F435980

General Info

Members Datasets Scaffolds Average Seq Length
405 250 810 288

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10021498|Ga0316576_100214983
Length 304
Sequence VGWRLAPPVPFCDMRGIVLAGGTGSRLWPVTQAVSKQLMPVYDKPMIYYPLSTLMNAEIREVLVITTPADQAAFQYLLGDGAQWGMRIEYAEQPRPEGLAQAFLIGADFIGTDSVSLVLGDNIFYGVGLGTQLRAATDVDGGRVFAYHVSNPSEYGVVEFDAAGSVLSIEEKPATPRSSYAVPGLYFYDNDVVEIARQVRPSARGELEITAVHATYLEQGRLTVSILPRGTAWLDTGTFTTMVQAAEFVRVIEDRQGYKIGCPEEVAWRNGWIDDEALQSLAEPLLKSGYGAYLQQILARGPNL

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
209 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
217 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
221 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
222 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
223 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
224 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
225 2808606372 Agromyces sp. 23-23 Isolate Unclassified
226 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
227 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
228 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
229 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
230 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
231 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
232 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
233 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
234 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
235 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
236 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
237 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
238 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
239 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
240 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
241 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
242 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
243 2928153084 Leifsonia sp. 563 Isolate Unclassified
244 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
245 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
246 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
247 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
248 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
249 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
250 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.1
Metatranscriptomes 0.49
Isolates 7.41

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 10.12
Nodule 0
Rhizoplane 0.74
Rhizosphere 79.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10021498 3300031727 Bacteria 4464
2 JGI24739J22299_10017127 3300001989 Bacteria 2617
3 JGI24737J22298_10017424 3300001990 Bacteria 2314
4 JGI24735J21928_10009115 3300002067 Bacteria 3194
5 Ga0006562J51391_1169909 3300003578 Bacteria 5020
6 Ga0055525_1001990 3300003759 Bacteria 2540
7 Ga0055527_1000005 3300003760 Bacteria 504776
8 Ga0055542_1000006 3300003762 Bacteria 504776
9 Ga0055529_1000013 3300003763 Bacteria 373267
10 Ga0065714_10010171 3300005288 Bacteria 2469
11 Ga0070658_10000044 3300005327 Bacteria 131465
12 Ga0070658_10000771 3300005327 Bacteria 27511
13 Ga0070658_10006153 3300005327 Bacteria 9731
14 Ga0070683_100153202 3300005329 Bacteria 2185
15 Ga0070666_10064259 3300005335 Bacteria 2489
16 Ga0070682_100279994 3300005337 Bacteria 1215
17 Ga0070682_100363558 3300005337 Bacteria 1083
18 Ga0068868_100004369 3300005338 Bacteria 9907
19 Ga0070660_100001735 3300005339 Bacteria 14952
20 Ga0070660_100093121 3300005339 Bacteria 2379
21 Ga0070661_100016569 3300005344 Bacteria 5214
