metagRoot

F436167

General Info

Members	Datasets	Scaffolds	Average Seq Length
406	242	405	127

Family's Representative Sequence

Representative Sequence	3300005937\|Ga0081455_10149944\|Ga0081455_101499441
Length	140
Sequence	VVAGKSIFPAVVMIARTATAQPATPNFRVGDERLVKLTANAGKKVGSLLTKQGRPNGVLRVAVVGGGCSGLQYKMDLQDGPANRDFLVESAGVKVVVDPKSALYVTGSELDYVEALQDGGFKVKNPNAATSCSCGESFSA

Samples

	Sample ID	Description	Type	Environment
1	2162886006	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	2786546548	Spartobacteria bacterium LR76	Isolate	Unclassified
4	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
5	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
6	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
7	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
8	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
9	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
10	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
11	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
12	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
13	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
14	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
15	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
16	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
17	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
18	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
19	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
20	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
21	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
22	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
23	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
24	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
25	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
26	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
27	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
28	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
29	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
30	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
31	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
32	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
35	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
36	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
37	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
38	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
39	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
40	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
41	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
42	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
43	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
44	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
45	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
46	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
47	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
48	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
49	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
50	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
51	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
52	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
53	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
54	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
55	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
56	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
57	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
58	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
59	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
60	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
61	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
62	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
63	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
64	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
65	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
66	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
67	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
68	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
69	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
70	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
71	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
73	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
74	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
75	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
76	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
77	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
78	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
79	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
80	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
81	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
82	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
83	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
84	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
85	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
86	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
87	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
88	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
89	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
90	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
91	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
132	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
134	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
135	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
136	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
137	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
138	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
139	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
140	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
141	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
142	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
143	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
144	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
145	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
146	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
147	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
148	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
149	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
150	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
151	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
152	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
153	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
154	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
155	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
156	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
157	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
158	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
159	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
160	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
161	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
162	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
163	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
164	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
165	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
166	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
167	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
168	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
169	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
170	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
171	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
172	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
173	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
174	3300042129	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95	Metagenome	Rhizosphere
175	3300042130	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97	Metagenome	Rhizosphere
176	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
177	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
178	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
179	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
180	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
181	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
182	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
183	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
184	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
185	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
186	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
187	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
188	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
189	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
190	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
191	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
192	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
193	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
194	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
195	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
196	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
197	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
198	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
199	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
200	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
201	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
202	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
203	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
204	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
205	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
206	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
207	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
208	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
209	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
210	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
211	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
212	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
213	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
214	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
215	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
216	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
217	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
218	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
219	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
220	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
221	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
223	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
224	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
225	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
226	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
227	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
228	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
229	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
230	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
231	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
232	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
233	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
234	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
235	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
236	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
237	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
238	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
239	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
240	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
241	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
242	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.75
Metatranscriptomes	0
Isolates	0.25

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.48
Nodule	0
Rhizoplane	2.96
Rhizosphere	93.1
Stem	0
Stem Tuber	0
Unclassified	2.46

