Ga0070711_100457195 3300005439 Bacteria 1046
61 Ga0070711_101400448 3300005439 Bacteria 608
62 Ga0070705_100192625 3300005440 Bacteria 1391
63 Ga0070700_100019649 3300005441 Bacteria 3903
64 Ga0070700_100097176 3300005441 Bacteria 1934
65 Ga0070700_100109027 3300005441 Bacteria 1837
66 Ga0070694_100013836 3300005444 Bacteria 5046
67 Ga0070663_100144381 3300005455 Bacteria 1820
68 Ga0070678_100012869 3300005456 Bacteria 5220
69 Ga0070662_100001037 3300005457 Bacteria 16977
70 Ga0068867_100003424 3300005459 Bacteria 11157
71 Ga0068867_100028083 3300005459 Bacteria 4049
72 Ga0068867_100065544 3300005459 Bacteria 2703
73 Ga0068867_100367649 3300005459 Bacteria 1205
74 Ga0068867_102166976 3300005459 Bacteria 527
75 Ga0070685_10410662 3300005466 Bacteria 940
76 Ga0070707_100547593 3300005468 Bacteria 1119
77 Ga0070684_100455771 3300005535 Bacteria 1182
78 Ga0070672_100262776 3300005543 Bacteria 1456
79 Ga0070672_100937799 3300005543 Bacteria 766
80 Ga0070686_100009840 3300005544 Bacteria 5372
81 Ga0070695_100092044 3300005545 Bacteria 2026
82 Ga0070696_100022656 3300005546 Bacteria 4269
83 Ga0070696_100353285 3300005546 Bacteria 1139
84 Ga0070696_101425068 3300005546 Bacteria 591
85 Ga0070693_100052576 3300005547 Bacteria 2336
86 Ga0070704_100023795 3300005549 Bacteria 4007
87 Ga0070704_100202807 3300005549 Bacteria 1602
88 Ga0068855_100360655 3300005563 Bacteria 1599
89 Ga0070664_100373238 3300005564 Bacteria 1301
90 Ga0068857_100066980 3300005577 Bacteria 3195
91 Ga0068857_100169252 3300005577 Bacteria 1985
92 Ga0068854_100000918 3300005578 Bacteria 17683
93 Ga0068854_100094145 3300005578 Bacteria 2234
94 Ga0068854_100932952 3300005578 Bacteria 765
95 Ga0068856_100276709 3300005614 Bacteria 1695
96 Ga0070702_100004718 3300005615 Bacteria 6258
97 Ga0070702_100091052 3300005615 Bacteria 1850
98 Ga0070702_100774424 3300005615 Bacteria 739
99 Ga0068852_101681231 3300005616 Bacteria 657
100 Ga0068859_100007364 3300005617 Bacteria 11165
101 Ga0068859_100565660 3300005617 Bacteria 1231
102 Ga0068864_100010875 3300005618 Bacteria 7523
103 Ga0068864_100052736 3300005618 Bacteria 3506
104 Ga0068864_100063275 3300005618 Bacteria 3206
105 Ga0068864_100148638 3300005618 Bacteria 2120
106 Ga0068866_10000566 3300005718 Bacteria 16802
107 Ga0068866_10002622 3300005718 Bacteria 7432
108 Ga0068861_100338708 3300005719 Bacteria 1316
109 Ga0068870_10015267 3300005840 Unclassified 3641
110 Ga0068863_100029419 3300005841 Bacteria 5244
111 Ga0068863_100189112 3300005841 Bacteria 1978
112 Ga0068858_100031229 3300005842 Bacteria 4946
113 Ga0068858_100168575 3300005842 Bacteria 2064
114 Ga0068860_100020067 3300005843 Bacteria 6475
115 Ga0068860_100080643 3300005843 Bacteria 3094
116 Ga0068862_100120336 3300005844 Bacteria 2313
117 Ga0068862_100651649 3300005844 Bacteria 1016
118 Ga0081455_10000351 3300005937 Bacteria 60585
119 Ga0081455_10283930 3300005937 Bacteria 1195
120 Ga0081455_11007354 3300005937 Bacteria 515
121 Ga0097621_100025871 3300006237 Bacteria 4597
122 Ga0097621_100044215 3300006237 Bacteria 3593
123 Ga0097621_100154791 3300006237 Bacteria 1967
124 Ga0097621_100201160 3300006237 Bacteria 1729
125 Ga0068871_100000178 3300006358 Bacteria 43025
126 Ga0068871_100023387 3300006358 Bacteria 4779
127 Ga0068871_100082490 3300006358 Bacteria 2666
128 Ga0068871_100275875 3300006358 Bacteria 1469
129 Ga0075430_101108069 3300006846 Bacteria 652
130 Ga0075431_100419335 3300006847 Bacteria 1338
131 Ga0075434_100053665 3300006871 Bacteria 4004
132 Ga0068865_100007459 3300006881 Bacteria 6731
133 Ga0068865_101135014 3300006881 Bacteria 690
134 Ga0068865_101625828 3300006881 Bacteria 581
135 Ga0097620_100007364 3300006931 Bacteria 11165
136 Ga0097620_100565585 3300006931 Bacteria 1231
137 Ga0097620_101366246 3300006931 Bacteria 781
138 Ga0105251_10000825 3300009011 Bacteria 27717
139 Ga0105250_10000326 3300009092 Bacteria 36660
140 Ga0105250_10382706 3300009092 Bacteria 621
141 Ga0105240_10527702 3300009093 Bacteria 1309
142 Ga0105245_10081803 3300009098 Bacteria 2953
143 Ga0105245_10479753 3300009098 Bacteria 1257
144 Ga0105247_10964996 3300009101 Bacteria 663
145 Ga0114129_11645158 3300009147 Bacteria 785
146 Ga0105243_10077096 3300009148 Bacteria 2710
147 Ga0105243_10249940 3300009148 Bacteria 1582
148 Ga0105241_10011267 3300009174 Bacteria 6556
149 Ga0105242_10028481 3300009176 Bacteria 4449
150 Ga0105242_10085741 3300009176 Bacteria 2642
151 Ga0105242_11199007 3300009176 Unclassified 778
152 Ga0105248_10005781 3300009177 Bacteria 13595
153 Ga0105248_10011045 3300009177 Bacteria 9963
154 Ga0105248_10870856 3300009177 Bacteria 1017
155 Ga0105248_10887252 3300009177 Bacteria 1007
156 Ga0105237_10610533 3300009545 Bacteria 1098
157 Ga0105238_10033485 3300009551 Bacteria 5230
158 Ga0105249_10005409 3300009553 Bacteria 11025
159 Ga0105249_10076031 3300009553 Bacteria 3111
160 Ga0105249_10207937 3300009553 Bacteria 1919
161 Ga0105249_10638638 3300009553 Bacteria 1122
162 Ga0105239_10023259 3300010375 Bacteria 6827
163 Ga0105239_10370331 3300010375 Bacteria 1619
164 Ga0105246_10021699 3300011119 Unclassified 4136
165 Ga0105246_11850547 3300011119 Bacteria 578
166 Ga0157371_10117232 3300013102 Bacteria 1893
167 Ga0157374_10618758 3300013296 Bacteria 1093
168 Ga0157378_10000730 3300013297 Bacteria 30701
169 Ga0157378_10010351 3300013297 Bacteria 8141