22 Ga0070659_100001130 3300005366 Bacteria 19470
23 Ga0070667_100100325 3300005367 Bacteria 2500
24 Ga0070705_100058332 3300005440 Bacteria 2281
25 Ga0070694_100098290 3300005444 Bacteria 2066
26 Ga0070685_10004099 3300005466 Bacteria 7363
27 Ga0070679_100432564 3300005530 Bacteria 1261
28 Ga0070684_100058744 3300005535 Bacteria 3362
29 Ga0068853_100016717 3300005539 Bacteria 6041
30 Ga0068853_100123963 3300005539 Bacteria 2307
31 Ga0070672_100001152 3300005543 Bacteria 16164
32 Ga0070696_100188096 3300005546 Bacteria 1535
33 Ga0070704_100064749 3300005549 Bacteria 2628
34 Ga0068855_100000144 3300005563 Bacteria 91639
35 Ga0068855_100004634 3300005563 Bacteria 16779
36 Ga0068855_100011498 3300005563 Bacteria 10695
37 Ga0068855_100016791 3300005563 Bacteria 8802
38 Ga0068855_100029512 3300005563 Bacteria 6555
39 Ga0068857_100000025 3300005577 Bacteria 84312
40 Ga0068857_100193817 3300005577 Bacteria 1851
41 Ga0068856_100020049 3300005614 Bacteria 6492
42 Ga0068856_100054961 3300005614 Bacteria 3929
43 Ga0068852_100001068 3300005616 Bacteria 18099
44 Ga0068852_100006734 3300005616 Bacteria 8336
45 Ga0068859_100194756 3300005617 Bacteria 2111
46 Ga0068864_100135231 3300005618 Bacteria 2219
47 Ga0068861_100063731 3300005719 Bacteria 2834
48 Ga0068861_100152556 3300005719 Bacteria 1897
49 Ga0068851_10000001 3300005834 Bacteria 495512
50 Ga0068858_100105374 3300005842 Bacteria 2631
51 Ga0068862_100287872 3300005844 Bacteria 1508
52 Ga0068862_100620812 3300005844 Bacteria 1040
53 Ga0081539_10013561 3300005985 Bacteria 6130
54 Ga0081539_10046966 3300005985 Bacteria 2470
55 Ga0070717_10140516 3300006028 Bacteria 2082
56 Ga0075365_10000134 3300006038 Bacteria 22900
57 Ga0075365_10018160 3300006038 Bacteria 4319
58 Ga0075365_10173884 3300006038 Bacteria 1504
59 Ga0075364_10002836 3300006051 Bacteria 9762
60 Ga0075369_10120055 3300006186 Bacteria 1189
61 Ga0075433_10028145 3300006852 Bacteria 4776
62 Ga0075434_100001167 3300006871 Bacteria 21754
63 Ga0075436_100056619 3300006914 Bacteria 2708
64 Ga0097620_100194754 3300006931 Bacteria 2111
65 Ga0075435_100013421 3300007076 Bacteria 6095
66 Ga0105240_10000002 3300009093 Bacteria 1924170
67 Ga0105240_10000314 3300009093 Bacteria 93043
68 Ga0105240_10000538 3300009093 Bacteria 70068
69 Ga0105240_10015209 3300009093 Bacteria 10470
70 Ga0105240_10018353 3300009093 Bacteria 9397
71 Ga0105240_10743782 3300009093 Bacteria 1067
72 Ga0111539_10055327 3300009094 Bacteria 4717
73 Ga0105245_10024201 3300009098 Bacteria 5331
74 Ga0105247_10006529 3300009101 Bacteria 7222
75 Ga0114129_10626052 3300009147 Bacteria 1391
76 Ga0105241_10000396 3300009174 Bacteria 32960
77 Ga0105241_10059083 3300009174 Bacteria 2947
78 Ga0105248_10000124 3300009177 Bacteria 88479
79 Ga0105248_10015953 3300009177 Bacteria 8272
80 Ga0105237_10080115 3300009545 Bacteria 3256
81 Ga0105238_10002448 3300009551 Bacteria 18618
82 Ga0105238_10004324 3300009551 Bacteria 14093
83 Ga0105238_10004876 3300009551 Bacteria 13270
84 Ga0105238_10116615 3300009551 Bacteria 2650
85 Ga0105238_10292068 3300009551 Bacteria 1612
86 Ga0105238_10376086 3300009551 Bacteria 1411
87 Ga0105238_10440031 3300009551 Bacteria 1300
88 Ga0105238_10704917 3300009551 Bacteria 1021
89 Ga0105239_10001868 3300010375 Bacteria 27566
90 Ga0105239_10005793 3300010375 Bacteria 14416
91 Ga0105239_10054159 3300010375 Bacteria 4399
92 Ga0105239_10134378 3300010375 Bacteria 2753
93 Ga0105246_10032809 3300011119 Bacteria 3447
94 Ga0157371_10003891 3300013102 Bacteria 13300
95 Ga0157370_10001023 3300013104 Bacteria 35200
96 Ga0157370_10110530 3300013104 Bacteria 2569
