F435988

General Info

Members Datasets Scaffolds Average Seq Length
405 254 810 253

Family's Representative Sequence

Representative Sequence 3300033179|Ga0307507_10096072|Ga0307507_100960722
Length 265
Sequence MHGSGGKNAAMQLSSLKIIITGGAQGMGAHFARRLAEAGAQVAAGDVKEDGLAALVEATRGLPGKVFARKLDVASEAEVGAFVEWAAEAMGGLNGLINNAGILRDGLLVKKDRTTGQVTKLTREQWDAVIGVNLTGATLMVRDTVAKMVATEQRPGVIVNMSSIARHGNRGQSNYVSAKAALAANTVTWSREFAAFGIRVGAVAPGMIETPMTQGMNPKARDALVASIPVGRIGVPEDIWLAVRFVLECDYFSGGTIDVDGGLAM

Samples

Sample ID Description Type Environment
1 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
168 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
192 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
193 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
194 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
225 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
226 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
236 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
237 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
238 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
239 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
240 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
241 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
242 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
243 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
244 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
245 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
248 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
251 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
252 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.43
Nodule 0
Rhizoplane 2.47
Rhizosphere 87.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307507_10096072 3300033179 Bacteria 2509
2 JGI24749J21850_1002623 3300002076 Bacteria 2520
3 JGI24034J26672_10008061 3300002239 Bacteria 1535
4 JGI24751J29686_10016473 3300002459 Bacteria 1524
5 JGI25404J52841_10005678 3300003659 Bacteria 2580
6 Ga0065715_10460552 3300005293 Bacteria 816
7 Ga0070658_10068055 3300005327 Bacteria 2910
8 Ga0070658_10125375 3300005327 Bacteria 2137
9 Ga0070658_10224407 3300005327 Bacteria 1590
10 Ga0070676_10007963 3300005328 Bacteria 5698
11 Ga0070683_100001693 3300005329 Bacteria 17150
12 Ga0070683_100115930 3300005329 Bacteria 2529
13 Ga0070683_100752461 3300005329 Bacteria 934
14 Ga0070690_100002170 3300005330 Bacteria 10488
15 Ga0070690_100003562 3300005330 Bacteria 8544
16 Ga0070670_100313959 3300005331 Bacteria 1372
17 Ga0070677_10015607 3300005333 Bacteria 2691
18 Ga0068869_100084686 3300005334 Bacteria 2373
19 Ga0068869_100215726 3300005334 Bacteria 1519
20 Ga0070666_10004437 3300005335 Bacteria 8546
21 Ga0070680_100102878 3300005336 Bacteria 2372
22 Ga0070680_100115395 3300005336 Bacteria 2238
23 Ga0070682_100112040 3300005337 Bacteria 1820
24 Ga0068868_100003459 3300005338 Bacteria 10999
25 Ga0068868_100011075 3300005338 Bacteria 6559
26 Ga0068868_100296431 3300005338 Bacteria 1372
27 Ga0070660_100147815 3300005339 Bacteria 1888
28 Ga0070689_100007263 3300005340 Bacteria 7726
29 Ga0070689_100013320 3300005340 Bacteria 5948
30 Ga0070689_100409917 3300005340 Bacteria 1147
31 Ga0070691_10100910 3300005341 Bacteria 1433
32 Ga0070687_100004624 3300005343 Bacteria 5500
33 Ga0070661_100001282 3300005344 Bacteria 17661
34 Ga0070692_10078874 3300005345 Bacteria 1769
35 Ga0070668_100077062 3300005347 Bacteria 2606
36 Ga0070668_100200209 3300005347 Bacteria 1639
37 Ga0070669_100011769 3300005353 Bacteria 6208
38 Ga0070675_100050045 3300005354 Bacteria 3431
39 Ga0070675_100319028 3300005354 Bacteria 1372
40 Ga0070671_100298144 3300005355 Bacteria 1372
41 Ga0070674_100095982 3300005356 Bacteria 2150
42 Ga0070688_100001958 3300005365 Bacteria 10347
43 Ga0070659_100093636 3300005366 Bacteria 2411
44 Ga0070703_10109219 3300005406 Bacteria 987
45 Ga0070701_10104969 3300005438 Bacteria 1571
46 Ga0070701_10382886 3300005438 Bacteria 887