170 Ga0157378_10047759 3300013297 Bacteria 3806
171 Ga0163162_10010483 3300013306 Bacteria 9011
172 Ga0163162_10110532 3300013306 Bacteria 2845
173 Ga0163162_10135015 3300013306 Bacteria 2578
174 Ga0157372_10947207 3300013307 Bacteria 998
175 Ga0157372_13002669 3300013307 Bacteria 539
176 Ga0157375_10001824 3300013308 Bacteria 18280
177 Ga0157375_10170986 3300013308 Bacteria 2321
178 Ga0157375_10223600 3300013308 Bacteria 2041
179 Ga0157375_10255885 3300013308 Bacteria 1912
180 Ga0157375_11603552 3300013308 Bacteria 769
181 Ga0163163_10160500 3300014325 Bacteria 2293
182 Ga0163163_10453234 3300014325 Bacteria 1343
183 Ga0163163_10661776 3300014325 Bacteria 1108
184 Ga0157380_10035693 3300014326 Bacteria 3841
185 Ga0157380_10139874 3300014326 Bacteria 2078
186 Ga0157380_11247964 3300014326 Bacteria 789
187 Ga0157380_12280709 3300014326 Unclassified 606
188 Ga0157377_10002560 3300014745 Bacteria 8070
189 Ga0157379_10053721 3300014968 Bacteria 3599
190 Ga0157379_10085382 3300014968 Bacteria 2829
191 Ga0157376_10123202 3300014969 Bacteria 2301
192 Ga0157376_10226282 3300014969 Bacteria 1735
193 Ga0157376_10593382 3300014969 Bacteria 1102
194 Ga0157376_10744786 3300014969 Bacteria 988
195 Ga0163161_10051305 3300017792 Bacteria 2987
196 Ga0163161_10076421 3300017792 Bacteria 2458
197 Ga0163161_10973045 3300017792 Bacteria 723
198 Ga0209760_100001 3300025207 Bacteria 348781
199 Ga0209784_100001 3300025224 Bacteria 3600592
200 Ga0209566_100001 3300025225 Bacteria 3600765
201 Ga0209674_100002 3300025226 Bacteria 3600592
202 Ga0209563_100008 3300025230 Bacteria 1554545
203 Ga0207427_100002 3300025231 Bacteria 1355321
204 Ga0209437_100007 3300025233 Bacteria 938377
205 Ga0209677_100004 3300025253 Bacteria 1554545
206 Ga0207696_1000415 3300025711 Bacteria 39668
207 Ga0207655_1000157 3300025728 Bacteria 124885
208 Ga0207713_1001476 3300025735 Bacteria 18623
209 Ga0207682_10003487 3300025893 Bacteria 6817
210 Ga0207642_10000341 3300025899 Bacteria 14012
211 Ga0207642_10154218 3300025899 Bacteria 1226
212 Ga0207710_10440933 3300025900 Bacteria 671
213 Ga0207680_10007128 3300025903 Bacteria 5436
214 Ga0207680_10055224 3300025903 Bacteria 2393
215 Ga0207645_10001506 3300025907 Bacteria 19062
216 Ga0207645_10915769 3300025907 Bacteria 595
217 Ga0207643_10010349 3300025908 Bacteria 5023
218 Ga0207643_10020540 3300025908 Bacteria 3626
219 Ga0207654_10013267 3300025911 Bacteria 4237
220 Ga0207695_10406363 3300025913 Bacteria 1246
221 Ga0207695_11144045 3300025913 Bacteria 658
222 Ga0207663_10102899 3300025916 Bacteria 1922
223 Ga0207660_10091359 3300025917 Bacteria 2258
224 Ga0207662_10013199 3300025918 Bacteria 4617
225 Ga0207662_10305352 3300025918 Bacteria 1059
226 Ga0207657_10473602 3300025919 Bacteria 982
227 Ga0207649_10010505 3300025920 Bacteria 5088
228 Ga0207652_10266258 3300025921 Bacteria 1546
229 Ga0207646_11768611 3300025922 Bacteria 529
230 Ga0207681_10033172 3300025923 Bacteria 3383
231 Ga0207681_10149717 3300025923 Bacteria 1747
232 Ga0207681_10543368 3300025923 Bacteria 955
233 Ga0207650_10041390 3300025925 Bacteria 3375
234 Ga0207659_10246571 3300025926 Bacteria 1447
235 Ga0207659_10398100 3300025926 Bacteria 1151
236 Ga0207687_10301043 3300025927 Bacteria 1292
237 Ga0207644_10028824 3300025931 Bacteria 3847
238 Ga0207644_10523689 3300025931 Bacteria 979
239 Ga0207690_10001610 3300025932 Bacteria 14061
240 Ga0207690_10562447 3300025932 Bacteria 928
241 Ga0207706_10000153 3300025933 Bacteria 75743
242 Ga0207686_10000197 3300025934 Bacteria 46584
243 Ga0207686_10123639 3300025934 Bacteria 1765
244 Ga0207709_10025741 3300025935 Bacteria 3371
245 Ga0207709_10096276 3300025935 Bacteria 1947
246 Ga0207670_10041278 3300025936 Bacteria 3033
247 Ga0207669_10001843 3300025937 Bacteria 8985
248 Ga0207669_10020755 3300025937 Bacteria 3452
249 Ga0207704_10009049 3300025938 Bacteria 4787
250 Ga0207704_10047400 3300025938 Bacteria 2568
251 Ga0207704_11131915 3300025938 Bacteria 666
252 Ga0207691_10102136 3300025940 Bacteria 2558
253 Ga0207691_10112807 3300025940 Bacteria 2416
254 Ga0207691_10184360 3300025940 Bacteria 1822
255 Ga0207691_10617765 3300025940 Bacteria 917
256 Ga0207711_10004388 3300025941 Bacteria 12029
257 Ga0207711_11191800 3300025941 Bacteria 703
258 Ga0207689_10028157 3300025942 Bacteria 4699
259 Ga0207689_10105328 3300025942 Bacteria 2317
260 Ga0207689_11768117 3300025942 Unclassified 511
261 Ga0207679_10000220 3300025945 Bacteria 45059
262 Ga0207679_11329724 3300025945 Bacteria 659
263 Ga0207667_10376831 3300025949 Bacteria 1446
264 Ga0207651_10040597 3300025960 Bacteria 3080
265 Ga0207651_10282210 3300025960 Bacteria 1373
266 Ga0207712_10004991 3300025961 Bacteria 8392
267 Ga0207712_10124064 3300025961 Bacteria 1958
268 Ga0207712_10127749 3300025961 Bacteria 1933
269 Ga0207712_10218815 3300025961 Bacteria 1521
270 Ga0207668_10090128 3300025972 Bacteria 2250
271 Ga0207668_11609833 3300025972 Bacteria 586
272 Ga0207668_12065304 3300025972 Unclassified 513
273 Ga0207640_10000938 3300025981 Bacteria 16277
274 Ga0207658_10327651 3300025986 Bacteria 1327
275 Ga0207658_10550511 3300025986 Bacteria 1032
276 Ga0207677_10171893 3300026023 Bacteria 1695
277 Ga0207677_11200073 3300026023 Bacteria 694
278 Ga0207677_11442252 3300026023 Bacteria 635
279 Ga0207703_10125602 3300026035 Bacteria 2208