97 Ga0157369_10001627 3300013105 Bacteria 27447
98 Ga0157369_10022008 3300013105 Bacteria 7124
99 Ga0157369_10206065 3300013105 Bacteria 2062
100 Ga0157369_10359282 3300013105 Bacteria 1512
101 Ga0157369_10359516 3300013105 Bacteria 1512
102 Ga0157369_10375730 3300013105 Bacteria 1475
103 Ga0157374_10059559 3300013296 Bacteria 3571
104 Ga0157374_10237975 3300013296 Bacteria 1790
105 Ga0157378_10027810 3300013297 Bacteria 4988
106 Ga0157378_10143525 3300013297 Bacteria 2219
107 Ga0163162_10451410 3300013306 Bacteria 1418
108 Ga0163163_10003889 3300014325 Bacteria 12729
109 Ga0157380_10012081 3300014326 Bacteria 6250
110 Ga0157379_10005945 3300014968 Bacteria 10511
111 Ga0209672_100003 3300025228 Bacteria 1560476
112 Ga0209147_101119 3300025229 Bacteria 11089
113 Ga0209563_100250 3300025230 Bacteria 25212
114 Ga0209148_1000004 3300025254 Bacteria 1844481
115 Ga0209148_1000857 3300025254 Bacteria 21284
116 Ga0209233_1013760 3300025261 Bacteria 2303
117 Ga0209455_1000046 3300025272 Bacteria 382681
118 Ga0209455_1003493 3300025272 Bacteria 5535
119 Ga0207656_10000002 3300025321 Bacteria 792178
120 Ga0207710_10043429 3300025900 Bacteria 1999
121 Ga0207688_10065594 3300025901 Bacteria 2052
122 Ga0207705_10000001 3300025909 Bacteria 2061880
123 Ga0207705_10008960 3300025909 Bacteria 7286
124 Ga0207705_10026962 3300025909 Bacteria 4095
125 Ga0207654_10000001 3300025911 Bacteria 1816198
126 Ga0207707_10363589 3300025912 Bacteria 1246
127 Ga0207695_10000002 3300025913 Bacteria 2188391
128 Ga0207695_10000012 3300025913 Bacteria 840961
129 Ga0207695_10000983 3300025913 Bacteria 50658
130 Ga0207695_10005519 3300025913 Bacteria 16742
131 Ga0207695_10185313 3300025913 Bacteria 2001
132 Ga0207671_10000002 3300025914 Bacteria 1144816
133 Ga0207657_10000531 3300025919 Bacteria 40498
134 Ga0207657_10063116 3300025919 Bacteria 3169
135 Ga0207649_10011403 3300025920 Bacteria 4901
136 Ga0207694_10000006 3300025924 Bacteria 631109
137 Ga0207694_10000022 3300025924 Bacteria 288900
138 Ga0207694_10113065 3300025924 Bacteria 2161
139 Ga0207694_10234440 3300025924 Bacteria 1499
140 Ga0207694_10263312 3300025924 Bacteria 1413
141 Ga0207659_10160959 3300025926 Bacteria 1762
142 Ga0207687_10014781 3300025927 Bacteria 5112
143 Ga0207644_10095808 3300025931 Bacteria 2220
144 Ga0207690_10003414 3300025932 Bacteria 9485
145 Ga0207691_10033394 3300025940 Bacteria 4790
146 Ga0207711_10000940 3300025941 Bacteria 28075
147 Ga0207711_10030187 3300025941 Bacteria 4571
148 Ga0207661_10324843 3300025944 Bacteria 1384
149 Ga0207667_10000467 3300025949 Bacteria 54059
150 Ga0207667_10001831 3300025949 Bacteria 26716
151 Ga0207667_10006145 3300025949 Bacteria 14589
152 Ga0207667_10014919 3300025949 Bacteria 8836
153 Ga0207667_10128952 3300025949 Bacteria 2605
154 Ga0207667_10234848 3300025949 Bacteria 1877
155 Ga0207658_10143438 3300025986 Bacteria 1936
156 Ga0207677_10021283 3300026023 Bacteria 3959
157 Ga0207639_10125317 3300026041 Bacteria 2117
158 Ga0207702_10015318 3300026078 Bacteria 6356
159 Ga0207702_10698184 3300026078 Bacteria 1000
160 Ga0207702_10721370 3300026078 Bacteria 983
161 Ga0207674_10000153 3300026116 Bacteria 80955
162 Ga0207675_100056153 3300026118 Bacteria 3673
163 Ga0207698_10000695 3300026142 Bacteria 19531
164 Ga0207698_10004561 3300026142 Bacteria 8453
165 Ga0207698_10031533 3300026142 Bacteria 3827
166 Ga0207698_10120396 3300026142 Bacteria 2220
167 Ga0207698_10430281 3300026142 Bacteria 1269
168 Ga0209995_1001898 3300027471 Bacteria 3272
169 Ga0209999_1002473 3300027543 Bacteria 3260
170 Ga0209971_1000485 3300027682 Bacteria 10524