47 Ga0070700_100028837 3300005441 Bacteria 3306
48 Ga0070700_100093386 3300005441 Bacteria 1968
49 Ga0070663_100010594 3300005455 Bacteria 5751
50 Ga0070663_100784935 3300005455 Bacteria 816
51 Ga0070678_100018306 3300005456 Bacteria 4539
52 Ga0070678_100030614 3300005456 Bacteria 3702
53 Ga0070678_100296576 3300005456 Bacteria 1372
54 Ga0070662_100207260 3300005457 Bacteria 1558
55 Ga0070681_10094358 3300005458 Bacteria 2941
56 Ga0068867_100143955 3300005459 Bacteria 1866
57 Ga0068867_100215064 3300005459 Bacteria 1546
58 Ga0070685_10000711 3300005466 Bacteria 18085
59 Ga0070685_10443615 3300005466 Bacteria 908
60 Ga0070706_100048401 3300005467 Bacteria 3923
61 Ga0070706_100326025 3300005467 Bacteria 1432
62 Ga0070707_100050776 3300005468 Bacteria 3976
63 Ga0070698_100000896 3300005471 Bacteria 32688
64 Ga0070698_100068872 3300005471 Bacteria 3555
65 Ga0070679_100005376 3300005530 Bacteria 11860
66 Ga0070679_100339417 3300005530 Bacteria 1450
67 Ga0070684_100096383 3300005535 Bacteria 2637
68 Ga0070684_100431492 3300005535 Bacteria 1217
69 Ga0070684_100575062 3300005535 Bacteria 1046
70 Ga0068853_100000690 3300005539 Bacteria 23314
71 Ga0070686_100010325 3300005544 Bacteria 5262
72 Ga0070695_100002694 3300005545 Bacteria 10283
73 Ga0070696_100019799 3300005546 Bacteria 4560
74 Ga0070693_100068449 3300005547 Bacteria 2084
75 Ga0070665_100003510 3300005548 Bacteria 16680
76 Ga0070665_100097766 3300005548 Bacteria 2940
77 Ga0070665_100332027 3300005548 Bacteria 1525
78 Ga0068855_100009747 3300005563 Bacteria 11588
79 Ga0070664_100003344 3300005564 Bacteria 12963
80 Ga0070664_100068589 3300005564 Bacteria 3032
81 Ga0068857_100081359 3300005577 Bacteria 2892
82 Ga0068857_100108289 3300005577 Bacteria 2497
83 Ga0068854_100064352 3300005578 Bacteria 2664
84 Ga0068856_100012961 3300005614 Bacteria 8072
85 Ga0068856_100013161 3300005614 Bacteria 8014
86 Ga0068856_100085007 3300005614 Bacteria 3143
87 Ga0068856_100114939 3300005614 Bacteria 2690
88 Ga0068856_100482887 3300005614 Bacteria 1260
89 Ga0068856_100662075 3300005614 Bacteria 1065
90 Ga0068852_100204618 3300005616 Bacteria 1869
91 Ga0068859_100236405 3300005617 Bacteria 1916
92 Ga0068859_100356074 3300005617 Bacteria 1558
93 Ga0068864_100013501 3300005618 Bacteria 6772
94 Ga0068864_100145793 3300005618 Bacteria 2140
95 Ga0068866_10004760 3300005718 Bacteria 5570
96 Ga0068866_10270281 3300005718 Bacteria 1049
97 Ga0068861_100017920 3300005719 Bacteria 5034
98 Ga0068851_10000764 3300005834 Bacteria 13860
99 Ga0068870_10018075 3300005840 Bacteria 3398
100 Ga0068863_100008954 3300005841 Bacteria 9773
101 Ga0068863_100037364 3300005841 Bacteria 4624
102 Ga0068863_100206082 3300005841 Bacteria 1892
103 Ga0068858_100371056 3300005842 Bacteria 1372
104 Ga0068860_100044663 3300005843 Bacteria 4223
105 Ga0068860_100313753 3300005843 Bacteria 1538
106 Ga0068862_100033547 3300005844 Bacteria 4340
107 Ga0081540_1000295 3300005983 Bacteria 51899
108 Ga0081540_1000656 3300005983 Bacteria 32685
109 Ga0081540_1002821 3300005983 Bacteria 14072
110 Ga0070717_10156511 3300006028 Bacteria 1974
111 Ga0097621_100031513 3300006237 Bacteria 4208
112 Ga0097621_100089233 3300006237 Bacteria 2577
113 Ga0068871_100026082 3300006358 Bacteria 4556
114 Ga0068871_100090459 3300006358 Bacteria 2549
115 Ga0068871_100127493 3300006358 Bacteria 2155
116 Ga0068871_100240490 3300006358 Bacteria 1574
117 Ga0075428_100054321 3300006844 Bacteria 4390
118 Ga0075430_100223736 3300006846 Bacteria 1561
119 Ga0075429_100035621 3300006880 Bacteria 4329
120 Ga0075429_100039121 3300006880 Bacteria 4128
121 Ga0075429_100169979 3300006880 Bacteria 1909
122 Ga0068865_100012474 3300006881 Bacteria 5350
123 Ga0068865_100153276 3300006881 Bacteria 1750
124 Ga0097620_100236410 3300006931 Bacteria 1916
125 Ga0097620_100356099 3300006931 Bacteria 1558
126 Ga0105250_10049264 3300009092 Bacteria 1689
127 Ga0105240_10009300 3300009093 Bacteria 13935
128 Ga0105240_10388503 3300009093 Bacteria 1574
129 Ga0111539_10003609 3300009094 Bacteria 20386