280 Ga0207678_10169072 3300026067 Unclassified 1866
281 Ga0207708_10001433 3300026075 Bacteria 17876
282 Ga0207708_10053026 3300026075 Bacteria 3089
283 Ga0207708_10491582 3300026075 Bacteria 1027
284 Ga0207641_10095510 3300026088 Bacteria 2609
285 Ga0207641_10239481 3300026088 Bacteria 1690
286 Ga0207641_10356328 3300026088 Bacteria 1395
287 Ga0207648_10000028 3300026089 Bacteria 130116
288 Ga0207648_10013533 3300026089 Bacteria 7585
289 Ga0207676_10013597 3300026095 Bacteria 5841
290 Ga0207676_10060095 3300026095 Bacteria 3004
291 Ga0207676_10516458 3300026095 Bacteria 1136
292 Ga0207674_10059169 3300026116 Unclassified 3879
293 Ga0207674_10213978 3300026116 Bacteria 1876
294 Ga0207675_100070552 3300026118 Bacteria 3266
295 Ga0207683_10007020 3300026121 Bacteria 9660
296 Ga0207683_10169800 3300026121 Bacteria 1975
297 Ga0207683_10174768 3300026121 Bacteria 1946
298 Ga0268266_10254822 3300028379 Bacteria 1624
299 Ga0268265_10485662 3300028380 Bacteria 1161
300 Ga0268265_10625453 3300028380 Bacteria 1032
301 Ga0268265_10652631 3300028380 Bacteria 1011
302 Ga0268265_11014117 3300028380 Bacteria 820
303 Ga0268264_10022730 3300028381 Bacteria 5117
304 Ga0268264_10043810 3300028381 Bacteria 3710
305 Ga0268264_11616788 3300028381 Bacteria 659
306 Ga0265323_10176107 3300028653 Bacteria 678
307 Ga0307416_103622513 3300032002 Bacteria 517
308 Ga0373932_0121991 3300035112 Bacteria 870
309 Ga0373939_0246300 3300035114 Bacteria 694
310 Ga0373960_0051999 3300035121 Bacteria 1219
311 Ga0373942_0238392 3300035207 Bacteria 615
312 Ga0373931_0029730 3300035691 Bacteria 2808
313 Ga0395899_0007262 3300037312 Bacteria 8571
314 Ga0395900_0039351 3300037418 Bacteria 4872
315 Ga0395905_0440845 3300037471 Bacteria 1200
316 Ga0395901_0409546 3300038443 Bacteria 1392
317 Ga0242420_002962 3300038996 Bacteria 2475
318 Ga0242420_079139 3300038996 Bacteria 677
319 Ga0451802_0315239 3300041460 Bacteria 1364
320 Ga0451804_0937317 3300041463 Bacteria 2048
321 Ga0451807_1983403 3300041486 Bacteria 1295
322 Ga0451837_0639187 3300041494 Bacteria 505
323 Ga0451845_0487811 3300041501 Bacteria 752
324 Ga0451853_1859943 3300041512 Bacteria 1329
325 Ga0439441_082583 3300042001 Bacteria 702
326 Ga0439448_0071472 3300042005 Bacteria 1156
327 Ga0439435_0070183 3300042436 Bacteria 1036
328 Ga0451577_0093540 3300042876 Bacteria 2684
329 Ga0451577_0432286 3300042876 Unclassified 1195
330 Ga0453683_0683977 3300044673 Bacteria 672
331 Ga0453683_0768831 3300044673 Bacteria 633
332 Ga0453684_0088492 3300044712 Bacteria 3835
333 Ga0453684_0343549 3300044712 Unclassified 1684
334 Ga0453684_0515703 3300044712 Unclassified 1321
335 Ga0453684_0541134 3300044712 Bacteria 1284
336 Ga0453684_0686398 3300044712 Unclassified 1114
337 Ga0453684_1738329 3300044712 Unclassified 636
338 Ga0451576_0069325 3300045051 Bacteria 3669
339 Ga0451576_1061786 3300045051 Bacteria 848
340 Ga0466958_0015759 3300045836 Bacteria 4340
341 Ga0495603_0235033 3300046455 Bacteria 1056
342 Ga0495590_0439035 3300046457 Bacteria 504
343 Ga0495650_0000016 3300046471 Bacteria 554693
344 Ga0495580_0700238 3300046472 Bacteria 663
345 Ga0495584_0018635 3300046491 Bacteria 3528
346 Ga0495585_0297773 3300046492 Unclassified 794
347 Ga0495607_0082709 3300046501 Bacteria 1760
348 Ga0495648_0134886 3300046524 Bacteria 1307
349 Ga0495621_0021560 3300046539 Bacteria 2125
350 Ga0495597_0000087 3300046542 Bacteria 81275
351 Ga0495622_0066012 3300046557 Bacteria 1673
352 Ga0495656_0246132 3300046615 Bacteria 902
353 Ga0495659_0220161 3300046664 Bacteria 784
354 Ga0495661_0069145 3300046665 Bacteria 2070
355 Ga0495588_0392253 3300046674 Bacteria 729
356 Ga0495670_0000551 3300046691 Bacteria 17851
357 Ga0495671_0000402 3300046692 Bacteria 35090
358 Ga0495660_0000007 3300046810 Bacteria 485295
359 Ga0495636_0072508 3300047318 Bacteria 1472
360 Ga0495672_0093098 3300047320 Bacteria 1651
361 Ga0495683_0006643 3300047323 Bacteria 6306
362 Ga0496102_0089084 3300048905 Unclassified 2854
363 Ga0496104_0015892 3300048907 Bacteria 6830
364 Ga0496104_0112855 3300048907 Bacteria 2606
365 Ga0496104_0296909 3300048907 Bacteria 1528
366 Ga0496105_0125179 3300048908 Bacteria 2119
367 Ga0496105_0137242 3300048908 Bacteria 2014
368 Ga0496106_0100927 3300048909 Bacteria 2238
369 Ga0496106_0362471 3300048909 Bacteria 1164
370 Ga0496107_0255755 3300048910 Bacteria 1303
371 Ga0496108_0002661 3300048911 Bacteria 14312
372 Ga0496108_0060920 3300048911 Bacteria 3175
373 Ga0496108_0134286 3300048911 Bacteria 2128
374 Ga0496109_0002792 3300048912 Bacteria 14625
375 Ga0496109_0011693 3300048912 Bacteria 7550
376 Ga0496109_0412546 3300048912 Bacteria 1276
377 Ga0496110_0038016 3300048913 Bacteria 4186
378 Ga0496110_0041029 3300048913 Bacteria 4036
379 Ga0496111_0066590 3300048914 Bacteria 2616
380 Ga0496111_0245519 3300048914 Bacteria 1329
381 Ga0496112_0000330 3300048915 Bacteria 30627
382 Ga0496112_0056191 3300048915 Bacteria 3873
383 Ga0496113_0000113 3300048916 Bacteria 35005
384 Ga0496113_0328387 3300048916 Bacteria 1226
385 Ga0496114_0153623 3300048917 Bacteria 1997
386 Ga0496116_0000127 3300048919 Bacteria 158773
387 Ga0496117_0009530 3300048920 Bacteria 9016
388 Ga0496118_0000464 3300048921 Bacteria 67368
389 Ga0496118_0007304 3300048921 Bacteria 11754
390 Ga0496119_0008158 3300048922 Bacteria 9270