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL3b_contig_1656878	2162886006	Unclassified	876
2	SwRhRL2b_contig_736758	2162886007	Unclassified	1615
3	JGI24746J21847_1000418	3300001977	Bacteria	6320
4	JGI24744J21845_10008989	3300002077	Bacteria	2053
5	rootH1_10174089	3300003316	Unclassified	1331
6	rootH2_10123692	3300003320	Bacteria	2736
7	rootL2_10271014	3300003322	Unclassified	1491
8	Ga0065714_10297068	3300005288	Bacteria	699
9	Ga0065704_10002826	3300005289	Unclassified	4648
10	Ga0065712_10235808	3300005290	Bacteria	998
11	Ga0065715_10167928	3300005293	Bacteria	1571
12	Ga0065707_10010793	3300005295	Bacteria	6416
13	Ga0065707_10017010	3300005295	Bacteria	1636
14	Ga0070658_10000920	3300005327	Bacteria	25141
15	Ga0070658_10033013	3300005327	Bacteria	4162
16	Ga0070683_100055196	3300005329	Bacteria	3686
17	Ga0070683_101222177	3300005329	Unclassified	722
18	Ga0070690_100733367	3300005330	Bacteria	761
19	Ga0068869_100303769	3300005334	Bacteria	1289
20	Ga0070680_100646213	3300005336	Bacteria	909
21	Ga0068868_102012301	3300005338	Unclassified	548
22	Ga0070689_100018038	3300005340	Bacteria	5192
23	Ga0070689_100020579	3300005340	Bacteria	4898
24	Ga0070689_100057048	3300005340	Bacteria	3030
25	Ga0070689_100220427	3300005340	Bacteria	1556
26	Ga0070689_100245793	3300005340	Bacteria	1475
27	Ga0070687_100651767	3300005343	Bacteria	730
28	Ga0070661_100007659	3300005344	Bacteria	7455
29	Ga0070692_10934335	3300005345	Bacteria	602
30	Ga0070668_100189657	3300005347	Unclassified	1683
31	Ga0070668_100262297	3300005347	Bacteria	1437
32	Ga0070668_100767913	3300005347	Unclassified	854
33	Ga0070675_100171353	3300005354	Unclassified	1872
34	Ga0070671_100172750	3300005355	Bacteria	1828
35	Ga0070674_100248562	3300005356	Unclassified	1396
36	Ga0070667_100699229	3300005367	Unclassified	938
37	Ga0070714_100004335	3300005435	Bacteria	10700
38	Ga0070714_101213984	3300005435	Bacteria	736
39	Ga0070713_100096785	3300005436	Bacteria	2549
40	Ga0070713_100210006	3300005436	Bacteria	1762
41	Ga0070713_101343022	3300005436	Unclassified	693
42	Ga0070713_102083470	3300005436	Unclassified	550
43	Ga0070711_100008874	3300005439	Bacteria	6169
44	Ga0070708_101560697	3300005445	Bacteria	615
45	Ga0070662_100052118	3300005457	Unclassified	2957
46	Ga0070662_100353516	3300005457	Bacteria	1204
47	Ga0070681_10248073	3300005458	Unclassified	1693
48	Ga0070681_10328011	3300005458	Bacteria	1440
49	Ga0070681_10568647	3300005458	Bacteria	1047
50	Ga0068867_100000214	3300005459	Bacteria	38574
51	Ga0070685_10086148	3300005466	Bacteria	1893
52	Ga0070698_101507149	3300005471	Unclassified	624
53	Ga0070679_100163492	3300005530	Bacteria	2200
54	Ga0070679_100452187	3300005530	Unclassified	1229
55	Ga0070684_100091988	3300005535	Bacteria	2699
56	Ga0070684_101358000	3300005535	Bacteria	669
57	Ga0070686_100004054	3300005544	Bacteria	8058
58	Ga0070686_100121598	3300005544	Bacteria	1793
59	Ga0070686_101152041	3300005544	Bacteria	642
60	Ga0070665_102345758	3300005548	Bacteria	536
61	Ga0070704_100474584	3300005549	Bacteria	1081
62	Ga0070704_100579248	3300005549	Bacteria	984
63	Ga0068855_100109797	3300005563	Bacteria	3167
64	Ga0068855_100290957	3300005563	Unclassified	1811
65	Ga0068855_100327189	3300005563	Bacteria	1693
66	Ga0068855_100756737	3300005563	Bacteria	1035
67	Ga0070664_100002500	3300005564	Bacteria	14824
68	Ga0068857_101544703	3300005577	Bacteria	647
69	Ga0068854_101452218	3300005578	Bacteria	621
70	Ga0068856_100264040	3300005614	Unclassified	1737
71	Ga0068856_101066425	3300005614	Unclassified	826
72	Ga0070702_100516073	3300005615	Unclassified	880
73	Ga0068859_100020088	3300005617	Bacteria	6706
74	Ga0068859_100792880	3300005617	Unclassified	1035
75	Ga0068859_101464182	3300005617	Bacteria	753
76	Ga0068864_100235235	3300005618	Bacteria	1695
77	Ga0068866_10025538	3300005718	Bacteria	2778
78	Ga0068861_102195636	3300005719	Unclassified	553
79	Ga0068863_100092001	3300005841	Unclassified	2877
80	Ga0068863_100966929	3300005841	Unclassified	853
81	Ga0068863_101858326	3300005841	Bacteria	612
82	Ga0068858_100322234	3300005842	Unclassified	1477
83	Ga0068860_100930463	3300005843	Bacteria	886
84	Ga0068862_100334990	3300005844	Bacteria	1400
85	Ga0068862_101581258	3300005844	Unclassified	662
86	Ga0081455_10149944	3300005937	Unclassified	1799
87	Ga0070716_100986628	3300006173	Unclassified	665
88	Ga0070712_100014127	3300006175	Bacteria	5121
89	Ga0075428_101070240	3300006844	Bacteria	852
90	Ga0075430_100493254	3300006846	Unclassified	1011
91	Ga0075431_100120740	3300006847	Bacteria	2704
92	Ga0075433_10927151	3300006852	Unclassified	759
93	Ga0075433_10950646	3300006852	Unclassified	749
94	Ga0075433_11475097	3300006852	Unclassified	588
95	Ga0075434_100087002	3300006871	Bacteria	3125
96	Ga0075434_100622564	3300006871	Bacteria	1098
97	Ga0075429_100021809	3300006880	Bacteria	5553
98	Ga0075429_100944729	3300006880	Bacteria	754
99	Ga0075429_101574156	3300006880	Unclassified	571
100	Ga0068865_100410009	3300006881	Bacteria	1112
101	Ga0075436_101273841	3300006914	Bacteria	556
102	Ga0097620_100020086	3300006931	Bacteria	6706
103	Ga0097620_100793111	3300006931	Unclassified	1035
104	Ga0097620_101464171	3300006931	Bacteria	753
105	Ga0097620_102175710	3300006931	Unclassified	612
106	Ga0075435_101232474	3300007076	Bacteria	655
107	Ga0105240_10347607	3300009093	Bacteria	1683
108	Ga0105240_10756669	3300009093	Bacteria	1056
109	Ga0105240_10797753	3300009093	Bacteria	1023
110	Ga0105240_11895175	3300009093	Unclassified	620
111	Ga0105240_12189798	3300009093	Unclassified	573
112	Ga0111539_10069487	3300009094	Unclassified	4159
113	Ga0111539_10807206	3300009094	Bacteria	1092
114	Ga0111539_12112028	3300009094	Bacteria	653
115	Ga0111539_12956061	3300009094	Unclassified	549
116	Ga0105243_11584382	3300009148	Bacteria	681
117	Ga0105243_11916767	3300009148	Bacteria	626
118	Ga0105242_10111485	3300009176	Bacteria	2333
119	Ga0105242_12092813	3300009176	Unclassified	610
120	Ga0105242_12273016	3300009176	Unclassified	588
121	Ga0105248_10237842	3300009177	Bacteria	2050
122	Ga0105248_10452616	3300009177	Bacteria	1446
123	Ga0105248_11552331	3300009177	Bacteria	750
124	Ga0105248_12595467	3300009177	Bacteria	578
125	Ga0105237_10457702	3300009545	Bacteria	1282
126	Ga0105238_10049243	3300009551	Bacteria	4244
127	Ga0105238_10158224	3300009551	Bacteria	2241
128	Ga0157373_10006336	3300013100	Bacteria	8840
129	Ga0157371_10699813	3300013102	Bacteria	758
130	Ga0157370_10001216	3300013104	Bacteria	32256
131	Ga0157370_10049618	3300013104	Bacteria	4016
132	Ga0157369_10435542	3300013105	Unclassified	1358
133	Ga0157374_10161069	3300013296	Bacteria	2186
134	Ga0157374_10194504	3300013296	Unclassified	1985
135	Ga0157374_10398810	3300013296	Unclassified	1372
136	Ga0157374_10987082	3300013296	Unclassified	861
137	Ga0157378_10229306	3300013297	Unclassified	1769
138	Ga0157378_10493364	3300013297	Bacteria	1222
139	Ga0157378_10566955	3300013297	Unclassified	1143
140	Ga0163162_11946012	3300013306	Unclassified	673
141	Ga0157372_10336593	3300013307	Bacteria	1758
142	Ga0157372_10415925	3300013307	Unclassified	1567
143	Ga0157372_10951449	3300013307	Unclassified	996
144	Ga0157372_11151925	3300013307	Bacteria	897
145	Ga0157375_10433606	3300013308	Bacteria	1480
146	Ga0157375_12343479	3300013308	Bacteria	637
147	Ga0157375_12723909	3300013308	Bacteria	591
148	Ga0163163_10951077	3300014325	Bacteria	922
149	Ga0157380_11244622	3300014326	Bacteria	789
150	Ga0157380_12536683	3300014326	Bacteria	578
151	Ga0157377_10107389	3300014745	Bacteria	1673