130 Ga0111539_10877303 3300009094 Bacteria 1044
131 Ga0111539_10989737 3300009094 Bacteria 978
132 Ga0105245_10000011 3300009098 Bacteria 271829
133 Ga0105245_10023085 3300009098 Bacteria 5459
134 Ga0105245_10457510 3300009098 Bacteria 1286
135 Ga0105247_10001780 3300009101 Bacteria 15154
136 Ga0105247_10022467 3300009101 Bacteria 3799
137 Ga0105243_10173101 3300009148 Bacteria 1871
138 Ga0105241_10003062 3300009174 Bacteria 12469
139 Ga0105242_10039080 3300009176 Bacteria 3818
140 Ga0105242_10071465 3300009176 Bacteria 2880
141 Ga0105242_10934774 3300009176 Bacteria 870
142 Ga0105237_10025262 3300009545 Bacteria 6076
143 Ga0105237_10789546 3300009545 Bacteria 956
144 Ga0105238_10005354 3300009551 Bacteria 12679
145 Ga0105238_10883432 3300009551 Bacteria 912
146 Ga0105249_10006423 3300009553 Bacteria 10220
147 Ga0105249_10026555 3300009553 Bacteria 5220
148 Ga0105249_10035395 3300009553 Bacteria 4530
149 Ga0105239_10081207 3300010375 Bacteria 3568
150 Ga0105246_10011489 3300011119 Bacteria 5495
151 Ga0157373_10032338 3300013100 Bacteria 3765
152 Ga0157371_10003440 3300013102 Bacteria 14359
153 Ga0157369_10002982 3300013105 Bacteria 20254
154 Ga0157374_10015344 3300013296 Bacteria 6719
155 Ga0157374_10017709 3300013296 Bacteria 6279
156 Ga0157378_10008295 3300013297 Bacteria 9053
157 Ga0157378_10063130 3300013297 Bacteria 3309
158 Ga0163162_10033549 3300013306 Bacteria 5102
159 Ga0157372_10011072 3300013307 Bacteria 9598
160 Ga0157375_10025192 3300013308 Bacteria 5521
161 Ga0163163_10102609 3300014325 Bacteria 2884
162 Ga0163163_10673813 3300014325 Bacteria 1098
163 Ga0157380_10079943 3300014326 Bacteria 2671
164 Ga0157379_10043323 3300014968 Bacteria 4018
165 Ga0157376_10020689 3300014969 Bacteria 5097
166 Ga0157376_10119150 3300014969 Bacteria 2336
167 Ga0157376_10182990 3300014969 Bacteria 1917
168 Ga0157376_10351868 3300014969 Bacteria 1410
169 Ga0213876_10027744 3300021384 Bacteria 2986
170 Ga0207697_10027584 3300025315 Bacteria 2322
171 Ga0207656_10012910 3300025321 Bacteria 3182
172 Ga0207682_10000679 3300025893 Bacteria 15849
173 Ga0207710_10069562 3300025900 Bacteria 1612
174 Ga0207688_10001697 3300025901 Bacteria 11682
175 Ga0207680_10004011 3300025903 Bacteria 6956
176 Ga0207647_10013259 3300025904 Bacteria 5720
177 Ga0207645_10000025 3300025907 Bacteria 98264
178 Ga0207643_10000023 3300025908 Bacteria 104515
179 Ga0207705_10029556 3300025909 Bacteria 3906
180 Ga0207684_10094883 3300025910 Bacteria 2545
181 Ga0207684_10465051 3300025910 Bacteria 1086
182 Ga0207695_10093933 3300025913 Bacteria 3008
183 Ga0207671_10011725 3300025914 Bacteria 7101
184 Ga0207662_10000020 3300025918 Bacteria 72933
185 Ga0207662_10289965 3300025918 Bacteria 1085
186 Ga0207657_10000067 3300025919 Bacteria 97934
187 Ga0207649_10010628 3300025920 Bacteria 5062
188 Ga0207652_10234024 3300025921 Bacteria 1656
189 Ga0207646_10060625 3300025922 Bacteria 3378
190 Ga0207681_10004701 3300025923 Bacteria 8398
191 Ga0207694_10078777 3300025924 Bacteria 2583
192 Ga0207650_10000147 3300025925 Bacteria 85501
193 Ga0207650_10185937 3300025925 Bacteria 1658
194 Ga0207659_10011865 3300025926 Bacteria 5520
195 Ga0207687_10065220 3300025927 Bacteria 2586
196 Ga0207690_10004967 3300025932 Bacteria 7852
197 Ga0207706_10003808 3300025933 Bacteria 14375
198 Ga0207686_10021029 3300025934 Bacteria 3738
199 Ga0207709_10052374 3300025935 Bacteria 2506
200 Ga0207670_10001195 3300025936 Bacteria 13727
201 Ga0207670_10008791 3300025936 Bacteria 5720
202 Ga0207670_10016668 3300025936 Bacteria 4422
203 Ga0207669_10001005 3300025937 Bacteria 12021
204 Ga0207704_10005095 3300025938 Bacteria 6048
205 Ga0207704_10017317 3300025938 Bacteria 3731
206 Ga0207704_10221767 3300025938 Bacteria 1400
207 Ga0207691_10002984 3300025940 Bacteria 16512
208 Ga0207711_10020557 3300025941 Bacteria 5507
209 Ga0207689_10000089 3300025942 Bacteria 73617
210 Ga0207661_10116600 3300025944 Bacteria 2267
211 Ga0207661_10254369 3300025944 Bacteria 1562