171 Ga0209974_10011289 3300027876 Bacteria 3004
172 Ga0268266_10049857 3300028379 Bacteria 3591
173 Ga0268264_10116359 3300028381 Bacteria 2350
174 Ga0307515_10296441 3300028794 Bacteria 1307
175 Ga0307513_10080983 3300031456 Bacteria 3347
176 Ga0307509_10068194 3300031507 Bacteria 3723
177 Ga0307508_10082497 3300031616 Bacteria 2797
178 Ga0307514_10001210 3300031649 Bacteria 34350
179 Ga0307516_10035375 3300031730 Bacteria 5012
180 Ga0307405_10291329 3300031731 Bacteria 1234
181 Ga0307405_10402977 3300031731 Bacteria 1071
182 Ga0307410_10045267 3300031852 Bacteria 2929
183 Ga0307410_10150519 3300031852 Bacteria 1732
184 Ga0307416_100117003 3300032002 Bacteria 2365
185 Ga0307416_100754980 3300032002 Bacteria 1066
186 Ga0316593_10014334 3300032168 Bacteria 2362
187 Ga0307510_10132546 3300033180 Bacteria 2160
188 Ga0373943_0103604 3300035170 Bacteria 1492
189 Ga0373955_0029043 3300035172 Bacteria 2873
190 Ga0316574_0044986 3300035398 Bacteria 2732
191 Ga0316584_0027799 3300036712 Bacteria 4165
192 Ga0373925_0002126 3300037068 Bacteria 16208
193 Ga0395899_0033134 3300037312 Bacteria 3881
194 Ga0395900_0006931 3300037418 Bacteria 11757
195 Ga0395900_0148082 3300037418 Bacteria 2400
196 Ga0395898_0000098 3300037466 Bacteria 229806
197 Ga0395898_0029808 3300037466 Bacteria 5462
198 Ga0395898_0121560 3300037466 Bacteria 2502
199 Ga0395905_0014602 3300037471 Bacteria 7492
200 Ga0395901_0001393 3300038443 Bacteria 25272
201 Ga0395901_0035090 3300038443 Bacteria 5183
202 Ga0400483_008727 3300039062 Bacteria 3102
203 Ga0466972_0018960 3300044658 Bacteria 3438
204 Ga0466972_0243333 3300044658 Bacteria 841
205 Ga0466965_0008428 3300044683 Bacteria 4771
206 Ga0466965_0220544 3300044683 Bacteria 1010
207 Ga0466966_0014616 3300044684 Bacteria 5196
208 Ga0466966_0065068 3300044684 Bacteria 2294
209 Ga0466961_0021027 3300044693 Bacteria 4199
210 Ga0466961_0047155 3300044693 Bacteria 2755
211 Ga0466963_0110230 3300044694 Bacteria 1889
212 Ga0466964_0226801 3300044706 Bacteria 910
213 Ga0466971_0026467 3300044719 Bacteria 2593
214 Ga0466968_0021443 3300044735 Bacteria 2617
215 Ga0466968_0054514 3300044735 Bacteria 1714
216 Ga0466970_0033986 3300044765 Bacteria 2697
217 Ga0466957_0153820 3300044842 Bacteria 1489
218 Ga0466960_0025055 3300044901 Bacteria 2696
219 Ga0466959_0027122 3300045049 Bacteria 4249
220 Ga0466959_0065868 3300045049 Bacteria 2628
221 Ga0466967_0017661 3300045976 Bacteria 5674
222 Ga0466967_0114302 3300045976 Bacteria 2485
223 Ga0466967_0124071 3300045976 Bacteria 2390
224 Ga0466967_0142172 3300045976 Bacteria 2236
225 Ga0466967_0296998 3300045976 Bacteria 1553
226 Ga0495592_0112644 3300046454 Bacteria 1923
227 Ga0495651_0003688 3300046462 Bacteria 11729
228 Ga0495650_0003615 3300046471 Bacteria 11141
229 Ga0495664_0015836 3300046477 Bacteria 4290
230 Ga0495664_0238895 3300046477 Bacteria 1099
231 Ga0495618_0050535 3300046514 Bacteria 2626
232 Ga0495652_0000885 3300046529 Bacteria 34425
233 Ga0495652_0058458 3300046529 Bacteria 3264
234 Ga0495645_0010401 3300046543 Bacteria 6521
235 Ga0495635_0011253 3300046663 Bacteria 6275
236 Ga0495599_0029507 3300046678 Bacteria 3439
237 Ga0495623_0013866 3300046679 Bacteria 5225
238 Ga0495600_0016462 3300046809 Bacteria 4693
239 Ga0495674_0114480 3300047319 Bacteria 2284
240 Ga0495674_0433160 3300047319 Bacteria 1058
241 Ga0495684_0098826 3300047471 Bacteria 2207
242 Ga0495686_0015634 3300047472 Bacteria 5175
243 Ga0496102_0242033 3300048905 Bacteria 1701
244 Ga0496105_0022924 3300048908 Bacteria 5062
245 Ga0496114_0099496 3300048917 Bacteria 2480
246 Ga0496117_0000084 3300048920 Bacteria 214308