152	Ga0157376_10006639	3300014969	Bacteria	8191
153	Ga0157376_12338152	3300014969	Unclassified	574
154	Ga0157376_12725607	3300014969	Unclassified	534
155	Ga0163161_10099724	3300017792	Unclassified	2160
156	Ga0207642_10049284	3300025899	Bacteria	1893
157	Ga0207643_10369450	3300025908	Bacteria	903
158	Ga0207705_10006459	3300025909	Bacteria	8684
159	Ga0207705_10654152	3300025909	Bacteria	817
160	Ga0207654_10575307	3300025911	Unclassified	802
161	Ga0207707_10259604	3300025912	Bacteria	1508
162	Ga0207707_10560654	3300025912	Unclassified	970
163	Ga0207695_10290204	3300025913	Unclassified	1528
164	Ga0207695_10894731	3300025913	Bacteria	767
165	Ga0207695_11485302	3300025913	Unclassified	558
166	Ga0207671_10894086	3300025914	Unclassified	702
167	Ga0207693_10001095	3300025915	Bacteria	24368
168	Ga0207663_10065708	3300025916	Unclassified	2319
169	Ga0207657_10199503	3300025919	Bacteria	1610
170	Ga0207649_10006856	3300025920	Bacteria	6189
171	Ga0207652_10796379	3300025921	Unclassified	839
172	Ga0207652_11503501	3300025921	Unclassified	577
173	Ga0207681_10478457	3300025923	Unclassified	1017
174	Ga0207694_10012353	3300025924	Bacteria	6433
175	Ga0207650_10163139	3300025925	Bacteria	1767
176	Ga0207659_10335789	3300025926	Unclassified	1250
177	Ga0207687_10279403	3300025927	Bacteria	1338
178	Ga0207664_10064011	3300025929	Unclassified	2940
179	Ga0207706_10077057	3300025933	Unclassified	2932
180	Ga0207706_10371122	3300025933	Bacteria	1243
181	Ga0207686_10704842	3300025934	Bacteria	803
182	Ga0207709_10000303	3300025935	Bacteria	53696
183	Ga0207670_10090137	3300025936	Bacteria	2166
184	Ga0207670_10212632	3300025936	Unclassified	1476
185	Ga0207670_10221128	3300025936	Unclassified	1450
186	Ga0207670_10282299	3300025936	Bacteria	1294
187	Ga0207669_11479345	3300025937	Unclassified	579
188	Ga0207704_10069209	3300025938	Bacteria	2229
189	Ga0207665_10181385	3300025939	Unclassified	1525
190	Ga0207691_11123271	3300025940	Unclassified	653
191	Ga0207711_10431231	3300025941	Unclassified	1226
192	Ga0207711_10729976	3300025941	Unclassified	924
193	Ga0207689_10214380	3300025942	Bacteria	1591
194	Ga0207661_10184924	3300025944	Bacteria	1823
195	Ga0207679_10005566	3300025945	Bacteria	7896
196	Ga0207667_10153318	3300025949	Unclassified	2371
197	Ga0207667_10263497	3300025949	Bacteria	1762
198	Ga0207667_11697797	3300025949	Unclassified	598
199	Ga0207668_10205018	3300025972	Bacteria	1573
200	Ga0207668_11307819	3300025972	Unclassified	653
201	Ga0207640_11374681	3300025981	Bacteria	632
202	Ga0207639_10874220	3300026041	Unclassified	840
203	Ga0207702_10077738	3300026078	Bacteria	2871
204	Ga0207702_10175237	3300026078	Bacteria	1970
205	Ga0207702_10813285	3300026078	Unclassified	924
206	Ga0207702_10818480	3300026078	Bacteria	921
207	Ga0207702_10985204	3300026078	Bacteria	836
208	Ga0207641_10291124	3300026088	Unclassified	1539
209	Ga0207641_11474840	3300026088	Bacteria	682
210	Ga0207641_11586369	3300026088	Unclassified	656
211	Ga0207648_10001846	3300026089	Bacteria	23181
212	Ga0207648_10646951	3300026089	Bacteria	977
213	Ga0207676_10259651	3300026095	Bacteria	1568
214	Ga0207674_10343510	3300026116	Bacteria	1443
215	Ga0207674_11178922	3300026116	Bacteria	735
216	Ga0207674_12221792	3300026116	Bacteria	511
217	Ga0207698_11919565	3300026142	Unclassified	607
218	Ga0207698_12647386	3300026142	Bacteria	511
219	Ga0207428_11218550	3300027907	Unclassified	523
220	Ga0268264_11080668	3300028381	Bacteria	810
221	Ga0265326_10001651	3300028558	Bacteria	7724
222	Ga0265326_10167169	3300028558	Bacteria	629
223	Ga0265334_10010947	3300028573	Bacteria	3827
224	Ga0265336_10040355	3300028666	Unclassified	1429
225	Ga0265338_10000398	3300028800	Bacteria	77989
226	Ga0265338_10000867	3300028800	Bacteria	51308
227	Ga0265338_10005211	3300028800	Bacteria	17052
228	Ga0265338_10008627	3300028800	Bacteria	12329
229	Ga0265338_10018923	3300028800	Bacteria	7342
230	Ga0265338_10045355	3300028800	Bacteria	4044
231	Ga0265338_10059393	3300028800	Bacteria	3369
232	Ga0265338_10060515	3300028800	Unclassified	3327
233	Ga0265338_10065775	3300028800	Unclassified	3142
234	Ga0265338_10089825	3300028800	Bacteria	2545
235	Ga0265338_10096920	3300028800	Unclassified	2418
236	Ga0265338_10133285	3300028800	Bacteria	1957
237	Ga0265338_10194943	3300028800	Bacteria	1532
238	Ga0265338_10524603	3300028800	Unclassified	832
239	Ga0265338_10666099	3300028800	Unclassified	720
240	Ga0265324_10000113	3300029957	Bacteria	64194
241	Ga0265324_10016199	3300029957	Bacteria	2728
242	Ga0265324_10117311	3300029957	Unclassified	904
243	Ga0265320_10131479	3300031240	Unclassified	1137
244	Ga0265320_10170809	3300031240	Unclassified	977
245	Ga0265320_10481918	3300031240	Unclassified	548
246	Ga0265340_10343154	3300031247	Bacteria	660
247	Ga0265339_10007123	3300031249	Bacteria	7261
248	Ga0265339_10064576	3300031249	Bacteria	1964
249	Ga0265331_10029671	3300031250	Bacteria	2728
250	Ga0265331_10061608	3300031250	Unclassified	1771
251	Ga0265331_10590774	3300031250	Unclassified	501
252	Ga0265327_10002176	3300031251	Bacteria	21557
253	Ga0265327_10014798	3300031251	Bacteria	5080
254	Ga0265327_10051718	3300031251	Bacteria	2143
255	Ga0265327_10063807	3300031251	Unclassified	1869
256	Ga0265327_10078086	3300031251	Bacteria	1641
257	Ga0265316_10849218	3300031344	Unclassified	639
258	Ga0265316_11023739	3300031344	Unclassified	574
259	Ga0307509_10549293	3300031507	Unclassified	833
260	Ga0307408_100021738	3300031548	Bacteria	4346
261	Ga0307408_100108089	3300031548	Bacteria	2131
262	Ga0307408_101781254	3300031548	Unclassified	588
263	Ga0265313_10257958	3300031595	Unclassified	709
264	Ga0265314_10000140	3300031711	Bacteria	108620
265	Ga0265314_10097732	3300031711	Unclassified	1896
266	Ga0265314_10101221	3300031711	Bacteria	1852
267	Ga0265314_10155385	3300031711	Bacteria	1398
268	Ga0265314_10183332	3300031711	Unclassified	1252
269	Ga0265342_10038143	3300031712	Bacteria	2928
270	Ga0307405_10193349	3300031731	Bacteria	1471
271	Ga0307413_10111080	3300031824	Bacteria	1835
272	Ga0307410_10055030	3300031852	Bacteria	2700
273	Ga0307406_10000613	3300031901	Bacteria	20386
274	Ga0307407_10000218	3300031903	Bacteria	17226
275	Ga0307412_10000127	3300031911	Bacteria	56113
276	Ga0307412_10086209	3300031911	Bacteria	2185
277	Ga0307416_100018135	3300032002	Bacteria	4950
278	Ga0307416_100027344	3300032002	Bacteria	4222
279	Ga0307416_100276856	3300032002	Bacteria	1652
280	Ga0307416_101709254	3300032002	Bacteria	734
281	Ga0307414_10000036	3300032004	Bacteria	166533
282	Ga0307414_10051334	3300032004	Bacteria	2862
283	Ga0307414_10275784	3300032004	Bacteria	1411
284	Ga0307411_10381228	3300032005	Bacteria	1160
285	Ga0373926_0056452	3300035083	Bacteria	1425
286	Ga0373945_0304723	3300035116	Unclassified	683
287	Ga0373946_0070381	3300035171	Bacteria	1510
288	Ga0373946_0156072	3300035171	Unclassified	1068
289	Ga0373931_0201535	3300035691	Bacteria	1189
290	Ga0373935_0008525	3300035692	Bacteria	6136
291	Ga0373927_0011142	3300035695	Bacteria	5989
292	Ga0373927_0588456	3300035695	Unclassified	735
293	Ga0373933_0811556	3300035724	Bacteria	616
294	Ga0373947_0064318	3300035725	Bacteria	2237
295	Ga0373937_0072675	3300036401	Bacteria	3173
296	Ga0373937_0134064	3300036401	Bacteria	2315
297	Ga0373937_0325300	3300036401	Unclassified	1455
298	Ga0373925_0021146	3300037068	Bacteria	4740
299	Ga0395900_0069039	3300037418	Bacteria	3632
300	Ga0395898_0264522	3300037466	Bacteria	1640
301	Ga0395905_0054165	3300037471	Unclassified	3754