391 Ga0496120_0001260 3300048923 Bacteria 31828
392 Ga0496122_0000013 3300048925 Bacteria 501039
393 Ga0496123_0000010 3300048926 Bacteria 501039
394 Ga0496124_0000152 3300048927 Bacteria 140118
395 Ga0496124_0000308 3300048927 Bacteria 90566
396 Ga0496125_0000019 3300048928 Bacteria 474989
397 Ga0496126_0000736 3300048929 Bacteria 59445
398 Ga0501223_142009 3300049663 Bacteria 517
399 Ga0501266_008644 3300049763 Bacteria 1282
400 Ga0501045_1068442 3300049824 Bacteria 591
401 Ga0501226_022469 3300049853 Bacteria 700
402 nmdc:mga0qj67_1013327_c1 3300050509 Bacteria 651
403 nmdc:mga06r32_905437_c1 3300050510 Bacteria 838
404 nmdc:mga0n895_119474_c1 3300050512 Bacteria 2656
405 Ga0500651_0094147 3300053093 Bacteria 1842
406 Ga0500641_0150077 3300053096 Bacteria 1006

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002076 JGI24749J21850_1070346 JGI24749J21850_10703461 109
2 3300002244 JGI24742J22300_10018238 JGI24742J22300_100182382 109
3 3300002737 JGI25162J39368_1000003 JGI25162J39368_1000003530 109
4 3300002771 JGI25163J39215_1000132 JGI25163J39215_100013216 109
5 3300002772 JGI25164J39214_1000211 JGI25164J39214_100021118 109
6 3300003751 Ga0055538_1000005 Ga0055538_1000005530 109
7 3300003752 Ga0055539_1000007 Ga0055539_1000007530 109
8 3300003756 Ga0055533_1000009 Ga0055533_1000009530 109
9 3300003759 Ga0055525_1000010 Ga0055525_1000010530 109
10 3300003841 Ga0055541_1000005 Ga0055541_100000535 109
11 3300005289 Ga0065704_10000516 Ga0065704_1000051613 109
12 3300005293 Ga0065715_10261743 Ga0065715_102617432 109
13 3300005293 Ga0065715_10416148 Ga0065715_104161481 109
14 3300005295 Ga0065707_10740671 Ga0065707_107406711 109
15 3300005327 Ga0070658_11986347 Ga0070658_119863471 109
16 3300005328 Ga0070676_10001146 Ga0070676_1000114612 109
17 3300005328 Ga0070676_11210086 Ga0070676_112100861 109
18 3300005329 Ga0070683_100297899 Ga0070683_1002978992 109
19 3300005330 Ga0070690_100003661 Ga0070690_1000036617 109
20 3300005330 Ga0070690_101723853 Ga0070690_1017238531 109
21 3300005331 Ga0070670_100359321 Ga0070670_1003593212 109
22 3300005333 Ga0070677_10002857 Ga0070677_100028577 109
23 3300005334 Ga0068869_100070654 Ga0068869_1000706542 109
24 3300005334 Ga0068869_100338144 Ga0068869_1003381441 109
25 3300005335 Ga0070666_10003039 Ga0070666_100030399 109
26 3300005335 Ga0070666_10034205 Ga0070666_100342052 109
27 3300005336 Ga0070680_100075793 Ga0070680_1000757931 109
28 3300005338 Ga0068868_100000994 Ga0068868_10000099419 109
29 3300005338 Ga0068868_100149227 Ga0068868_1001492272 109
30 3300005338 Ga0068868_101545369 Ga0068868_1015453692 109
31 3300005339 Ga0070660_100154404 Ga0070660_1001544041 109
32 3300005340 Ga0070689_100060702 Ga0070689_1000607025 109
33 3300005343 Ga0070687_100121874 Ga0070687_1001218742 109
34 3300005344 Ga0070661_100001578 Ga0070661_1000015785 109
35 3300005344 Ga0070661_101182272 Ga0070661_1011822722 109
36 3300005344 Ga0070661_101636987 Ga0070661_1016369871 109
37 3300005345 Ga0070692_10110099 Ga0070692_101100993 109
38 3300005347 Ga0070668_100174353 Ga0070668_1001743533 109
39 3300005347 Ga0070668_100833304 Ga0070668_1008333042 109
40 3300005347 Ga0070668_100947990 Ga0070668_1009479902 109
41 3300005353 Ga0070669_100008035 Ga0070669_1000080354 109
42 3300005353 Ga0070669_100234886 Ga0070669_1002348862 109
43 3300005354 Ga0070675_100363248 Ga0070675_1003632482 109
44 3300005354 Ga0070675_100468099 Ga0070675_1004680992 109
45 3300005355 Ga0070671_100281164 Ga0070671_1002811642 109
46 3300005356 Ga0070674_100020327 Ga0070674_1000203272 109
47 3300005356 Ga0070674_100029314 Ga0070674_1000293142 109
48 3300005356 Ga0070674_101571970 Ga0070674_1015719701 109
49 3300005364 Ga0070673_100084516 Ga0070673_1000845163 109
50 3300005364 Ga0070673_100277200 Ga0070673_1002772001 109
51 3300005364 Ga0070673_100428485 Ga0070673_1004284852 109
52 3300005365 Ga0070688_100348473 Ga0070688_1003484732 109
53 3300005366 Ga0070659_100000451 Ga0070659_1000004519 109
54 3300005366 Ga0070659_100065033 Ga0070659_1000650334 109
55 3300005367 Ga0070667_100153407 Ga0070667_1001534073 109
56 3300005406 Ga0070703_10473716 Ga0070703_104737162 109
57 3300005438 Ga0070701_10003628 Ga0070701_100036281 109
58 3300005438 Ga0070701_10069200 Ga0070701_100692002 109
59 3300005439 Ga0070711_100457195 Ga0070711_1004571952 109
60 3300005439 Ga0070711_101400448 Ga0070711_1014004481 109
61 3300005440 Ga0070705_100192625 Ga0070705_1001926251 109
62 3300005441 Ga0070700_100019649 Ga0070700_1000196492 109
63 3300005441 Ga0070700_100097176 Ga0070700_1000971764 109
64 3300005441 Ga0070700_100109027 Ga0070700_1001090273 109
65 3300005444 Ga0070694_100013836 Ga0070694_1000138364 109
66 3300005455 Ga0070663_100144381 Ga0070663_1001443812 109
67 3300005456 Ga0070678_100012869 Ga0070678_1000128695 109
68 3300005457 Ga0070662_100001037 Ga0070662_1000010373 109
69 3300005459 Ga0068867_100003424 Ga0068867_10000342411 109
70 3300005459 Ga0068867_100028083 Ga0068867_1000280833 109
71 3300005459 Ga0068867_100065544 Ga0068867_1000655443 109
72 3300005459 Ga0068867_100367649 Ga0068867_1003676493 109
73 3300005459 Ga0068867_102166976 Ga0068867_1021669761 109
74 3300005466 Ga0070685_10410662 Ga0070685_104106621 109
75 3300005468 Ga0070707_100547593 Ga0070707_1005475931 109
76 3300005535 Ga0070684_100455771 Ga0070684_1004557712 109