247 Ga0496117_0001796 3300048920 Bacteria 29192
248 Ga0496117_0015825 3300048920 Bacteria 6401
249 Ga0496117_0018793 3300048920 Bacteria 5708
250 Ga0496118_0000240 3300048921 Bacteria 96796
251 Ga0496119_0000552 3300048922 Bacteria 51035
252 Ga0496119_0015290 3300048922 Bacteria 5926
253 Ga0496119_0253052 3300048922 Bacteria 887
254 Ga0496120_0000586 3300048923 Bacteria 55320
255 Ga0496120_0053869 3300048923 Bacteria 2284
256 Ga0496121_0000025 3300048924 Bacteria 453467
257 Ga0496122_0045331 3300048925 Bacteria 3419
258 Ga0496123_0018378 3300048926 Bacteria 5565
259 Ga0496124_0000070 3300048927 Bacteria 220875
260 Ga0496124_0003516 3300048927 Bacteria 19082
261 Ga0496124_0237558 3300048927 Bacteria 1357
262 Ga0496126_0172812 3300048929 Bacteria 1840
263 Ga0496126_0270585 3300048929 Bacteria 1410
264 Ga0495682_0005015 3300049460 Bacteria 5564
265 Ga0501031_0012247 3300049568 Bacteria 5590
266 Ga0501031_0101830 3300049568 Bacteria 1874
267 Ga0501032_0004923 3300049569 Bacteria 9993
268 Ga0501032_0042592 3300049569 Bacteria 3079
269 Ga0501032_0093093 3300049569 Bacteria 1999
270 Ga0501033_0012699 3300049570 Bacteria 6422
271 Ga0501033_0021890 3300049570 Bacteria 4823
272 Ga0501033_0053236 3300049570 Bacteria 2997
273 Ga0501033_0095066 3300049570 Bacteria 2178
274 Ga0501033_0141383 3300049570 Bacteria 1739
275 Ga0501033_0196735 3300049570 Bacteria 1441
276 Ga0501033_0414285 3300049570 Bacteria 939
277 Ga0501034_0000170 3300049571 Bacteria 120823
278 Ga0501034_0001472 3300049571 Bacteria 31159
279 Ga0501034_0005219 3300049571 Bacteria 14253
280 Ga0501034_0012879 3300049571 Bacteria 8625
281 Ga0501034_0029771 3300049571 Bacteria 5550
282 Ga0501034_0045834 3300049571 Bacteria 4417
283 Ga0501034_0156154 3300049571 Bacteria 2255
284 Ga0501034_0220792 3300049571 Bacteria 1848
285 Ga0501034_0233538 3300049571 Bacteria 1787
286 Ga0501036_0002790 3300049572 Bacteria 13837
287 Ga0501036_0086453 3300049572 Bacteria 2650
288 Ga0501036_0104186 3300049572 Bacteria 2399
289 Ga0501036_0306045 3300049572 Bacteria 1329
290 Ga0501036_0480051 3300049572 Bacteria 1035
291 Ga0501037_0002321 3300049573 Bacteria 13750
292 Ga0501037_0012763 3300049573 Bacteria 6188
293 Ga0501038_0005112 3300049574 Bacteria 12193
294 Ga0501038_0358980 3300049574 Bacteria 1133
295 Ga0501039_0000795 3300049575 Bacteria 22728
296 Ga0501040_0150252 3300049576 Bacteria 1643
297 Ga0501041_0065570 3300049577 Bacteria 2225
298 Ga0501042_0017912 3300049578 Bacteria 4896
299 Ga0501042_0139929 3300049578 Bacteria 1745
300 Ga0501043_0013742 3300049579 Bacteria 6334
301 Ga0501043_0017353 3300049579 Bacteria 5646
302 Ga0501043_0021435 3300049579 Bacteria 5066
303 Ga0501043_0044317 3300049579 Bacteria 3498
304 Ga0501046_0007479 3300049580 Bacteria 9591
305 Ga0501046_0022748 3300049580 Bacteria 5161
306 Ga0501046_0044424 3300049580 Bacteria 3534
307 Ga0501046_0061539 3300049580 Bacteria 2934
308 Ga0501047_0000910 3300049581 Bacteria 30244
309 Ga0501047_0015974 3300049581 Bacteria 7158
310 Ga0501047_0023095 3300049581 Bacteria 5970
311 Ga0501047_0288194 3300049581 Bacteria 1486
312 Ga0501048_0042842 3300049582 Bacteria 3240
313 Ga0501048_0168077 3300049582 Bacteria 1553
314 Ga0501070_0000050 3300049586 Bacteria 103310
315 Ga0501070_0026852 3300049586 Bacteria 4829
316 Ga0501070_0041918 3300049586 Bacteria 3812
317 Ga0501070_0060776 3300049586 Bacteria 3132
318 Ga0501071_0185465 3300049587 Bacteria 1559
319 Ga0501072_0008109 3300049588 Bacteria 7970
320 Ga0501073_0103983 3300049589 Bacteria 1971
321 Ga0501073_0209763 3300049589 Bacteria 1346
322 Ga0501073_0386475 3300049589 Bacteria 967