212 Ga0207679_10000412 3300025945 Bacteria 30689
213 Ga0207679_10007913 3300025945 Bacteria 6757
214 Ga0207667_10043869 3300025949 Bacteria 4743
215 Ga0207651_10005938 3300025960 Bacteria 6322
216 Ga0207712_10001167 3300025961 Bacteria 18233
217 Ga0207712_10035919 3300025961 Bacteria 3371
218 Ga0207668_10009616 3300025972 Bacteria 5803
219 Ga0207640_10015874 3300025981 Bacteria 4369
220 Ga0207658_10002676 3300025986 Bacteria 12903
221 Ga0207677_10002286 3300026023 Bacteria 10063
222 Ga0207677_10003167 3300026023 Bacteria 8685
223 Ga0207677_10008524 3300026023 Bacteria 5734
224 Ga0207703_10010779 3300026035 Bacteria 7131
225 Ga0207639_10017691 3300026041 Bacteria 5054
226 Ga0207678_10012554 3300026067 Bacteria 7442
227 Ga0207678_10320482 3300026067 Bacteria 1333
228 Ga0207708_10046114 3300026075 Bacteria 3320
229 Ga0207708_10260094 3300026075 Bacteria 1401
230 Ga0207702_10058364 3300026078 Bacteria 3284
231 Ga0207702_10074992 3300026078 Bacteria 2921
232 Ga0207702_10239069 3300026078 Bacteria 1701
233 Ga0207702_10442423 3300026078 Bacteria 1260
234 Ga0207702_10654031 3300026078 Bacteria 1034
235 Ga0207641_10009354 3300026088 Bacteria 8083
236 Ga0207641_10011687 3300026088 Bacteria 7208
237 Ga0207641_10035751 3300026088 Bacteria 4142
238 Ga0207641_10154201 3300026088 Bacteria 2083
239 Ga0207641_10945366 3300026088 Bacteria 857
240 Ga0207648_10005308 3300026089 Bacteria 13000
241 Ga0207648_10096263 3300026089 Bacteria 2590
242 Ga0207648_10356367 3300026089 Bacteria 1319
243 Ga0207648_10405122 3300026089 Bacteria 1236
244 Ga0207676_10016617 3300026095 Bacteria 5329
245 Ga0207676_10197415 3300026095 Bacteria 1775
246 Ga0207674_10000177 3300026116 Bacteria 78243
247 Ga0207674_10137534 3300026116 Bacteria 2404
248 Ga0207675_100001623 3300026118 Bacteria 22532
249 Ga0207683_10000050 3300026121 Bacteria 87435
250 Ga0207683_10028755 3300026121 Bacteria 4808
251 Ga0207683_10044004 3300026121 Bacteria 3902
252 Ga0207428_10052936 3300027907 Bacteria 3239
253 Ga0207428_10498748 3300027907 Bacteria 884
254 Ga0268266_10005522 3300028379 Bacteria 11769
255 Ga0268266_10039717 3300028379 Bacteria 4008
256 Ga0268266_10057439 3300028379 Bacteria 3349
257 Ga0268265_10003955 3300028380 Bacteria 10438
258 Ga0268264_10003052 3300028381 Bacteria 14505
259 Ga0268264_10075743 3300028381 Bacteria 2861
260 Ga0268264_10269901 3300028381 Bacteria 1589
261 Ga0265334_10044897 3300028573 Bacteria 1714
262 Ga0307517_10041594 3300028786 Bacteria 4958
263 Ga0307515_10033385 3300028794 Bacteria 8476
264 Ga0265338_10063778 3300028800 Bacteria 3210
265 Ga0265338_10079430 3300028800 Bacteria 2760
266 Ga0307511_10077095 3300030521 Bacteria 2376
267 Ga0265332_10001840 3300031238 Bacteria 11311
268 Ga0307513_10005355 3300031456 Bacteria 16962
269 Ga0307509_10000398 3300031507 Bacteria 72894
270 Ga0307509_10006319 3300031507 Bacteria 15996
271 Ga0307509_10045694 3300031507 Bacteria 4720
272 Ga0265313_10089459 3300031595 Bacteria 1385
273 Ga0307508_10042031 3300031616 Bacteria 4102
274 Ga0307508_10068390 3300031616 Bacteria 3122
275 Ga0307516_10026573 3300031730 Bacteria 5877
276 Ga0307406_10003786 3300031901 Bacteria 8232
277 Ga0307406_10206144 3300031901 Bacteria 1451
278 Ga0307414_10301380 3300032004 Bacteria 1356
279 Ga0307411_10920173 3300032005 Bacteria 778
280 Ga0373949_0000053 3300035090 Bacteria 43174
281 Ga0373936_0000024 3300035113 Bacteria 127202
282 Ga0373941_0159247 3300035115 Bacteria 834
283 Ga0373946_0283932 3300035171 Bacteria 815
284 Ga0373961_0000183 3300035241 Bacteria 30129
285 Ga0316574_0075603 3300035398 Bacteria 2133
286 Ga0316574_0105385 3300035398 Bacteria 1806
287 Ga0316574_0219659 3300035398 Bacteria 1218
288 Ga0373927_0007218 3300035695 Bacteria 7540
289 Ga0316584_0066914 3300036712 Bacteria 2693
290 Ga0373925_0014557 3300037068 Bacteria 5685
291 Ga0395899_0011061 3300037312 Bacteria 6911
292 Ga0395900_0063088 3300037418 Bacteria 3809
293 Ga0395898_0037795 3300037466 Bacteria 4787
294 Ga0395905_0036526 3300037471 Bacteria 4615
295 Ga0395905_0136500 3300037471 Bacteria 2308