302	Ga0395905_0395385	3300037471	Unclassified	1277
303	Ga0395901_0315871	3300038443	Unclassified	1617
304	Ga0450888_005425	3300042126	Bacteria	1360
305	Ga0450890_000103	3300042127	Bacteria	14138
306	Ga0450891_001205	3300042129	Bacteria	2691
307	Ga0450892_000119	3300042130	Bacteria	9000
308	Ga0450918_024014	3300042531	Bacteria	1066
309	Ga0451577_0007931	3300042876	Bacteria	10375
310	Ga0451577_0015980	3300042876	Bacteria	6965
311	Ga0451577_0277658	3300042876	Bacteria	1518
312	Ga0451577_1979823	3300042876	Unclassified	509
313	Ga0453684_0007437	3300044712	Bacteria	20139
314	Ga0453684_0080141	3300044712	Unclassified	4078
315	Ga0453684_0571533	3300044712	Bacteria	1243
316	Ga0453684_0610699	3300044712	Bacteria	1194
317	Ga0453684_1005841	3300044712	Unclassified	886
318	Ga0453684_1521332	3300044712	Bacteria	690
319	Ga0453684_2186465	3300044712	Unclassified	553
320	Ga0451576_0029509	3300045051	Bacteria	5868
321	Ga0451576_0128496	3300045051	Bacteria	2641
322	Ga0451576_0132631	3300045051	Bacteria	2597
323	Ga0451576_0686035	3300045051	Bacteria	1076
324	Ga0451576_1891160	3300045051	Unclassified	616
325	Ga0495641_0025042	3300046461	Bacteria	2933
326	Ga0495662_0188402	3300046476	Bacteria	1017
327	Ga0495584_0103463	3300046491	Unclassified	1440
328	Ga0495583_0282156	3300046506	Unclassified	662
329	Ga0495608_0570116	3300046511	Unclassified	681
330	Ga0495630_0006529	3300046517	Bacteria	8307
331	Ga0495630_0207410	3300046517	Bacteria	1496
332	Ga0495630_0925811	3300046517	Bacteria	663
333	Ga0495632_0229900	3300046519	Unclassified	837
334	Ga0495666_0180798	3300046526	Bacteria	974
335	Ga0495642_0007963	3300046528	Unclassified	4055
336	Ga0495640_0369794	3300046533	Bacteria	883
337	Ga0495586_0011327	3300046535	Bacteria	4742
338	Ga0495586_0258930	3300046535	Bacteria	993
339	Ga0495587_0198608	3300046536	Unclassified	1135
340	Ga0495667_0016397	3300046559	Bacteria	5007
341	Ga0495659_0440379	3300046664	Bacteria	566
342	Ga0495646_0126165	3300046680	Unclassified	1444
343	Ga0495647_0002896	3300046681	Bacteria	5447
344	Ga0495647_0071347	3300046681	Bacteria	1391
345	Ga0495658_0006382	3300046683	Bacteria	5792
346	Ga0495658_0020786	3300046683	Bacteria	3451
347	Ga0495658_0462076	3300046683	Bacteria	811
348	Ga0495669_0008615	3300046684	Unclassified	4292
349	Ga0495669_0358123	3300046684	Unclassified	705
350	Ga0495613_0488963	3300046689	Bacteria	830
351	Ga0495674_1184090	3300047319	Bacteria	578
352	Ga0495676_0302993	3300047321	Bacteria	1077
353	Ga0495680_0464978	3300047322	Bacteria	864
354	Ga0495677_0063682	3300047445	Unclassified	1370
355	Ga0495681_0309030	3300047470	Unclassified	610
356	Ga0495684_0741991	3300047471	Unclassified	647
357	Ga0496100_0873729	3300048903	Unclassified	706
358	Ga0496101_1341449	3300048904	Unclassified	559
359	Ga0496102_0703107	3300048905	Unclassified	934
360	Ga0496104_0907859	3300048907	Unclassified	786
361	Ga0496105_0203693	3300048908	Unclassified	1615
362	Ga0496106_0067575	3300048909	Unclassified	2725
363	Ga0496108_0073128	3300048911	Unclassified	2895
364	Ga0496109_0347977	3300048912	Bacteria	1400
365	Ga0496110_0107289	3300048913	Unclassified	2507
366	Ga0496112_0536451	3300048915	Bacteria	1104
367	Ga0496115_0074335	3300048918	Bacteria	2759
368	Ga0496115_0548686	3300048918	Unclassified	924
369	Ga0496121_0049965	3300048924	Bacteria	3539
370	Ga0496122_0258827	3300048925	Bacteria	967
371	Ga0496124_0209956	3300048927	Unclassified	1474
372	Ga0496125_0000147	3300048928	Bacteria	154731
373	Ga0496125_0304578	3300048928	Bacteria	974
374	Ga0501032_0005511	3300049569	Bacteria	9390
375	Ga0501033_0017293	3300049570	Bacteria	5449
376	Ga0501034_0050094	3300049571	Bacteria	4213
377	Ga0501034_0898712	3300049571	Bacteria	774
378	Ga0501034_0939019	3300049571	Bacteria	751
379	Ga0501043_0244513	3300049579	Bacteria	1383
380	Ga0501070_0294847	3300049586	Bacteria	1322
381	Ga0501073_0131587	3300049589	Bacteria	1734
382	Ga0501227_000108	3300049665	Bacteria	14021
383	Ga0501083_0016403	3300049744	Bacteria	5185
384	Ga0501083_0514481	3300049744	Unclassified	779
385	Ga0501044_1122943	3300049823	Bacteria	655
386	nmdc:mga07m45_439655_c1	3300050496	Bacteria	756
387	nmdc:mga09592_1002488_c1	3300050508	Bacteria	698
388	nmdc:mga09592_239658_c1	3300050508	Unclassified	1571
389	nmdc:mga0qj67_471159_c1	3300050509	Unclassified	1011
390	nmdc:mga06r32_71369_c1	3300050510	Bacteria	3360
391	nmdc:mga08y16_1419590_c1	3300050511	Bacteria	657
392	nmdc:mga08y16_269677_c1	3300050511	Bacteria	1757
393	nmdc:mga0n895_1499886_c1	3300050512	Bacteria	640
394	nmdc:mga0n895_565984_c1	3300050512	Bacteria	1141
395	nmdc:mga0n895_736521_c1	3300050512	Unclassified	980
396	nmdc:mga0n895_76276_c1	3300050512	Unclassified	3333
397	nmdc:mga08x19_1035845_c1	3300050514	Unclassified	583
398	Ga0495655_0001034	3300053083	Unclassified	4297
399	Ga0495619_0200119	3300053085	Unclassified	1383
400	Ga0500650_0399259	3300053098	Unclassified	595
401	Ga0500559_0004693	3300053136	Bacteria	6436
402	Ga0500559_0038296	3300053136	Bacteria	2082
403	Ga0500616_0025920	3300053153	Unclassified	3250
404	Ga0500627_0160021	3300053158	Bacteria	1016
405	Ga0501082_1456520	3300060353	Unclassified	598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300026089	Ga0207648_10646951	Ga0207648_106469512	108
2	3300005340	Ga0070689_100020579	Ga0070689_1000205794	112
3	3300005466	Ga0070685_10086148	Ga0070685_100861483	112
4	3300006880	Ga0075429_100021809	Ga0075429_1000218098	112
5	3300031903	Ga0307407_10000218	Ga0307407_1000021811	116
6	3300032002	Ga0307416_100027344	Ga0307416_1000273443	116
7	3300048924	Ga0496121_0049965	Ga0496121_0049965_2898_3251	117
8	3300048927	Ga0496124_0209956	Ga0496124_0209956_129_482	117
9	3300048928	Ga0496125_0000147	Ga0496125_0000147_53563_53916	117
10	iso_pu_bacteria	2786546548	2787508205	117
11	3300042876	Ga0451577_0007931	Ga0451577_0007931_5402_5770	118
12	3300006846	Ga0075430_100493254	Ga0075430_1004932542	119
13	3300006847	Ga0075431_100120740	Ga0075431_1001207404	119
14	3300006880	Ga0075429_101574156	Ga0075429_1015741561	119
15	3300007076	Ga0075435_101232474	Ga0075435_1012324741	119
16	3300009094	Ga0111539_10069487	Ga0111539_100694872	119
17	3300027907	Ga0207428_11218550	Ga0207428_112185501	119
18	3300037418	Ga0395900_0069039	Ga0395900_0069039_1275_1634	119
19	3300037466	Ga0395898_0264522	Ga0395898_0264522_830_1189	119
20	3300038443	Ga0395901_0315871	Ga0395901_0315871_963_1322	119
21	3300046664	Ga0495659_0440379	Ga0495659_0440379_63_422	119
22	3300050508	nmdc:mga09592_239658_c1	nmdc:mga09592_239658_c1_1006_1365	119
23	3300050509	nmdc:mga0qj67_471159_c1	nmdc:mga0qj67_471159_c1_623_982	119
24	3300050511	nmdc:mga08y16_269677_c1	nmdc:mga08y16_269677_c1_1254_1613	119
25	3300002077	JGI24744J21845_10008989	JGI24744J21845_100089893	120
26	3300005288	Ga0065714_10297068	Ga0065714_102970681	120
27	3300005327	Ga0070658_10000920	Ga0070658_1000092020	120
28	3300013100	Ga0157373_10006336	Ga0157373_100063367	120
29	3300013104	Ga0157370_10001216	Ga0157370_100012164	120
30	3300014326	Ga0157380_12536683	Ga0157380_125366831	120
31	3300025909	Ga0207705_10006459	Ga0207705_100064594	120
32	3300048925	Ga0496122_0258827	Ga0496122_0258827_188_550	120
33	3300053136	Ga0500559_0038296	Ga0500559_0038296_486_848	120
34	3300001977	JGI24746J21847_1000418	JGI24746J21847_10004186	121
35	3300005290	Ga0065712_10235808	Ga0065712_102358081	121
36	3300005334	Ga0068869_100303769	Ga0068869_1003037692	121
37	3300005344	Ga0070661_100007659	Ga0070661_1000076595	121
38	3300005459	Ga0068867_100000214	Ga0068867_10000021416	121