77 3300005543 Ga0070672_100262776 Ga0070672_1002627763 109
78 3300005543 Ga0070672_100937799 Ga0070672_1009377993 109
79 3300005544 Ga0070686_100009840 Ga0070686_1000098405 109
80 3300005545 Ga0070695_100092044 Ga0070695_1000920443 109
81 3300005546 Ga0070696_100022656 Ga0070696_1000226565 109
82 3300005546 Ga0070696_101425068 Ga0070696_1014250681 109
83 3300005547 Ga0070693_100052576 Ga0070693_1000525764 109
84 3300005549 Ga0070704_100023795 Ga0070704_1000237955 109
85 3300005549 Ga0070704_100202807 Ga0070704_1002028072 109
86 3300005563 Ga0068855_100360655 Ga0068855_1003606552 109
87 3300005564 Ga0070664_100373238 Ga0070664_1003732382 109
88 3300005577 Ga0068857_100066980 Ga0068857_1000669802 109
89 3300005577 Ga0068857_100169252 Ga0068857_1001692521 109
90 3300005578 Ga0068854_100000918 Ga0068854_10000091813 109
91 3300005578 Ga0068854_100094145 Ga0068854_1000941452 109
92 3300005578 Ga0068854_100932952 Ga0068854_1009329521 109
93 3300005614 Ga0068856_100276709 Ga0068856_1002767093 109
94 3300005615 Ga0070702_100004718 Ga0070702_1000047188 109
95 3300005615 Ga0070702_100091052 Ga0070702_1000910524 109
96 3300005615 Ga0070702_100774424 Ga0070702_1007744242 109
97 3300005616 Ga0068852_101681231 Ga0068852_1016812311 109
98 3300005617 Ga0068859_100007364 Ga0068859_1000073644 109
99 3300005617 Ga0068859_100565660 Ga0068859_1005656602 109
100 3300005618 Ga0068864_100010875 Ga0068864_1000108756 109
101 3300005618 Ga0068864_100052736 Ga0068864_1000527362 109
102 3300005618 Ga0068864_100063275 Ga0068864_1000632752 109
103 3300005618 Ga0068864_100148638 Ga0068864_1001486382 109
104 3300005718 Ga0068866_10000566 Ga0068866_100005663 109
105 3300005718 Ga0068866_10002622 Ga0068866_100026226 109
106 3300005719 Ga0068861_100338708 Ga0068861_1003387083 109
107 3300005840 Ga0068870_10015267 Ga0068870_100152676 109
108 3300005841 Ga0068863_100029419 Ga0068863_1000294195 109
109 3300005841 Ga0068863_100189112 Ga0068863_1001891122 109
110 3300005842 Ga0068858_100031229 Ga0068858_1000312295 109
111 3300005842 Ga0068858_100168575 Ga0068858_1001685754 109
112 3300005843 Ga0068860_100020067 Ga0068860_1000200672 109
113 3300005843 Ga0068860_100080643 Ga0068860_1000806432 109
114 3300005844 Ga0068862_100120336 Ga0068862_1001203362 109
115 3300005844 Ga0068862_100651649 Ga0068862_1006516492 109
116 3300005937 Ga0081455_10000351 Ga0081455_1000035193 109
117 3300005937 Ga0081455_10283930 Ga0081455_102839303 109
118 3300005937 Ga0081455_11007354 Ga0081455_110073541 109
119 3300006237 Ga0097621_100025871 Ga0097621_1000258712 109
120 3300006237 Ga0097621_100044215 Ga0097621_1000442151 109
121 3300006237 Ga0097621_100154791 Ga0097621_1001547912 109
122 3300006237 Ga0097621_100201160 Ga0097621_1002011602 109
123 3300006358 Ga0068871_100000178 Ga0068871_10000017819 109
124 3300006358 Ga0068871_100023387 Ga0068871_1000233873 109
125 3300006358 Ga0068871_100082490 Ga0068871_1000824904 109
126 3300006358 Ga0068871_100275875 Ga0068871_1002758752 109
127 3300006846 Ga0075430_101108069 Ga0075430_1011080692 109
128 3300006847 Ga0075431_100419335 Ga0075431_1004193352 109
129 3300006871 Ga0075434_100053665 Ga0075434_1000536654 109
130 3300006881 Ga0068865_100007459 Ga0068865_1000074599 109
131 3300006881 Ga0068865_101135014 Ga0068865_1011350142 109
132 3300006881 Ga0068865_101625828 Ga0068865_1016258281 109
133 3300006931 Ga0097620_100007364 Ga0097620_1000073644 109
134 3300006931 Ga0097620_100565585 Ga0097620_1005655852 109
135 3300006931 Ga0097620_101366246 Ga0097620_1013662462 109
136 3300009011 Ga0105251_10000825 Ga0105251_1000082518 109
137 3300009092 Ga0105250_10382706 Ga0105250_103827061 109
138 3300009093 Ga0105240_10527702 Ga0105240_105277022 109
139 3300009098 Ga0105245_10081803 Ga0105245_100818035 109
140 3300009098 Ga0105245_10479753 Ga0105245_104797532 109
141 3300009101 Ga0105247_10964996 Ga0105247_109649962 109
142 3300009147 Ga0114129_11645158 Ga0114129_116451581 109
143 3300009148 Ga0105243_10077096 Ga0105243_100770963 109
144 3300009148 Ga0105243_10249940 Ga0105243_102499403 109
145 3300009174 Ga0105241_10011267 Ga0105241_100112676 109
146 3300009176 Ga0105242_10028481 Ga0105242_100284812 109
147 3300009176 Ga0105242_10085741 Ga0105242_100857413 109
148 3300009176 Ga0105242_11199007 Ga0105242_111990072 109
149 3300009177 Ga0105248_10005781 Ga0105248_100057819 109
150 3300009177 Ga0105248_10011045 Ga0105248_100110458 109
151 3300009177 Ga0105248_10870856 Ga0105248_108708561 109
152 3300009177 Ga0105248_10887252 Ga0105248_108872522 109
153 3300009545 Ga0105237_10610533 Ga0105237_106105332 109
154 3300009551 Ga0105238_10033485 Ga0105238_100334852 109
155 3300009553 Ga0105249_10005409 Ga0105249_1000540914 109
156 3300009553 Ga0105249_10076031 Ga0105249_100760314 109
157 3300009553 Ga0105249_10207937 Ga0105249_102079372 109
158 3300009553 Ga0105249_10638638 Ga0105249_106386382 109
159 3300010375 Ga0105239_10023259 Ga0105239_100232592 109
160 3300010375 Ga0105239_10370331 Ga0105239_103703313 109
161 3300011119 Ga0105246_10021699 Ga0105246_100216996 109
162 3300011119 Ga0105246_11850547 Ga0105246_118505471 109
163 3300013102 Ga0157371_10117232 Ga0157371_101172323 109
164 3300013296 Ga0157374_10618758 Ga0157374_106187582 109
165 3300013297 Ga0157378_10000730 Ga0157378_1000073016 109
166 3300013297 Ga0157378_10010351 Ga0157378_100103516 109