323 Ga0501077_0014985 3300049593 Bacteria 4874
324 Ga0501079_0012865 3300049741 Bacteria 6387
325 Ga0501079_0024080 3300049741 Bacteria 4671
326 Ga0501080_0017544 3300049742 Bacteria 6620
327 Ga0501081_0064246 3300049743 Bacteria 2549
328 Ga0501083_0000016 3300049744 Bacteria 156309
329 Ga0501035_0001210 3300049822 Bacteria 26894
330 Ga0501035_0001900 3300049822 Bacteria 20989
331 Ga0501035_0007227 3300049822 Bacteria 10389
332 Ga0501035_0016878 3300049822 Bacteria 6731
333 Ga0501035_0166836 3300049822 Bacteria 1904
334 Ga0501044_0003000 3300049823 Bacteria 19107
335 Ga0501044_0004758 3300049823 Bacteria 15183
336 Ga0501044_0025651 3300049823 Bacteria 6248
337 Ga0501044_0054266 3300049823 Bacteria 4121
338 Ga0501044_0151442 3300049823 Bacteria 2301
339 Ga0501045_0033315 3300049824 Bacteria 3735
340 nmdc:mga00v17_2839_c1 3300050491 Bacteria 8899
341 nmdc:mga0yw44_6040_c1 3300050492 Bacteria 5802
342 nmdc:mga0yw44_7099_c1 3300050492 Bacteria 5482
343 nmdc:mga06z11_243891_c1 3300050494 Bacteria 1056
344 nmdc:mga05p37_133640_c1 3300050507 Bacteria 3043
345 nmdc:mga05p37_786237_c1 3300050507 Bacteria 1043
346 nmdc:mga06r32_38161_c1 3300050510 Bacteria 4549
347 nmdc:mga08x19_172626_c1 3300050514 Bacteria 1473
348 Ga0495601_0026519 3300053077 Bacteria 3578
349 Ga0495612_0014810 3300053078 Bacteria 3129
350 Ga0500635_0029514 3300053080 Bacteria 1761
351 Ga0495619_0032605 3300053085 Bacteria 3381
352 Ga0500646_0072120 3300053090 Bacteria 1038
353 Ga0500651_0004187 3300053093 Bacteria 8046
354 Ga0500556_0000085 3300053104 Bacteria 87978
355 Ga0500593_003237 3300053117 Bacteria 6123
356 Ga0500595_007947 3300053119 Bacteria 4360
357 Ga0500642_0021756 3300053130 Bacteria 2546
358 Ga0500559_0000163 3300053136 Bacteria 52657
359 Ga0500559_0000532 3300053136 Bacteria 26601
360 Ga0500559_0018971 3300053136 Bacteria 2906
361 Ga0500568_0000161 3300053139 Bacteria 57643
362 Ga0500568_0000165 3300053139 Bacteria 57124
363 Ga0500568_0000852 3300053139 Bacteria 21466
364 Ga0500568_0003488 3300053139 Bacteria 8741
365 Ga0500568_0008765 3300053139 Bacteria 4850
366 Ga0500588_0001377 3300053146 Bacteria 4614
367 Ga0500616_0000403 3300053153 Bacteria 59207
368 Ga0500616_0074302 3300053153 Bacteria 1724
369 Ga0500622_0000001 3300053156 Bacteria 657715
370 Ga0500645_003678 3300053730 Bacteria 6127
371 Ga0501084_0248458 3300054114 Bacteria 1502
372 Ga0501084_0305259 3300054114 Bacteria 1344
373 Ga0466962_0007370 3300061719 Bacteria 5280
374 Ga0530510_0042572 3300061734 Bacteria 3281
375 Ga0530510_0140137 3300061734 Bacteria 1782
376 2516086902 2515154202 Bacteria 5471270
377 2644180980 2643221632 Bacteria 3406696
378 2644197082 2643221635 Bacteria 2632343
379 2753302580 2751185788 Bacteria 4541048
380 2808902917 2808606372 Bacteria 4649509
381 2852646297 2852643534 Bacteria 3013378
382 2852680883 2852677369 Bacteria 3768884
383 2857732174 2857729791 Bacteria 4040535
384 2857735994 2857733635 Bacteria 3532004
385 2857737531 2857737099 Bacteria 3104305
386 2887483088 2887478801 Bacteria 8972725
387 2897562218 2897561785 Bacteria 3256946
388 2904433599 2904430863 Bacteria 3486923
389 2904503878 2904501621 Bacteria 3401437
390 2908676844 2908674828 Bacteria 3382763
391 2909076969 2909074476 Bacteria 3436050
392 2919039581 2919039151 Bacteria 3391018
393 2919042978 2919042368 Bacteria 3905917
394 2919057159 2919055335 Bacteria 3875751
395 2919527214 2919523602 Bacteria 3788128
396 2928105906 2928104781 Bacteria 3877447
397 2928124928 2928121344 Bacteria 3972376
398 2928154933 2928153084 Bacteria 4020257
399 2928501986 2928500415 Bacteria 3384541