39	3300005564	Ga0070664_100002500	Ga0070664_10000250016	121
40	3300005577	Ga0068857_101544703	Ga0068857_1015447032	121
41	3300005578	Ga0068854_101452218	Ga0068854_1014522181	121
42	3300005718	Ga0068866_10025538	Ga0068866_100255383	121
43	3300013102	Ga0157371_10699813	Ga0157371_106998132	121
44	3300013307	Ga0157372_10336593	Ga0157372_103365931	121
45	3300014969	Ga0157376_10006639	Ga0157376_100066393	121
46	3300025899	Ga0207642_10049284	Ga0207642_100492843	121
47	3300025908	Ga0207643_10369450	Ga0207643_103694502	121
48	3300025920	Ga0207649_10006856	Ga0207649_100068565	121
49	3300025927	Ga0207687_10279403	Ga0207687_102794031	121
50	3300025935	Ga0207709_10000303	Ga0207709_1000030321	121
51	3300025938	Ga0207704_10069209	Ga0207704_100692093	121
52	3300025942	Ga0207689_10214380	Ga0207689_102143803	121
53	3300025945	Ga0207679_10005566	Ga0207679_100055665	121
54	3300025981	Ga0207640_11374681	Ga0207640_113746812	121
55	3300026089	Ga0207648_10001846	Ga0207648_100018465	121
56	3300026116	Ga0207674_11178922	Ga0207674_111789222	121
57	3300031250	Ga0265331_10029671	Ga0265331_100296712	121
58	3300031251	Ga0265327_10002176	Ga0265327_100021762	121
59	3300031548	Ga0307408_100021738	Ga0307408_1000217384	121
60	3300031548	Ga0307408_100108089	Ga0307408_1001080894	121
61	3300031731	Ga0307405_10193349	Ga0307405_101933492	121
62	3300031824	Ga0307413_10111080	Ga0307413_101110803	121
63	3300031852	Ga0307410_10055030	Ga0307410_100550304	121
64	3300031901	Ga0307406_10000613	Ga0307406_100006134	121
65	3300031911	Ga0307412_10000127	Ga0307412_1000012725	121
66	3300032002	Ga0307416_100018135	Ga0307416_1000181354	121
67	3300032002	Ga0307416_101709254	Ga0307416_1017092542	121
68	3300032004	Ga0307414_10051334	Ga0307414_100513344	121
69	3300032004	Ga0307414_10275784	Ga0307414_102757841	121
70	3300042126	Ga0450888_005425	Ga0450888_005425_112_477	121
71	3300042127	Ga0450890_000103	Ga0450890_000103_5894_6259	121
72	3300042129	Ga0450891_001205	Ga0450891_001205_786_1151	121
73	3300042130	Ga0450892_000119	Ga0450892_000119_2789_3154	121
74	3300042531	Ga0450918_024014	Ga0450918_024014_442_807	121
75	3300048928	Ga0496125_0304578	Ga0496125_0304578_398_763	121
76	3300049569	Ga0501032_0005511	Ga0501032_0005511_8286_8651	121
77	3300049571	Ga0501034_0898712	Ga0501034_0898712_17_382	121
78	3300049665	Ga0501227_000108	Ga0501227_000108_6546_6911	121
79	3300050496	nmdc:mga07m45_439655_c1	nmdc:mga07m45_439655_c1_11_376	121
80	3300053136	Ga0500559_0004693	Ga0500559_0004693_1873_2238	121
81	3300053158	Ga0500627_0160021	Ga0500627_0160021_16_381	121
82	3300005347	Ga0070668_100262297	Ga0070668_1002622972	122
83	3300005355	Ga0070671_100172750	Ga0070671_1001727503	122
84	3300005719	Ga0068861_102195636	Ga0068861_1021956361	122
85	3300006871	Ga0075434_100622564	Ga0075434_1006225642	122
86	3300025972	Ga0207668_10205018	Ga0207668_102050182	122
87	3300026088	Ga0207641_11586369	Ga0207641_115863692	122
88	3300028800	Ga0265338_10008627	Ga0265338_100086279	122
89	3300028800	Ga0265338_10666099	Ga0265338_106660992	122
90	3300031240	Ga0265320_10481918	Ga0265320_104819181	122
91	3300032004	Ga0307414_10000036	Ga0307414_1000003637	122
92	3300049589	Ga0501073_0131587	Ga0501073_0131587_160_534	122
93	3300050510	nmdc:mga06r32_71369_c1	nmdc:mga06r32_71369_c1_2048_2416	122
94	3300050512	nmdc:mga0n895_565984_c1	nmdc:mga0n895_565984_c1_608_985	122
95	3300005295	Ga0065707_10017010	Ga0065707_100170101	123
96	3300026078	Ga0207702_10818480	Ga0207702_108184801	123
97	3300028800	Ga0265338_10065775	Ga0265338_100657752	123
98	3300049744	Ga0501083_0016403	Ga0501083_0016403_3685_4056	123
99	3300060353	Ga0501082_1456520	Ga0501082_1456520_136_507	123
100	3300025940	Ga0207691_11123271	Ga0207691_111232712	124
101	3300003316	rootH1_10174089	rootH1_101740892	126
102	3300005327	Ga0070658_10033013	Ga0070658_100330134	126
103	3300005329	Ga0070683_100055196	Ga0070683_1000551961	126
104	3300005330	Ga0070690_100733367	Ga0070690_1007333671	126
105	3300005336	Ga0070680_100646213	Ga0070680_1006462131	126
106	3300005340	Ga0070689_100057048	Ga0070689_1000570482	126
107	3300005354	Ga0070675_100171353	Ga0070675_1001713532	126
108	3300005435	Ga0070714_100004335	Ga0070714_10000433511	126
109	3300005435	Ga0070714_101213984	Ga0070714_1012139842	126
110	3300005436	Ga0070713_100210006	Ga0070713_1002100063	126
111	3300005436	Ga0070713_101343022	Ga0070713_1013430222	126
112	3300005436	Ga0070713_102083470	Ga0070713_1020834701	126
113	3300005457	Ga0070662_100353516	Ga0070662_1003535161	126
114	3300005458	Ga0070681_10248073	Ga0070681_102480731	126
115	3300005458	Ga0070681_10328011	Ga0070681_103280112	126
116	3300005530	Ga0070679_100163492	Ga0070679_1001634922	126
117	3300005530	Ga0070679_100452187	Ga0070679_1004521871	126
118	3300005535	Ga0070684_100091988	Ga0070684_1000919882	126
119	3300005563	Ga0068855_100109797	Ga0068855_1001097972	126
120	3300005563	Ga0068855_100290957	Ga0068855_1002909572	126
121	3300005563	Ga0068855_100756737	Ga0068855_1007567372	126
122	3300005615	Ga0070702_100516073	Ga0070702_1005160731	126
123	3300005617	Ga0068859_100792880	Ga0068859_1007928802	126
124	3300005842	Ga0068858_100322234	Ga0068858_1003222343	126
125	3300006931	Ga0097620_100793111	Ga0097620_1007931112	126
126	3300009093	Ga0105240_10797753	Ga0105240_107977532	126
127	3300009093	Ga0105240_11895175	Ga0105240_118951752	126
128	3300009093	Ga0105240_12189798	Ga0105240_121897981	126
129	3300009176	Ga0105242_10111485	Ga0105242_101114852	126
130	3300009176	Ga0105242_12092813	Ga0105242_120928132	126
131	3300009177	Ga0105248_12595467	Ga0105248_125954671	126
132	3300009551	Ga0105238_10158224	Ga0105238_101582241	126
133	3300013104	Ga0157370_10049618	Ga0157370_100496181	126
134	3300013105	Ga0157369_10435542	Ga0157369_104355422	126
135	3300013296	Ga0157374_10161069	Ga0157374_101610692	126
136	3300013296	Ga0157374_10987082	Ga0157374_109870822	126
137	3300013297	Ga0157378_10229306	Ga0157378_102293063	126
138	3300013307	Ga0157372_10951449	Ga0157372_109514492	126
139	3300013307	Ga0157372_11151925	Ga0157372_111519251	126
140	3300014745	Ga0157377_10107389	Ga0157377_101073892	126
141	3300014969	Ga0157376_12338152	Ga0157376_123381522	126
142	3300025909	Ga0207705_10654152	Ga0207705_106541521	126
143	3300025911	Ga0207654_10575307	Ga0207654_105753071	126
144	3300025912	Ga0207707_10259604	Ga0207707_102596042	126
145	3300025912	Ga0207707_10560654	Ga0207707_105606542	126
146	3300025913	Ga0207695_10894731	Ga0207695_108947311	126
147	3300025913	Ga0207695_11485302	Ga0207695_114853021	126
148	3300025919	Ga0207657_10199503	Ga0207657_101995032	126
149	3300025921	Ga0207652_10796379	Ga0207652_107963791	126
150	3300025921	Ga0207652_11503501	Ga0207652_115035012	126
151	3300025926	Ga0207659_10335789	Ga0207659_103357892	126
152	3300025929	Ga0207664_10064011	Ga0207664_100640113	126
153	3300025933	Ga0207706_10371122	Ga0207706_103711222	126
154	3300025934	Ga0207686_10704842	Ga0207686_107048422	126
155	3300025936	Ga0207670_10212632	Ga0207670_102126322	126
156	3300025944	Ga0207661_10184924	Ga0207661_101849242	126
157	3300025949	Ga0207667_10153318	Ga0207667_101533182	126
158	3300025949	Ga0207667_10263497	Ga0207667_102634971	126
159	3300025949	Ga0207667_11697797	Ga0207667_116977971	126
160	3300026041	Ga0207639_10874220	Ga0207639_108742202	126
161	3300026078	Ga0207702_10077738	Ga0207702_100777383	126
162	3300026116	Ga0207674_12221792	Ga0207674_122217921	126
163	3300026142	Ga0207698_11919565	Ga0207698_119195652	126