167 3300013297 Ga0157378_10047759 Ga0157378_100477593 109
168 3300013306 Ga0163162_10010483 Ga0163162_1001048310 109
169 3300013306 Ga0163162_10110532 Ga0163162_101105322 109
170 3300013307 Ga0157372_10947207 Ga0157372_109472072 109
171 3300013307 Ga0157372_13002669 Ga0157372_130026691 109
172 3300013308 Ga0157375_10001824 Ga0157375_100018242 109
173 3300013308 Ga0157375_10170986 Ga0157375_101709862 109
174 3300013308 Ga0157375_10223600 Ga0157375_102236003 109
175 3300013308 Ga0157375_10255885 Ga0157375_102558853 109
176 3300013308 Ga0157375_11603552 Ga0157375_116035522 109
177 3300014325 Ga0163163_10160500 Ga0163163_101605003 109
178 3300014325 Ga0163163_10453234 Ga0163163_104532342 109
179 3300014325 Ga0163163_10661776 Ga0163163_106617762 109
180 3300014326 Ga0157380_10035693 Ga0157380_100356935 109
181 3300014326 Ga0157380_10139874 Ga0157380_101398744 109
182 3300014326 Ga0157380_11247964 Ga0157380_112479641 109
183 3300014326 Ga0157380_12280709 Ga0157380_122807092 109
184 3300014745 Ga0157377_10002560 Ga0157377_100025602 109
185 3300014968 Ga0157379_10053721 Ga0157379_100537214 109
186 3300014968 Ga0157379_10085382 Ga0157379_100853824 109
187 3300014969 Ga0157376_10123202 Ga0157376_101232024 109
188 3300014969 Ga0157376_10226282 Ga0157376_102262822 109
189 3300014969 Ga0157376_10593382 Ga0157376_105933822 109
190 3300014969 Ga0157376_10744786 Ga0157376_107447862 109
191 3300017792 Ga0163161_10051305 Ga0163161_100513052 109
192 3300017792 Ga0163161_10076421 Ga0163161_100764212 109
193 3300017792 Ga0163161_10973045 Ga0163161_109730452 109
194 3300025207 Ga0209760_100001 Ga0209760_100001204 109
195 3300025224 Ga0209784_100001 Ga0209784_1000011072 109
196 3300025225 Ga0209566_100001 Ga0209566_1000011072 109
197 3300025226 Ga0209674_100002 Ga0209674_1000021072 109
198 3300025230 Ga0209563_100008 Ga0209563_1000081073 109
199 3300025231 Ga0207427_100002 Ga0207427_100002204 109
200 3300025233 Ga0209437_100007 Ga0209437_100007525 109
201 3300025253 Ga0209677_100004 Ga0209677_1000041073 109
202 3300025711 Ga0207696_1000415 Ga0207696_100041532 109
203 3300025728 Ga0207655_1000157 Ga0207655_100015723 109
204 3300025735 Ga0207713_1001476 Ga0207713_100147610 109
205 3300025893 Ga0207682_10003487 Ga0207682_100034875 109
206 3300025899 Ga0207642_10000341 Ga0207642_1000034117 109
207 3300025899 Ga0207642_10154218 Ga0207642_101542182 109
208 3300025900 Ga0207710_10440933 Ga0207710_104409332 109
209 3300025903 Ga0207680_10007128 Ga0207680_100071282 109
210 3300025903 Ga0207680_10055224 Ga0207680_100552242 109
211 3300025907 Ga0207645_10001506 Ga0207645_1000150613 109
212 3300025907 Ga0207645_10915769 Ga0207645_109157691 109
213 3300025908 Ga0207643_10010349 Ga0207643_100103492 109
214 3300025908 Ga0207643_10020540 Ga0207643_100205402 109
215 3300025911 Ga0207654_10013267 Ga0207654_100132675 109
216 3300025913 Ga0207695_10406363 Ga0207695_104063632 109
217 3300025913 Ga0207695_11144045 Ga0207695_111440452 109
218 3300025916 Ga0207663_10102899 Ga0207663_101028991 109
219 3300025917 Ga0207660_10091359 Ga0207660_100913592 109
220 3300025918 Ga0207662_10013199 Ga0207662_100131996 109
221 3300025918 Ga0207662_10305352 Ga0207662_103053521 109
222 3300025919 Ga0207657_10473602 Ga0207657_104736021 109
223 3300025920 Ga0207649_10010505 Ga0207649_1001050511 109
224 3300025922 Ga0207646_11768611 Ga0207646_117686111 109
225 3300025923 Ga0207681_10033172 Ga0207681_100331726 109
226 3300025923 Ga0207681_10149717 Ga0207681_101497172 109
227 3300025923 Ga0207681_10543368 Ga0207681_105433682 109
228 3300025925 Ga0207650_10041390 Ga0207650_100413904 109
229 3300025926 Ga0207659_10246571 Ga0207659_102465712 109
230 3300025926 Ga0207659_10398100 Ga0207659_103981001 109
231 3300025927 Ga0207687_10301043 Ga0207687_103010432 109
232 3300025931 Ga0207644_10028824 Ga0207644_100288245 109
233 3300025931 Ga0207644_10523689 Ga0207644_105236892 109
234 3300025932 Ga0207690_10001610 Ga0207690_100016104 109
235 3300025932 Ga0207690_10562447 Ga0207690_105624471 109
236 3300025933 Ga0207706_10000153 Ga0207706_1000015316 109
237 3300025934 Ga0207686_10000197 Ga0207686_1000019761 109
238 3300025934 Ga0207686_10123639 Ga0207686_101236393 109
239 3300025935 Ga0207709_10025741 Ga0207709_100257411 109
240 3300025935 Ga0207709_10096276 Ga0207709_100962763 109
241 3300025936 Ga0207670_10041278 Ga0207670_100412781 109
242 3300025937 Ga0207669_10001843 Ga0207669_100018436 109
243 3300025937 Ga0207669_10020755 Ga0207669_100207554 109
244 3300025938 Ga0207704_10009049 Ga0207704_100090495 109
245 3300025938 Ga0207704_10047400 Ga0207704_100474002 109
246 3300025938 Ga0207704_11131915 Ga0207704_111319152 109
247 3300025940 Ga0207691_10102136 Ga0207691_101021365 109
248 3300025940 Ga0207691_10112807 Ga0207691_101128075 109
249 3300025940 Ga0207691_10184360 Ga0207691_101843602 109
250 3300025940 Ga0207691_10617765 Ga0207691_106177652 109
251 3300025941 Ga0207711_10004388 Ga0207711_1000438813 109
252 3300025941 Ga0207711_11191800 Ga0207711_111918002 109
253 3300025942 Ga0207689_10028157 Ga0207689_100281575 109
254 3300025942 Ga0207689_10105328 Ga0207689_101053282 109
255 3300025942 Ga0207689_11768117 Ga0207689_117681171 109
256 3300025945 Ga0207679_10000220 Ga0207679_100002201 109
257 3300025945 Ga0207679_11329724 Ga0207679_113297242 109
258 3300025949 Ga0207667_10376831 Ga0207667_103768313 109