296 Ga0395901_0148599 3300038443 Bacteria 2462
297 Ga0436365_0095608 3300039437 Bacteria 1453
298 Ga0436365_0218423 3300039437 Bacteria 3286
299 Ga0436365_0430206 3300039437 Bacteria 1396
300 Ga0436365_1903641 3300039437 Bacteria 815
301 Ga0436361_0102084 3300039447 Bacteria 988
302 Ga0436361_0982883 3300039447 Bacteria 1050
303 Ga0436363_1414190 3300039450 Bacteria 980
304 Ga0439465_0006634 3300041413 Bacteria 3677
305 Ga0451851_0495819 3300041507 Bacteria 759
306 Ga0439455_0002815 3300042012 Bacteria 3230
307 Ga0450898_026051 3300042134 Bacteria 1052
308 Ga0439446_0083490 3300042156 Bacteria 992
309 Ga0451577_0091695 3300042876 Bacteria 2712
310 Ga0451577_0104398 3300042876 Bacteria 2532
311 Ga0451577_0178629 3300042876 Bacteria 1913
312 Ga0451577_0183644 3300042876 Bacteria 1886
313 Ga0451577_0251219 3300042876 Bacteria 1601
314 Ga0451577_0456524 3300042876 Bacteria 1160
315 Ga0451577_0641423 3300042876 Bacteria 963
316 Ga0451577_0789900 3300042876 Bacteria 858
317 Ga0453683_0031403 3300044673 Bacteria 3356
318 Ga0453683_0398455 3300044673 Bacteria 887
319 Ga0466966_0182359 3300044684 Bacteria 1274
320 Ga0466961_0131274 3300044693 Bacteria 1570
321 Ga0466963_0128190 3300044694 Bacteria 1751
322 Ga0453684_0001271 3300044712 Bacteria 75619
323 Ga0453684_0002105 3300044712 Bacteria 50258
324 Ga0453684_0008722 3300044712 Bacteria 18023
325 Ga0453684_0011236 3300044712 Bacteria 15071
326 Ga0453684_0026844 3300044712 Bacteria 8297
327 Ga0453684_0871476 3300044712 Bacteria 966
328 Ga0453684_0900150 3300044712 Bacteria 948
329 Ga0453684_1001102 3300044712 Bacteria 889
330 Ga0453684_1177428 3300044712 Bacteria 806
331 Ga0466959_0062744 3300045049 Bacteria 2700
332 Ga0451576_0074082 3300045051 Bacteria 3543
333 Ga0451576_0120769 3300045051 Bacteria 2728
334 Ga0451576_0209234 3300045051 Bacteria 2037
335 Ga0451576_0435601 3300045051 Bacteria 1376
336 Ga0451576_0863101 3300045051 Bacteria 950
337 Ga0495650_0104552 3300046471 Bacteria 1059
338 Ga0495630_0404004 3300046517 Bacteria 1047
339 Ga0495588_0018056 3300046674 Bacteria 3435
340 Ga0495613_0116666 3300046689 Bacteria 1920
341 Ga0495636_0000334 3300047318 Bacteria 18070
342 Ga0495686_0021819 3300047472 Bacteria 4245
343 Ga0495615_0002304 3300048090 Bacteria 3043
344 Ga0496100_0036313 3300048903 Bacteria 3107
345 Ga0496105_0246021 3300048908 Bacteria 1450
346 Ga0496106_0019893 3300048909 Bacteria 4978
347 Ga0496106_0671520 3300048909 Bacteria 827
348 Ga0496108_0135298 3300048911 Bacteria 2120
349 Ga0496113_0116370 3300048916 Bacteria 2086
350 Ga0496114_0265472 3300048917 Bacteria 1512
351 Ga0496114_0346749 3300048917 Bacteria 1313
352 Ga0496115_0265725 3300048918 Bacteria 1410
353 Ga0496115_0374741 3300048918 Bacteria 1158
354 Ga0496123_0136627 3300048926 Bacteria 1348
355 Ga0501032_0111316 3300049569 Bacteria 1812
356 Ga0501032_0143374 3300049569 Bacteria 1573
357 Ga0501046_0237413 3300049580 Bacteria 1345
358 Ga0501047_0013201 3300049581 Bacteria 7822
359 Ga0501047_0393809 3300049581 Bacteria 1218
360 Ga0501070_0026315 3300049586 Bacteria 4882
361 Ga0501070_0035490 3300049586 Bacteria 4167
362 Ga0501070_0121350 3300049586 Bacteria 2160
363 Ga0501073_0181181 3300049589 Bacteria 1458
364 Ga0501074_0074773 3300049590 Bacteria 2433
365 Ga0501227_000618 3300049665 Bacteria 7728
366 Ga0501233_000766 3300049668 Bacteria 5358
367 Ga0501225_0006287 3300049705 Bacteria 3471
368 Ga0501080_0198432 3300049742 Bacteria 1843
369 Ga0501083_0087606 3300049744 Bacteria 2059
370 Ga0501035_0001798 3300049822 Bacteria 21669
371 Ga0501035_0381622 3300049822 Bacteria 1175
372 Ga0501044_0010371 3300049823 Bacteria 10112
373 nmdc:mga05p37_657204_c1 3300050507 Bacteria 1172
374 nmdc:mga09592_15876_c1 3300050508 Bacteria 6154
375 nmdc:mga09592_177763_c1 3300050508 Bacteria 1841
376 nmdc:mga09592_31218_c1 3300050508 Bacteria 4438
377 nmdc:mga08y16_298161_c1 3300050511 Bacteria 1662
378 nmdc:mga08y16_521_c1 3300050511 Bacteria 35502
379 nmdc:mga08y16_817126_c1 3300050511 Bacteria 924