164	3300028573	Ga0265334_10010947	Ga0265334_100109474	126
165	3300028800	Ga0265338_10005211	Ga0265338_100052112	126
166	3300028800	Ga0265338_10045355	Ga0265338_100453554	126
167	3300028800	Ga0265338_10060515	Ga0265338_100605152	126
168	3300028800	Ga0265338_10133285	Ga0265338_101332852	126
169	3300028800	Ga0265338_10524603	Ga0265338_105246032	126
170	3300031240	Ga0265320_10131479	Ga0265320_101314792	126
171	3300031240	Ga0265320_10170809	Ga0265320_101708092	126
172	3300031507	Ga0307509_10549293	Ga0307509_105492932	126
173	3300031711	Ga0265314_10000140	Ga0265314_1000014029	126
174	3300035083	Ga0373926_0056452	Ga0373926_0056452_979_1362	126
175	3300035691	Ga0373931_0201535	Ga0373931_0201535_705_1088	126
176	3300035692	Ga0373935_0008525	Ga0373935_0008525_1090_1473	126
177	3300035695	Ga0373927_0011142	Ga0373927_0011142_2467_2850	126
178	3300035725	Ga0373947_0064318	Ga0373947_0064318_729_1112	126
179	3300036401	Ga0373937_0072675	Ga0373937_0072675_2731_3114	126
180	3300037068	Ga0373925_0021146	Ga0373925_0021146_1534_1917	126
181	3300044712	Ga0453684_0007437	Ga0453684_0007437_14259_14642	126
182	3300045051	Ga0451576_0029509	Ga0451576_0029509_206_592	126
183	3300045051	Ga0451576_0128496	Ga0451576_0128496_2014_2415	126
184	3300046461	Ga0495641_0025042	Ga0495641_0025042_1310_1693	126
185	3300046526	Ga0495666_0180798	Ga0495666_0180798_99_482	126
186	3300046535	Ga0495586_0011327	Ga0495586_0011327_1702_2085	126
187	3300046681	Ga0495647_0002896	Ga0495647_0002896_1355_1738	126
188	3300046681	Ga0495647_0071347	Ga0495647_0071347_156_539	126
189	3300046683	Ga0495658_0006382	Ga0495658_0006382_986_1369	126
190	3300046684	Ga0495669_0358123	Ga0495669_0358123_117_500	126
191	3300047321	Ga0495676_0302993	Ga0495676_0302993_634_1017	126
192	3300048908	Ga0496105_0203693	Ga0496105_0203693_726_1106	126
193	3300048911	Ga0496108_0073128	Ga0496108_0073128_892_1272	126
194	3300048912	Ga0496109_0347977	Ga0496109_0347977_929_1309	126
195	3300048913	Ga0496110_0107289	Ga0496110_0107289_1414_1794	126
196	3300048915	Ga0496112_0536451	Ga0496112_0536451_225_605	126
197	3300048918	Ga0496115_0074335	Ga0496115_0074335_1268_1651	126
198	3300048918	Ga0496115_0548686	Ga0496115_0548686_31_414	126
199	3300049570	Ga0501033_0017293	Ga0501033_0017293_592_975	126
200	3300049586	Ga0501070_0294847	Ga0501070_0294847_567_950	126
201	3300053098	Ga0500650_0399259	Ga0500650_0399259_38_421	126
202	3300053153	Ga0500616_0025920	Ga0500616_0025920_1714_2103	126
203	3300005293	Ga0065715_10167928	Ga0065715_101679282	127
204	3300005329	Ga0070683_101222177	Ga0070683_1012221771	127
205	3300005338	Ga0068868_102012301	Ga0068868_1020123011	127
206	3300005340	Ga0070689_100018038	Ga0070689_1000180382	127
207	3300005340	Ga0070689_100220427	Ga0070689_1002204273	127
208	3300005340	Ga0070689_100245793	Ga0070689_1002457932	127
209	3300005343	Ga0070687_100651767	Ga0070687_1006517672	127
210	3300005345	Ga0070692_10934335	Ga0070692_109343351	127
211	3300005445	Ga0070708_101560697	Ga0070708_1015606971	127
212	3300005458	Ga0070681_10568647	Ga0070681_105686472	127
213	3300005471	Ga0070698_101507149	Ga0070698_1015071491	127
214	3300005535	Ga0070684_101358000	Ga0070684_1013580001	127
215	3300005544	Ga0070686_100004054	Ga0070686_1000040541	127
216	3300005544	Ga0070686_100121598	Ga0070686_1001215981	127
217	3300005544	Ga0070686_101152041	Ga0070686_1011520411	127
218	3300005549	Ga0070704_100474584	Ga0070704_1004745842	127
219	3300005549	Ga0070704_100579248	Ga0070704_1005792482	127
220	3300005563	Ga0068855_100327189	Ga0068855_1003271893	127
221	3300005614	Ga0068856_100264040	Ga0068856_1002640402	127
222	3300005617	Ga0068859_100020088	Ga0068859_1000200884	127
223	3300005617	Ga0068859_101464182	Ga0068859_1014641821	127
224	3300005618	Ga0068864_100235235	Ga0068864_1002352352	127
225	3300005841	Ga0068863_100092001	Ga0068863_1000920015	127
226	3300005841	Ga0068863_100966929	Ga0068863_1009669292	127
227	3300005841	Ga0068863_101858326	Ga0068863_1018583261	127
228	3300005843	Ga0068860_100930463	Ga0068860_1009304631	127
229	3300005844	Ga0068862_101581258	Ga0068862_1015812581	127
230	3300005937	Ga0081455_10149944	Ga0081455_101499441	127
231	3300006173	Ga0070716_100986628	Ga0070716_1009866281	127
232	3300006852	Ga0075433_10927151	Ga0075433_109271512	127
233	3300006852	Ga0075433_11475097	Ga0075433_114750971	127
234	3300006880	Ga0075429_100944729	Ga0075429_1009447292	127
235	3300006881	Ga0068865_100410009	Ga0068865_1004100092	127
236	3300006931	Ga0097620_100020086	Ga0097620_1000200864	127
237	3300006931	Ga0097620_101464171	Ga0097620_1014641711	127
238	3300009093	Ga0105240_10756669	Ga0105240_107566692	127
239	3300009094	Ga0111539_10807206	Ga0111539_108072062	127
240	3300009094	Ga0111539_12956061	Ga0111539_129560612	127
241	3300009148	Ga0105243_11584382	Ga0105243_115843822	127
242	3300009176	Ga0105242_12273016	Ga0105242_122730162	127
243	3300009177	Ga0105248_10237842	Ga0105248_102378422	127
244	3300009177	Ga0105248_10452616	Ga0105248_104526161	127
245	3300009177	Ga0105248_11552331	Ga0105248_115523312	127
246	3300009545	Ga0105237_10457702	Ga0105237_104577021	127
247	3300009551	Ga0105238_10049243	Ga0105238_100492433	127
248	3300013296	Ga0157374_10194504	Ga0157374_101945042	127
249	3300013297	Ga0157378_10493364	Ga0157378_104933642	127
250	3300013308	Ga0157375_12343479	Ga0157375_123434792	127
251	3300013308	Ga0157375_12723909	Ga0157375_127239092	127
252	3300014325	Ga0163163_10951077	Ga0163163_109510771	127
253	3300014326	Ga0157380_11244622	Ga0157380_112446222	127
254	3300014969	Ga0157376_12725607	Ga0157376_127256072	127
255	3300025913	Ga0207695_10290204	Ga0207695_102902043	127
256	3300025914	Ga0207671_10894086	Ga0207671_108940861	127
257	3300025924	Ga0207694_10012353	Ga0207694_100123536	127
258	3300025936	Ga0207670_10090137	Ga0207670_100901373	127
259	3300025936	Ga0207670_10221128	Ga0207670_102211282	127
260	3300025936	Ga0207670_10282299	Ga0207670_102822992	127
261	3300025941	Ga0207711_10431231	Ga0207711_104312312	127
262	3300025941	Ga0207711_10729976	Ga0207711_107299762	127
263	3300026078	Ga0207702_10175237	Ga0207702_101752372	127
264	3300026078	Ga0207702_10985204	Ga0207702_109852042	127
265	3300026088	Ga0207641_10291124	Ga0207641_102911242	127
266	3300026088	Ga0207641_11474840	Ga0207641_114748402	127
267	3300026095	Ga0207676_10259651	Ga0207676_102596511	127
268	3300026116	Ga0207674_10343510	Ga0207674_103435102	127
269	3300028381	Ga0268264_11080668	Ga0268264_110806681	127
270	3300028800	Ga0265338_10059393	Ga0265338_100593932	127
271	3300028800	Ga0265338_10089825	Ga0265338_100898252	127
272	3300028800	Ga0265338_10096920	Ga0265338_100969203	127
273	3300031250	Ga0265331_10590774	Ga0265331_105907741	127
274	3300031251	Ga0265327_10014798	Ga0265327_100147982	127
275	3300031251	Ga0265327_10051718	Ga0265327_100517182	127
276	3300031251	Ga0265327_10078086	Ga0265327_100780863	127
277	3300031548	Ga0307408_101781254	Ga0307408_1017812542	127
278	3300031711	Ga0265314_10101221	Ga0265314_101012212	127
279	3300035171	Ga0373946_0156072	Ga0373946_0156072_56_466	127
280	3300035724	Ga0373933_0811556	Ga0373933_0811556_98_484	127
281	3300036401	Ga0373937_0134064	Ga0373937_0134064_1226_1612	127
282	3300036401	Ga0373937_0325300	Ga0373937_0325300_1051_1437	127
283	3300037471	Ga0395905_0054165	Ga0395905_0054165_2830_3216	127
284	3300037471	Ga0395905_0395385	Ga0395905_0395385_629_1015	127
285	3300042876	Ga0451577_0015980	Ga0451577_0015980_5204_5590	127
286	3300044712	Ga0453684_0080141	Ga0453684_0080141_3361_3747	127