400 2939660189 2939657138 Bacteria 3740283
401 2966926409 2966924647 Bacteria 3268643
402 2984554738 2984551494 Bacteria 3877562
403 8046355743 8046352972 Bacteria 3613806
404 8055040534 8055037949 Bacteria 3337834
405 8057345791 8057345674 Bacteria 4160394
406 Ga0316576_10021498
407 JGI24739J22299_10017127
408 JGI24737J22298_10017424
409 JGI24735J21928_10009115
410 Ga0006562J51391_1169909
411 Ga0055525_1001990
412 Ga0055527_1000005
413 Ga0055542_1000006
414 Ga0055529_1000013
415 Ga0065714_10010171
416 Ga0070658_10000044
417 Ga0070658_10000771
418 Ga0070658_10006153
419 Ga0070683_100153202
420 Ga0070666_10064259
421 Ga0070682_100279994
422 Ga0070682_100363558
423 Ga0068868_100004369
424 Ga0070660_100001735
425 Ga0070660_100093121
426 Ga0070661_100016569
427 Ga0070659_100001130
428 Ga0070667_100100325
429 Ga0070705_100058332
430 Ga0070694_100098290
431 Ga0070685_10004099
432 Ga0070679_100432564
433 Ga0070684_100058744
434 Ga0068853_100016717
435 Ga0068853_100123963
436 Ga0070672_100001152
437 Ga0070696_100188096
438 Ga0070704_100064749
439 Ga0068855_100000144
440 Ga0068855_100004634
441 Ga0068855_100011498
442 Ga0068855_100016791
443 Ga0068855_100029512
444 Ga0068857_100000025
445 Ga0068857_100193817
446 Ga0068856_100020049
447 Ga0068856_100054961
448 Ga0068852_100001068
449 Ga0068852_100006734
450 Ga0068859_100194756
451 Ga0068864_100135231
452 Ga0068861_100063731
453 Ga0068861_100152556
454 Ga0068851_10000001
455 Ga0068858_100105374
456 Ga0068862_100287872
457 Ga0068862_100620812
458 Ga0081539_10013561
459 Ga0081539_10046966
460 Ga0070717_10140516
461 Ga0075365_10000134
462 Ga0075365_10018160
463 Ga0075365_10173884
464 Ga0075364_10002836
465 Ga0075369_10120055
466 Ga0075433_10028145
467 Ga0075434_100001167
468 Ga0075436_100056619
469 Ga0097620_100194754
470 Ga0075435_100013421
471 Ga0105240_10000002
472 Ga0105240_10000314
473 Ga0105240_10000538
474 Ga0105240_10015209
475 Ga0105240_10018353
476 Ga0105240_10743782
477 Ga0111539_10055327
478 Ga0105245_10024201
479 Ga0105247_10006529
480 Ga0114129_10626052
481 Ga0105241_10000396
482 Ga0105241_10059083
483 Ga0105248_10000124
484 Ga0105248_10015953
485 Ga0105237_10080115
486 Ga0105238_10002448
487 Ga0105238_10004324
488 Ga0105238_10004876
489 Ga0105238_10116615
490 Ga0105238_10292068
491 Ga0105238_10376086
492 Ga0105238_10440031
493 Ga0105238_10704917
494 Ga0105239_10001868
495 Ga0105239_10005793
496 Ga0105239_10054159
497 Ga0105239_10134378
498 Ga0105246_10032809
499 Ga0157371_10003891
500 Ga0157370_10001023
501 Ga0157370_10110530
502 Ga0157369_10001627
503 Ga0157369_10022008
504 Ga0157369_10206065
505 Ga0157369_10359282
506 Ga0157369_10359516
507 Ga0157369_10375730
508 Ga0157374_10059559
509 Ga0157374_10237975
510 Ga0157378_10027810
511 Ga0157378_10143525
512 Ga0163162_10451410
513 Ga0163163_10003889
514 Ga0157380_10012081
515 Ga0157379_10005945
516 Ga0209672_100003
517 Ga0209147_101119
518 Ga0209563_100250
519 Ga0209148_1000004
520 Ga0209148_1000857
521 Ga0209233_1013760
522 Ga0209455_1000046
523 Ga0209455_1003493
524 Ga0207656_10000002
525 Ga0207710_10043429
526 Ga0207688_10065594
527 Ga0207705_10000001
528 Ga0207705_10008960
529 Ga0207705_10026962
530 Ga0207654_10000001
531 Ga0207707_10363589
532 Ga0207695_10000002
533 Ga0207695_10000012
534 Ga0207695_10000983
535 Ga0207695_10005519
536 Ga0207695_10185313
537 Ga0207671_10000002
538 Ga0207657_10000531
539 Ga0207657_10063116
540 Ga0207649_10011403
541 Ga0207694_10000006
542 Ga0207694_10000022
543 Ga0207694_10113065
544 Ga0207694_10234440
545 Ga0207694_10263312
546 Ga0207659_10160959
547 Ga0207687_10014781
548 Ga0207644_10095808
549 Ga0207690_10003414