259 3300025960 Ga0207651_10040597 Ga0207651_100405974 109
260 3300025960 Ga0207651_10282210 Ga0207651_102822103 109
261 3300025961 Ga0207712_10004991 Ga0207712_100049919 109
262 3300025961 Ga0207712_10124064 Ga0207712_101240643 109
263 3300025961 Ga0207712_10127749 Ga0207712_101277492 109
264 3300025961 Ga0207712_10218815 Ga0207712_102188152 109
265 3300025972 Ga0207668_10090128 Ga0207668_100901282 109
266 3300025972 Ga0207668_11609833 Ga0207668_116098332 109
267 3300025972 Ga0207668_12065304 Ga0207668_120653042 109
268 3300025981 Ga0207640_10000938 Ga0207640_1000093811 109
269 3300025986 Ga0207658_10327651 Ga0207658_103276512 109
270 3300025986 Ga0207658_10550511 Ga0207658_105505112 109
271 3300026023 Ga0207677_10171893 Ga0207677_101718933 109
272 3300026023 Ga0207677_11200073 Ga0207677_112000732 109
273 3300026023 Ga0207677_11442252 Ga0207677_114422521 109
274 3300026035 Ga0207703_10125602 Ga0207703_101256023 109
275 3300026067 Ga0207678_10169072 Ga0207678_101690722 109
276 3300026075 Ga0207708_10001433 Ga0207708_1000143320 109
277 3300026075 Ga0207708_10053026 Ga0207708_100530265 109
278 3300026075 Ga0207708_10491582 Ga0207708_104915823 109
279 3300026088 Ga0207641_10095510 Ga0207641_100955101 109
280 3300026088 Ga0207641_10239481 Ga0207641_102394812 109
281 3300026088 Ga0207641_10356328 Ga0207641_103563282 109
282 3300026089 Ga0207648_10000028 Ga0207648_1000002888 109
283 3300026089 Ga0207648_10013533 Ga0207648_100135335 109
284 3300026095 Ga0207676_10013597 Ga0207676_100135973 109
285 3300026095 Ga0207676_10060095 Ga0207676_100600951 109
286 3300026095 Ga0207676_10516458 Ga0207676_105164582 109
287 3300026116 Ga0207674_10059169 Ga0207674_100591695 109
288 3300026116 Ga0207674_10213978 Ga0207674_102139782 109
289 3300026118 Ga0207675_100070552 Ga0207675_1000705524 109
290 3300026121 Ga0207683_10007020 Ga0207683_1000702010 109
291 3300026121 Ga0207683_10169800 Ga0207683_101698002 109
292 3300026121 Ga0207683_10174768 Ga0207683_101747682 109
293 3300028379 Ga0268266_10254822 Ga0268266_102548221 109
294 3300028380 Ga0268265_10485662 Ga0268265_104856623 109
295 3300028380 Ga0268265_10625453 Ga0268265_106254532 109
296 3300028380 Ga0268265_10652631 Ga0268265_106526311 109
297 3300028380 Ga0268265_11014117 Ga0268265_110141172 109
298 3300028381 Ga0268264_10022730 Ga0268264_100227301 109
299 3300028381 Ga0268264_10043810 Ga0268264_100438103 109
300 3300028381 Ga0268264_11616788 Ga0268264_116167882 109
301 3300028653 Ga0265323_10176107 Ga0265323_101761072 109
302 3300032002 Ga0307416_103622513 Ga0307416_1036225131 109
303 3300035112 Ga0373932_0121991 Ga0373932_0121991_418_747 109
304 3300035114 Ga0373939_0246300 Ga0373939_0246300_254_583 109
305 3300035121 Ga0373960_0051999 Ga0373960_0051999_708_1037 109
306 3300035207 Ga0373942_0238392 Ga0373942_0238392_69_398 109
307 3300035691 Ga0373931_0029730 Ga0373931_0029730_2329_2658 109
308 3300037312 Ga0395899_0007262 Ga0395899_0007262_4521_4850 109
309 3300037418 Ga0395900_0039351 Ga0395900_0039351_3345_3674 109
310 3300037471 Ga0395905_0440845 Ga0395905_0440845_693_1022 109
311 3300038443 Ga0395901_0409546 Ga0395901_0409546_451_792 109
312 3300038996 Ga0242420_002962 Ga0242420_002962_536_865 109
313 3300038996 Ga0242420_079139 Ga0242420_079139_101_430 109
314 3300041460 Ga0451802_0315239 Ga0451802_0315239_188_517 109
315 3300041463 Ga0451804_0937317 Ga0451804_0937317_458_787 109
316 3300041486 Ga0451807_1983403 Ga0451807_1983403_610_939 109
317 3300041494 Ga0451837_0639187 Ga0451837_0639187_26_355 109
318 3300041501 Ga0451845_0487811 Ga0451845_0487811_11_340 109
319 3300041512 Ga0451853_1859943 Ga0451853_1859943_138_467 109
320 3300042001 Ga0439441_082583 Ga0439441_082583_334_663 109
321 3300042005 Ga0439448_0071472 Ga0439448_0071472_803_1132 109
322 3300042436 Ga0439435_0070183 Ga0439435_0070183_55_384 109
323 3300042876 Ga0451577_0093540 Ga0451577_0093540_698_1027 109
324 3300042876 Ga0451577_0432286 Ga0451577_0432286_113_442 109
325 3300044673 Ga0453683_0683977 Ga0453683_0683977_186_515 109
326 3300044673 Ga0453683_0768831 Ga0453683_0768831_243_572 109
327 3300044712 Ga0453684_0088492 Ga0453684_0088492_1450_1779 109
328 3300044712 Ga0453684_0343549 Ga0453684_0343549_529_858 109
329 3300044712 Ga0453684_0515703 Ga0453684_0515703_132_461 109
330 3300044712 Ga0453684_0541134 Ga0453684_0541134_401_730 109
331 3300044712 Ga0453684_0686398 Ga0453684_0686398_663_992 109
332 3300044712 Ga0453684_1738329 Ga0453684_1738329_142_471 109
333 3300045051 Ga0451576_0069325 Ga0451576_0069325_855_1184 109
334 3300045051 Ga0451576_1061786 Ga0451576_1061786_59_388 109
335 3300045836 Ga0466958_0015759 Ga0466958_0015759_2794_3123 109
336 3300046455 Ga0495603_0235033 Ga0495603_0235033_536_865 109
337 3300046457 Ga0495590_0439035 Ga0495590_0439035_128_457 109
338 3300046472 Ga0495580_0700238 Ga0495580_0700238_155_484 109
339 3300046491 Ga0495584_0018635 Ga0495584_0018635_662_991 109
340 3300046492 Ga0495585_0297773 Ga0495585_0297773_176_505 109
341 3300046501 Ga0495607_0082709 Ga0495607_0082709_1252_1581 109
342 3300046524 Ga0495648_0134886 Ga0495648_0134886_298_627 109
343 3300046539 Ga0495621_0021560 Ga0495621_0021560_484_813 109
344 3300046542 Ga0495597_0000087 Ga0495597_0000087_71886_72215 109
345 3300046557 Ga0495622_0066012 Ga0495622_0066012_952_1281 109