287	3300044712	Ga0453684_0610699	Ga0453684_0610699_136_522	127
288	3300044712	Ga0453684_1005841	Ga0453684_1005841_425_811	127
289	3300044712	Ga0453684_1521332	Ga0453684_1521332_38_424	127
290	3300044712	Ga0453684_2186465	Ga0453684_2186465_51_437	127
291	3300045051	Ga0451576_0132631	Ga0451576_0132631_1621_2007	127
292	3300046476	Ga0495662_0188402	Ga0495662_0188402_86_472	127
293	3300046511	Ga0495608_0570116	Ga0495608_0570116_137_523	127
294	3300046517	Ga0495630_0006529	Ga0495630_0006529_171_557	127
295	3300046517	Ga0495630_0925811	Ga0495630_0925811_51_437	127
296	3300046533	Ga0495640_0369794	Ga0495640_0369794_407_793	127
297	3300046535	Ga0495586_0258930	Ga0495586_0258930_564_950	127
298	3300046559	Ga0495667_0016397	Ga0495667_0016397_3151_3537	127
299	3300046683	Ga0495658_0020786	Ga0495658_0020786_904_1314	127
300	3300046683	Ga0495658_0462076	Ga0495658_0462076_277_663	127
301	3300046689	Ga0495613_0488963	Ga0495613_0488963_147_533	127
302	3300047319	Ga0495674_1184090	Ga0495674_1184090_31_417	127
303	3300047322	Ga0495680_0464978	Ga0495680_0464978_70_456	127
304	3300047471	Ga0495684_0741991	Ga0495684_0741991_82_468	127
305	3300049571	Ga0501034_0050094	Ga0501034_0050094_1841_2227	127
306	3300049571	Ga0501034_0939019	Ga0501034_0939019_338_724	127
307	3300049579	Ga0501043_0244513	Ga0501043_0244513_225_611	127
308	3300050508	nmdc:mga09592_1002488_c1	nmdc:mga09592_1002488_c1_88_474	127
309	3300050512	nmdc:mga0n895_1499886_c1	nmdc:mga0n895_1499886_c1_136_522	127
310	3300050512	nmdc:mga0n895_76276_c1	nmdc:mga0n895_76276_c1_131_517	127
311	3300050514	nmdc:mga08x19_1035845_c1	nmdc:mga08x19_1035845_c1_137_523	127
312	3300053085	Ga0495619_0200119	Ga0495619_0200119_198_587	127
313	3300003320	rootH2_10123692	rootH2_101236923	128
314	3300003322	rootL2_10271014	rootL2_102710142	128
315	3300005347	Ga0070668_100767913	Ga0070668_1007679131	128
316	3300005548	Ga0070665_102345758	Ga0070665_1023457582	128
317	3300006844	Ga0075428_101070240	Ga0075428_1010702402	128
318	3300006931	Ga0097620_102175710	Ga0097620_1021757101	128
319	3300009093	Ga0105240_10347607	Ga0105240_103476073	128
320	3300009094	Ga0111539_12112028	Ga0111539_121120281	128
321	3300009148	Ga0105243_11916767	Ga0105243_119167672	128
322	3300025923	Ga0207681_10478457	Ga0207681_104784572	128
323	3300025925	Ga0207650_10163139	Ga0207650_101631392	128
324	3300026142	Ga0207698_12647386	Ga0207698_126473861	128
325	3300028558	Ga0265326_10001651	Ga0265326_100016515	128
326	3300028558	Ga0265326_10167169	Ga0265326_101671691	128
327	3300028666	Ga0265336_10040355	Ga0265336_100403552	128
328	3300028800	Ga0265338_10000398	Ga0265338_1000039854	128
329	3300028800	Ga0265338_10000867	Ga0265338_100008678	128
330	3300028800	Ga0265338_10194943	Ga0265338_101949432	128
331	3300029957	Ga0265324_10000113	Ga0265324_1000011346	128
332	3300029957	Ga0265324_10016199	Ga0265324_100161993	128
333	3300031247	Ga0265340_10343154	Ga0265340_103431541	128
334	3300031249	Ga0265339_10064576	Ga0265339_100645763	128
335	3300031250	Ga0265331_10061608	Ga0265331_100616082	128
336	3300031251	Ga0265327_10063807	Ga0265327_100638071	128
337	3300031344	Ga0265316_11023739	Ga0265316_110237391	128
338	3300031711	Ga0265314_10097732	Ga0265314_100977322	128
339	3300031711	Ga0265314_10155385	Ga0265314_101553852	128
340	3300031712	Ga0265342_10038143	Ga0265342_100381432	128
341	3300031911	Ga0307412_10086209	Ga0307412_100862092	128
342	3300032002	Ga0307416_100276856	Ga0307416_1002768562	128
343	3300032005	Ga0307411_10381228	Ga0307411_103812282	128
344	3300042876	Ga0451577_0277658	Ga0451577_0277658_716_1120	128
345	3300045051	Ga0451576_0686035	Ga0451576_0686035_356_748	128
346	3300045051	Ga0451576_1891160	Ga0451576_1891160_38_442	128
347	3300046517	Ga0495630_0207410	Ga0495630_0207410_19_414	128
348	3300046536	Ga0495587_0198608	Ga0495587_0198608_435_830	128
349	3300046680	Ga0495646_0126165	Ga0495646_0126165_402_797	128
350	3300048909	Ga0496106_0067575	Ga0496106_0067575_1981_2376	128
351	3300049744	Ga0501083_0514481	Ga0501083_0514481_47_439	128
352	3300050511	nmdc:mga08y16_1419590_c1	nmdc:mga08y16_1419590_c1_125_514	128
353	3300005844	Ga0068862_100334990	Ga0068862_1003349903	129
354	3300042876	Ga0451577_1979823	Ga0451577_1979823_64_456	129
355	3300044712	Ga0453684_0571533	Ga0453684_0571533_797_1189	129
356	2162886006	SwRhRL3b_contig_1656878	SwRhRL3b_0101.00001760	130
357	2162886007	SwRhRL2b_contig_736758	SwRhRL2b_0079.00007690	130
358	3300005289	Ga0065704_10002826	Ga0065704_100028265	130
359	3300005295	Ga0065707_10010793	Ga0065707_100107934	130
360	3300005347	Ga0070668_100189657	Ga0070668_1001896571	130
361	3300005356	Ga0070674_100248562	Ga0070674_1002485622	130
362	3300005367	Ga0070667_100699229	Ga0070667_1006992293	130
363	3300005436	Ga0070713_100096785	Ga0070713_1000967854	130
364	3300005439	Ga0070711_100008874	Ga0070711_1000088743	130
365	3300005457	Ga0070662_100052118	Ga0070662_1000521184	130
366	3300005614	Ga0068856_101066425	Ga0068856_1010664252	130
367	3300006175	Ga0070712_100014127	Ga0070712_1000141276	130
368	3300006852	Ga0075433_10950646	Ga0075433_109506462	130
369	3300006871	Ga0075434_100087002	Ga0075434_1000870023	130
370	3300006914	Ga0075436_101273841	Ga0075436_1012738411	130
371	3300013296	Ga0157374_10398810	Ga0157374_103988102	130
372	3300013297	Ga0157378_10566955	Ga0157378_105669552	130
373	3300013306	Ga0163162_11946012	Ga0163162_119460121	130
374	3300013307	Ga0157372_10415925	Ga0157372_104159252	130
375	3300013308	Ga0157375_10433606	Ga0157375_104336061	130
376	3300017792	Ga0163161_10099724	Ga0163161_100997242	130
377	3300025915	Ga0207693_10001095	Ga0207693_1000109524	130
378	3300025916	Ga0207663_10065708	Ga0207663_100657084	130
379	3300025933	Ga0207706_10077057	Ga0207706_100770574	130
380	3300025937	Ga0207669_11479345	Ga0207669_114793451	130
381	3300025939	Ga0207665_10181385	Ga0207665_101813851	130
382	3300025972	Ga0207668_11307819	Ga0207668_113078191	130
383	3300026078	Ga0207702_10813285	Ga0207702_108132851	130
384	3300028800	Ga0265338_10018923	Ga0265338_100189239	130
385	3300029957	Ga0265324_10117311	Ga0265324_101173112	130
386	3300031249	Ga0265339_10007123	Ga0265339_100071238	130
387	3300031344	Ga0265316_10849218	Ga0265316_108492182	130
388	3300031595	Ga0265313_10257958	Ga0265313_102579582	130
389	3300031711	Ga0265314_10183332	Ga0265314_101833322	130
390	3300035116	Ga0373945_0304723	Ga0373945_0304723_228_620	130
391	3300035171	Ga0373946_0070381	Ga0373946_0070381_980_1372	130
392	3300035695	Ga0373927_0588456	Ga0373927_0588456_119_511	130
393	3300046491	Ga0495584_0103463	Ga0495584_0103463_201_593	130
394	3300046506	Ga0495583_0282156	Ga0495583_0282156_88_480	130
395	3300046519	Ga0495632_0229900	Ga0495632_0229900_13_405	130
396	3300046528	Ga0495642_0007963	Ga0495642_0007963_3506_3898	130
397	3300046684	Ga0495669_0008615	Ga0495669_0008615_2886_3278	130
398	3300047445	Ga0495677_0063682	Ga0495677_0063682_677_1069	130
399	3300047470	Ga0495681_0309030	Ga0495681_0309030_208_600	130
400	3300048903	Ga0496100_0873729	Ga0496100_0873729_11_403	130
401	3300048904	Ga0496101_1341449	Ga0496101_1341449_148_540	130
402	3300048905	Ga0496102_0703107	Ga0496102_0703107_157_549	130
403	3300048907	Ga0496104_0907859	Ga0496104_0907859_58_450	130
404	3300049823	Ga0501044_1122943	Ga0501044_1122943_142_558	130
405	3300050512	nmdc:mga0n895_736521_c1	nmdc:mga0n895_736521_c1_518_910	130
406	3300053083	Ga0495655_0001034	Ga0495655_0001034_290_682	130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