380 nmdc:mga0rr50_119119_c2 3300050513 Bacteria 1035
381 nmdc:mga0rr50_61253_c1 3300050513 Bacteria 2834
382 Ga0500635_0000559 3300053080 Bacteria 9924
383 Ga0500646_0002774 3300053090 Bacteria 4511
384 Ga0500566_0000172 3300053094 Bacteria 32841
385 Ga0500566_0013498 3300053094 Bacteria 4809
386 Ga0500566_0059590 3300053094 Bacteria 2164
387 Ga0500640_001168 3300053095 Bacteria 7669
388 Ga0500554_000076 3300053102 Bacteria 17813
389 Ga0500554_007200 3300053102 Bacteria 2545
390 Ga0500572_004447 3300053111 Bacteria 3179
391 Ga0500595_000135 3300053119 Bacteria 48110
392 Ga0500597_007049 3300053120 Bacteria 3781
393 Ga0500597_012489 3300053120 Bacteria 3118
394 Ga0500614_000055 3300053123 Bacteria 24422
395 Ga0500617_066208 3300053124 Bacteria 1591
396 Ga0500642_0053079 3300053130 Bacteria 1796
397 Ga0500559_0002180 3300053136 Bacteria 10350
398 Ga0500564_076936 3300053138 Bacteria 1500
399 Ga0500603_001353 3300053150 Bacteria 5616
400 Ga0500616_0163038 3300053153 Bacteria 1020
401 Ga0500622_0118126 3300053156 Bacteria 1289
402 Ga0500636_0040556 3300053177 Bacteria 2753
403 Ga0500637_0175689 3300053178 Bacteria 1229
404 Ga0501082_0035852 3300060353 Bacteria 4275
405 Ga0530510_0033993 3300061734 Bacteria 3672
406 Ga0307507_10096072
407 JGI24749J21850_1002623
408 JGI24034J26672_10008061
409 JGI24751J29686_10016473
410 JGI25404J52841_10005678
411 Ga0065715_10460552
412 Ga0070658_10068055
413 Ga0070658_10125375
414 Ga0070658_10224407
415 Ga0070676_10007963
416 Ga0070683_100001693
417 Ga0070683_100115930
418 Ga0070683_100752461
419 Ga0070690_100002170
420 Ga0070690_100003562
421 Ga0070670_100313959
422 Ga0070677_10015607
423 Ga0068869_100084686
424 Ga0068869_100215726
425 Ga0070666_10004437
426 Ga0070680_100102878
427 Ga0070680_100115395
428 Ga0070682_100112040
429 Ga0068868_100003459
430 Ga0068868_100011075
431 Ga0068868_100296431
432 Ga0070660_100147815
433 Ga0070689_100007263
434 Ga0070689_100013320
435 Ga0070689_100409917
436 Ga0070691_10100910
437 Ga0070687_100004624
438 Ga0070661_100001282
439 Ga0070692_10078874
440 Ga0070668_100077062
441 Ga0070668_100200209
442 Ga0070669_100011769
443 Ga0070675_100050045
444 Ga0070675_100319028
445 Ga0070671_100298144
446 Ga0070674_100095982
447 Ga0070688_100001958
448 Ga0070659_100093636
449 Ga0070703_10109219
450 Ga0070701_10104969
451 Ga0070701_10382886
452 Ga0070700_100028837
453 Ga0070700_100093386
454 Ga0070663_100010594
455 Ga0070663_100784935
456 Ga0070678_100018306
457 Ga0070678_100030614
458 Ga0070678_100296576
459 Ga0070662_100207260
460 Ga0070681_10094358
461 Ga0068867_100143955
462 Ga0068867_100215064
463 Ga0070685_10000711
464 Ga0070685_10443615
465 Ga0070706_100048401
466 Ga0070706_100326025
467 Ga0070707_100050776
468 Ga0070698_100000896
469 Ga0070698_100068872
470 Ga0070679_100005376
471 Ga0070679_100339417
472 Ga0070684_100096383
473 Ga0070684_100431492
474 Ga0070684_100575062
475 Ga0068853_100000690
476 Ga0070686_100010325
477 Ga0070695_100002694
478 Ga0070696_100019799
479 Ga0070693_100068449
480 Ga0070665_100003510
481 Ga0070665_100097766
482 Ga0070665_100332027
483 Ga0068855_100009747
484 Ga0070664_100003344
485 Ga0070664_100068589
486 Ga0068857_100081359
487 Ga0068857_100108289
488 Ga0068854_100064352
489 Ga0068856_100012961
490 Ga0068856_100013161
491 Ga0068856_100085007
492 Ga0068856_100114939
493 Ga0068856_100482887
494 Ga0068856_100662075
495 Ga0068852_100204618
496 Ga0068859_100236405
497 Ga0068859_100356074
498 Ga0068864_100013501
499 Ga0068864_100145793
500 Ga0068866_10004760
501 Ga0068866_10270281
502 Ga0068861_100017920
503 Ga0068851_10000764
504 Ga0068870_10018075
505 Ga0068863_100008954
506 Ga0068863_100037364
507 Ga0068863_100206082
508 Ga0068858_100371056
509 Ga0068860_100044663
510 Ga0068860_100313753
511 Ga0068862_100033547
512 Ga0081540_1000295
513 Ga0081540_1000656
514 Ga0081540_1002821
515 Ga0070717_10156511
516 Ga0097621_100031513
517 Ga0097621_100089233
518 Ga0068871_100026082
519 Ga0068871_100090459
520 Ga0068871_100127493