346 3300046615 Ga0495656_0246132 Ga0495656_0246132_333_662 109
347 3300046664 Ga0495659_0220161 Ga0495659_0220161_387_716 109
348 3300046665 Ga0495661_0069145 Ga0495661_0069145_400_729 109
349 3300046691 Ga0495670_0000551 Ga0495670_0000551_6795_7124 109
350 3300046692 Ga0495671_0000402 Ga0495671_0000402_34100_34429 109
351 3300047318 Ga0495636_0072508 Ga0495636_0072508_433_762 109
352 3300047320 Ga0495672_0093098 Ga0495672_0093098_119_448 109
353 3300047323 Ga0495683_0006643 Ga0495683_0006643_5473_5802 109
354 3300048907 Ga0496104_0112855 Ga0496104_0112855_469_798 109
355 3300048908 Ga0496105_0137242 Ga0496105_0137242_1391_1720 109
356 3300048909 Ga0496106_0100927 Ga0496106_0100927_148_477 109
357 3300048909 Ga0496106_0362471 Ga0496106_0362471_390_719 109
358 3300048911 Ga0496108_0002661 Ga0496108_0002661_13745_14074 109
359 3300048911 Ga0496108_0134286 Ga0496108_0134286_1167_1496 109
360 3300048912 Ga0496109_0002792 Ga0496109_0002792_13756_14085 109
361 3300048912 Ga0496109_0412546 Ga0496109_0412546_396_725 109
362 3300048913 Ga0496110_0041029 Ga0496110_0041029_3419_3748 109
363 3300048914 Ga0496111_0066590 Ga0496111_0066590_317_646 109
364 3300048915 Ga0496112_0000330 Ga0496112_0000330_374_703 109
365 3300048916 Ga0496113_0000113 Ga0496113_0000113_7799_8128 109
366 3300048917 Ga0496114_0153623 Ga0496114_0153623_374_703 109
367 3300048927 Ga0496124_0000308 Ga0496124_0000308_47552_47881 109
368 3300049663 Ga0501223_142009 Ga0501223_142009_85_414 109
369 3300049763 Ga0501266_008644 Ga0501266_008644_295_624 109
370 3300049824 Ga0501045_1068442 Ga0501045_1068442_24_353 109
371 3300049853 Ga0501226_022469 Ga0501226_022469_351_680 109
372 3300050509 nmdc:mga0qj67_1013327_c1 nmdc:mga0qj67_1013327_c1_267_596 109
373 3300050510 nmdc:mga06r32_905437_c1 nmdc:mga06r32_905437_c1_88_417 109
374 3300050512 nmdc:mga0n895_119474_c1 nmdc:mga0n895_119474_c1_1593_1922 109
375 3300053093 Ga0500651_0094147 Ga0500651_0094147_388_717 109
376 3300053096 Ga0500641_0150077 Ga0500641_0150077_605_934 109
377 3300046674 Ga0495588_0392253 Ga0495588_0392253_245_583 112
378 3300005546 Ga0070696_100353285 Ga0070696_1003532851 118
379 3300048905 Ga0496102_0089084 Ga0496102_0089084_1815_2198 121
380 3300048910 Ga0496107_0255755 Ga0496107_0255755_384_767 121
381 2162886007 SwRhRL2b_contig_1757691 SwRhRL2b_0988.00001830 122
382 3300009092 Ga0105250_10000326 Ga0105250_1000032612 122
383 3300013306 Ga0163162_10135015 Ga0163162_101350152 122
384 3300025921 Ga0207652_10266258 Ga0207652_102662583 122
385 3300046471 Ga0495650_0000016 Ga0495650_0000016_118860_119228 122
386 3300046810 Ga0495660_0000007 Ga0495660_0000007_75093_75461 122
387 3300048907 Ga0496104_0015892 Ga0496104_0015892_3302_3670 122
388 3300048907 Ga0496104_0296909 Ga0496104_0296909_702_1085 122
389 3300048908 Ga0496105_0125179 Ga0496105_0125179_337_720 122
390 3300048911 Ga0496108_0060920 Ga0496108_0060920_1388_1771 122
391 3300048912 Ga0496109_0011693 Ga0496109_0011693_4493_4876 122
392 3300048913 Ga0496110_0038016 Ga0496110_0038016_1963_2346 122
393 3300048914 Ga0496111_0245519 Ga0496111_0245519_325_708 122
394 3300048915 Ga0496112_0056191 Ga0496112_0056191_529_912 122
395 3300048916 Ga0496113_0328387 Ga0496113_0328387_31_414 122
396 3300048919 Ga0496116_0000127 Ga0496116_0000127_75079_75447 122
397 3300048920 Ga0496117_0009530 Ga0496117_0009530_972_1340 122
398 3300048921 Ga0496118_0000464 Ga0496118_0000464_61961_62329 122
399 3300048921 Ga0496118_0007304 Ga0496118_0007304_3203_3571 122
400 3300048922 Ga0496119_0008158 Ga0496119_0008158_2287_2655 122
401 3300048923 Ga0496120_0001260 Ga0496120_0001260_26740_27108 122
402 3300048925 Ga0496122_0000013 Ga0496122_0000013_123158_123526 122
403 3300048926 Ga0496123_0000010 Ga0496123_0000010_377514_377882 122
404 3300048927 Ga0496124_0000152 Ga0496124_0000152_138081_138449 122
405 3300048928 Ga0496125_0000019 Ga0496125_0000019_64879_65247 122
406 3300048929 Ga0496126_0000736 Ga0496126_0000736_29406_29774 122

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i45-assembly1.cif.gz_A crystal structure of protein nmb1881 from neisseria meningitidis 0.8549 43 122
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.8538 41 121
5i0u-assembly1.cif.gz_A incompletely interpreted d-cysteine soak of cysteine dioxygenase at ph 7.0 0.8532 41 121
4e2g-assembly3.cif.gz_E crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.8522 20 121
6u4l-assembly1.cif.gz_A cysteine dioxygenase variant - c93e 0.8519 41 121
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8612 43 121 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8569 41 121 2.60.120.10
1o5uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8507 55 120 2.60.120.10
3elnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.849 41 121 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8468 41 121 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A8B6KSK9-F1-model_v4 deleted 1.003 57 122
AF-F4MYE7-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 1.002 31 122
AF-A0A4Q5TGD2-F1-model_v4 ChrR-like cupin domain-containing protein 1 18 122
AF-A0A127Q2B0-F1-model_v4 Cupin domain protein 0.9996 17 122
AF-A0A176XVP2-F1-model_v4 DHCW motif cupin fold protein 0.999 14 122

Feature Viewer

pLDDT pTM Quality
91.21 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map