34

136

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2d2a-assembly2.cif.gz_B-2	crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters	0.8811	25	118
1r94-assembly1.cif.gz_A	crystal structure of isca (mercury derivative)	0.8657	25	119
1x0g-assembly1.cif.gz_A	crystal structure of isca with the [2fe-2s] cluster	0.845	25	119
1s98-assembly1.cif.gz_A	e.coli isca crystal structure to 2.3 a	0.842	25	119
1r94-assembly1.cif.gz_A	crystal structure of isca (mercury derivative)	0.8331	25	119

ID	Description	Score	Start	End	Superfamily
af_A0A0R0F1L8_21_105_2.60.300.12	Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain	0.8844	25	105	2.60.300.12
2d2aB01	Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain	0.8811	25	118	2.60.300.12
2d2aB01	Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain	0.8631	25	118	2.60.300.12
af_Q2FZV8_4_111_2.60.300.12	Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain	0.858	26	127	2.60.300.12
af_O43045_97_205_2.60.300.12	Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain	0.8572	25	118	2.60.300.12

ID	Description	Score	Start	End	GO Terms
AF-A0A2E5HRC8-F1-model_v4	Iron-sulfur cluster assembly protein IscA	0.9502	25	118	GO:0005737 GO:0016226 GO:0051537 GO:0097428
AF-A0A7X9HXH7-F1-model_v4	Iron-sulfur cluster assembly accessory protein	0.9427	25	116	GO:0005506 GO:0016020 GO:0016226 GO:0051537 GO:0051539 GO:0106035
AF-A0A1F7P6N9-F1-model_v4	Heme biosynthesis protein HemY	0.9385	25	117	GO:0005506 GO:0016226 GO:0051537 GO:0051539 GO:0106035
AF-A0A3A4PEB8-F1-model_v4	Iron-sulfur cluster assembly accessory protein	0.9258	25	117	GO:0005506 GO:0016226 GO:0051537 GO:0051539 GO:0106035
AF-A0A6N8UQF9-F1-model_v4	Iron-sulfur cluster insertion protein ErpA	0.9211	26	119	GO:0005506 GO:0016226 GO:0051537 GO:0051539 GO:0106035

Feature Viewer

pLDDT	pTM	Quality
77.36	0.65	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F436167

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

34

136

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map