521 Ga0068871_100240490
522 Ga0075428_100054321
523 Ga0075430_100223736
524 Ga0075429_100035621
525 Ga0075429_100039121
526 Ga0075429_100169979
527 Ga0068865_100012474
528 Ga0068865_100153276
529 Ga0097620_100236410
530 Ga0097620_100356099
531 Ga0105250_10049264
532 Ga0105240_10009300
533 Ga0105240_10388503
534 Ga0111539_10003609
535 Ga0111539_10877303
536 Ga0111539_10989737
537 Ga0105245_10000011
538 Ga0105245_10023085
539 Ga0105245_10457510
540 Ga0105247_10001780
541 Ga0105247_10022467
542 Ga0105243_10173101
543 Ga0105241_10003062
544 Ga0105242_10039080
545 Ga0105242_10071465
546 Ga0105242_10934774
547 Ga0105237_10025262
548 Ga0105237_10789546
549 Ga0105238_10005354
550 Ga0105238_10883432
551 Ga0105249_10006423
552 Ga0105249_10026555
553 Ga0105249_10035395
554 Ga0105239_10081207
555 Ga0105246_10011489
556 Ga0157373_10032338
557 Ga0157371_10003440
558 Ga0157369_10002982
559 Ga0157374_10015344
560 Ga0157374_10017709
561 Ga0157378_10008295
562 Ga0157378_10063130
563 Ga0163162_10033549
564 Ga0157372_10011072
565 Ga0157375_10025192
566 Ga0163163_10102609
567 Ga0163163_10673813
568 Ga0157380_10079943
569 Ga0157379_10043323
570 Ga0157376_10020689
571 Ga0157376_10119150
572 Ga0157376_10182990
573 Ga0157376_10351868
574 Ga0213876_10027744
575 Ga0207697_10027584
576 Ga0207656_10012910
577 Ga0207682_10000679
578 Ga0207710_10069562
579 Ga0207688_10001697
580 Ga0207680_10004011
581 Ga0207647_10013259
582 Ga0207645_10000025
583 Ga0207643_10000023
584 Ga0207705_10029556
585 Ga0207684_10094883
586 Ga0207684_10465051
587 Ga0207695_10093933
588 Ga0207671_10011725
589 Ga0207662_10000020
590 Ga0207662_10289965
591 Ga0207657_10000067
592 Ga0207649_10010628
593 Ga0207652_10234024
594 Ga0207646_10060625
595 Ga0207681_10004701
596 Ga0207694_10078777
597 Ga0207650_10000147
598 Ga0207650_10185937
599 Ga0207659_10011865
600 Ga0207687_10065220
601 Ga0207690_10004967
602 Ga0207706_10003808
603 Ga0207686_10021029
604 Ga0207709_10052374
605 Ga0207670_10001195
606 Ga0207670_10008791
607 Ga0207670_10016668
608 Ga0207669_10001005
609 Ga0207704_10005095
610 Ga0207704_10017317
611 Ga0207704_10221767
612 Ga0207691_10002984
613 Ga0207711_10020557
614 Ga0207689_10000089
615 Ga0207661_10116600
616 Ga0207661_10254369
617 Ga0207679_10000412
618 Ga0207679_10007913
619 Ga0207667_10043869
620 Ga0207651_10005938
621 Ga0207712_10001167
622 Ga0207712_10035919
623 Ga0207668_10009616
624 Ga0207640_10015874
625 Ga0207658_10002676
626 Ga0207677_10002286
627 Ga0207677_10003167
628 Ga0207677_10008524
629 Ga0207703_10010779
630 Ga0207639_10017691
631 Ga0207678_10012554
632 Ga0207678_10320482
633 Ga0207708_10046114
634 Ga0207708_10260094
635 Ga0207702_10058364
636 Ga0207702_10074992
637 Ga0207702_10239069
638 Ga0207702_10442423
639 Ga0207702_10654031
640 Ga0207641_10009354
641 Ga0207641_10011687
642 Ga0207641_10035751
643 Ga0207641_10154201
644 Ga0207641_10945366
645 Ga0207648_10005308
646 Ga0207648_10096263
647 Ga0207648_10356367
648 Ga0207648_10405122
649 Ga0207676_10016617
650 Ga0207676_10197415
651 Ga0207674_10000177
652 Ga0207674_10137534
653 Ga0207675_100001623
654 Ga0207683_10000050
655 Ga0207683_10028755
656 Ga0207683_10044004
657 Ga0207428_10052936
658 Ga0207428_10498748
659 Ga0268266_10005522
660 Ga0268266_10039717
661 Ga0268266_10057439
662 Ga0268265_10003955
663 Ga0268264_10003052
664 Ga0268264_10075743
665 Ga0268264_10269901
666 Ga0265334_10044897
667 Ga0307517_10041594
668 Ga0307515_10033385
669 Ga0265338_10063778
670 Ga0265338_10079430
671 Ga0307511_10077095
672 Ga0265332_10001840
673 Ga0307513_10005355
674 Ga0307509_10000398
675 Ga0307509_10006319
676 Ga0307509_10045694
677 Ga0265313_10089459
678 Ga0307508_10042031
679 Ga0307508_10068390
680 Ga0307516_10026573
681 Ga0307406_10003786
682 Ga0307406_10206144
683 Ga0307414_10301380
684 Ga0307411_10920173
685 Ga0373949_0000053
686 Ga0373936_0000024
687 Ga0373941_0159247
688 Ga0373946_0283932
689 Ga0373961_0000183
690 Ga0316574_0075603
691 Ga0316574_0105385
692 Ga0316574_0219659
693 Ga0373927_0007218
694 Ga0316584_0066914
695 Ga0373925_0014557
696 Ga0395899_0011061
697 Ga0395900_0063088
698 Ga0395898_0037795
699 Ga0395905_0036526
700 Ga0395905_0136500
701 Ga0395901_0148599
702 Ga0436365_0095608
703 Ga0436365_0218423
704 Ga0436365_0430206
705 Ga0436365_1903641
706 Ga0436361_0102084
707 Ga0436361_0982883
708 Ga0436363_1414190
709 Ga0439465_0006634
710 Ga0451851_0495819
711 Ga0439455_0002815
712 Ga0450898_026051
713 Ga0439446_0083490
714 Ga0451577_0091695
715 Ga0451577_0104398
716 Ga0451577_0178629
717 Ga0451577_0183644
718 Ga0451577_0251219
719 Ga0451577_0456524
720 Ga0451577_0641423
721 Ga0451577_0789900
722 Ga0453683_0031403
723 Ga0453683_0398455
724 Ga0466966_0182359
725 Ga0466961_0131274
726 Ga0466963_0128190
727 Ga0453684_0001271
728 Ga0453684_0002105
729 Ga0453684_0008722
730 Ga0453684_0011236
731 Ga0453684_0026844
732 Ga0453684_0871476
733 Ga0453684_0900150
734 Ga0453684_1001102
735 Ga0453684_1177428
736 Ga0466959_0062744
737 Ga0451576_0074082
738 Ga0451576_0120769
739 Ga0451576_0209234
740 Ga0451576_0435601
741 Ga0451576_0863101
742 Ga0495650_0104552
743 Ga0495630_0404004
744 Ga0495588_0018056
745 Ga0495613_0116666
746 Ga0495636_0000334
747 Ga0495686_0021819
748 Ga0495615_0002304
749 Ga0496100_0036313
750 Ga0496105_0246021
751 Ga0496106_0019893
752 Ga0496106_0671520
753 Ga0496108_0135298
754 Ga0496113_0116370
755 Ga0496114_0265472
756 Ga0496114_0346749
757 Ga0496115_0265725
758 Ga0496115_0374741
759 Ga0496123_0136627
760 Ga0501032_0111316
761 Ga0501032_0143374
762 Ga0501046_0237413
763 Ga0501047_0013201
764 Ga0501047_0393809
765 Ga0501070_0026315
766 Ga0501070_0035490
767 Ga0501070_0121350
768 Ga0501073_0181181
769 Ga0501074_0074773
770 Ga0501227_000618
771 Ga0501233_000766
772 Ga0501225_0006287
773 Ga0501080_0198432
774 Ga0501083_0087606
775 Ga0501035_0001798
776 Ga0501035_0381622
777 Ga0501044_0010371
778 nmdc:mga05p37_657204_c1
779 nmdc:mga09592_15876_c1
780 nmdc:mga09592_177763_c1
781 nmdc:mga09592_31218_c1
782 nmdc:mga08y16_298161_c1
783 nmdc:mga08y16_521_c1
784 nmdc:mga08y16_817126_c1
785 nmdc:mga0rr50_119119_c2
786 nmdc:mga0rr50_61253_c1
787 Ga0500635_0000559
788 Ga0500646_0002774
789 Ga0500566_0000172
790 Ga0500566_0013498
791 Ga0500566_0059590
792 Ga0500640_001168
793 Ga0500554_000076
794 Ga0500554_007200
795 Ga0500572_004447
796 Ga0500595_000135
797 Ga0500597_007049
798 Ga0500597_012489
799 Ga0500614_000055
800 Ga0500617_066208
801 Ga0500642_0053079
802 Ga0500559_0002180
803 Ga0500564_076936
804 Ga0500603_001353
805 Ga0500616_0163038
806 Ga0500622_0118126
807 Ga0500636_0040556
808 Ga0500637_0175689
809 Ga0501082_0035852
810 Ga0530510_0033993

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

17

221

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

22

264

0.93

PF08659

KR

KR domain

17

205

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cqm-assembly1.cif.gz_K crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9389 5 252
7pcs-assembly1.cif.gz_D structure of the heterotetrameric sdr family member bbscd 0.9367 8 252
4nbw-assembly1.cif.gz_D crystal structure of fabg from plesiocystis pacifica 0.9335 5 255
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9298 2 255
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.9293 1 255
ID Description Score Start End Superfamily
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9389 5 252 3.40.50.720
5t5qC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9365 6 255 3.40.50.720
4nbwD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9335 5 255 3.40.50.720
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.93 2 253 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9274 2 252 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A090P148-F1-model_v4 deleted 0.9596 62 255
AF-A0A0F8Z1P8-F1-model_v4 3-oxoacyl-ACP reductase 0.9466 85 255 GO:0016491
AF-A0A5C7KJ47-F1-model_v4 deleted 0.9448 3 90
AF-A0A7V5XCC3-F1-model_v4 SDR family oxidoreductase 0.9437 68 255 GO:0016616
GO:0030497
AF-A0A6L9DFL3-F1-model_v4 deleted 0.9399 6 196

Map