550 Ga0207691_10033394
551 Ga0207711_10000940
552 Ga0207711_10030187
553 Ga0207661_10324843
554 Ga0207667_10000467
555 Ga0207667_10001831
556 Ga0207667_10006145
557 Ga0207667_10014919
558 Ga0207667_10128952
559 Ga0207667_10234848
560 Ga0207658_10143438
561 Ga0207677_10021283
562 Ga0207639_10125317
563 Ga0207702_10015318
564 Ga0207702_10698184
565 Ga0207702_10721370
566 Ga0207674_10000153
567 Ga0207675_100056153
568 Ga0207698_10000695
569 Ga0207698_10004561
570 Ga0207698_10031533
571 Ga0207698_10120396
572 Ga0207698_10430281
573 Ga0209995_1001898
574 Ga0209999_1002473
575 Ga0209971_1000485
576 Ga0209974_10011289
577 Ga0268266_10049857
578 Ga0268264_10116359
579 Ga0307515_10296441
580 Ga0307513_10080983
581 Ga0307509_10068194
582 Ga0307508_10082497
583 Ga0307514_10001210
584 Ga0307516_10035375
585 Ga0307405_10291329
586 Ga0307405_10402977
587 Ga0307410_10045267
588 Ga0307410_10150519
589 Ga0307416_100117003
590 Ga0307416_100754980
591 Ga0316593_10014334
592 Ga0307510_10132546
593 Ga0373943_0103604
594 Ga0373955_0029043
595 Ga0316574_0044986
596 Ga0316584_0027799
597 Ga0373925_0002126
598 Ga0395899_0033134
599 Ga0395900_0006931
600 Ga0395900_0148082
601 Ga0395898_0000098
602 Ga0395898_0029808
603 Ga0395898_0121560
604 Ga0395905_0014602
605 Ga0395901_0001393
606 Ga0395901_0035090
607 Ga0400483_008727
608 Ga0466972_0018960
609 Ga0466972_0243333
610 Ga0466965_0008428
611 Ga0466965_0220544
612 Ga0466966_0014616
613 Ga0466966_0065068
614 Ga0466961_0021027
615 Ga0466961_0047155
616 Ga0466963_0110230
617 Ga0466964_0226801
618 Ga0466971_0026467
619 Ga0466968_0021443
620 Ga0466968_0054514
621 Ga0466970_0033986
622 Ga0466957_0153820
623 Ga0466960_0025055
624 Ga0466959_0027122
625 Ga0466959_0065868
626 Ga0466967_0017661
627 Ga0466967_0114302
628 Ga0466967_0124071
629 Ga0466967_0142172
630 Ga0466967_0296998
631 Ga0495592_0112644
632 Ga0495651_0003688
633 Ga0495650_0003615
634 Ga0495664_0015836
635 Ga0495664_0238895
636 Ga0495618_0050535
637 Ga0495652_0000885
638 Ga0495652_0058458
639 Ga0495645_0010401
640 Ga0495635_0011253
641 Ga0495599_0029507
642 Ga0495623_0013866
643 Ga0495600_0016462
644 Ga0495674_0114480
645 Ga0495674_0433160
646 Ga0495684_0098826
647 Ga0495686_0015634
648 Ga0496102_0242033
649 Ga0496105_0022924
650 Ga0496114_0099496
651 Ga0496117_0000084
652 Ga0496117_0001796
653 Ga0496117_0015825
654 Ga0496117_0018793
655 Ga0496118_0000240
656 Ga0496119_0000552
657 Ga0496119_0015290
658 Ga0496119_0253052
659 Ga0496120_0000586
660 Ga0496120_0053869
661 Ga0496121_0000025
662 Ga0496122_0045331
663 Ga0496123_0018378
664 Ga0496124_0000070
665 Ga0496124_0003516
666 Ga0496124_0237558
667 Ga0496126_0172812
668 Ga0496126_0270585
669 Ga0495682_0005015
670 Ga0501031_0012247
671 Ga0501031_0101830
672 Ga0501032_0004923
673 Ga0501032_0042592
674 Ga0501032_0093093
675 Ga0501033_0012699
676 Ga0501033_0021890
677 Ga0501033_0053236
678 Ga0501033_0095066
679 Ga0501033_0141383
680 Ga0501033_0196735
681 Ga0501033_0414285
682 Ga0501034_0000170
683 Ga0501034_0001472
684 Ga0501034_0005219
685 Ga0501034_0012879
686 Ga0501034_0029771
687 Ga0501034_0045834
688 Ga0501034_0156154
689 Ga0501034_0220792
690 Ga0501034_0233538
691 Ga0501036_0002790
692 Ga0501036_0086453
693 Ga0501036_0104186
694 Ga0501036_0306045
695 Ga0501036_0480051
696 Ga0501037_0002321
697 Ga0501037_0012763
698 Ga0501038_0005112
699 Ga0501038_0358980
700 Ga0501039_0000795
701 Ga0501040_0150252
702 Ga0501041_0065570
703 Ga0501042_0017912
704 Ga0501042_0139929
705 Ga0501043_0013742
706 Ga0501043_0017353
707 Ga0501043_0021435
708 Ga0501043_0044317
709 Ga0501046_0007479
710 Ga0501046_0022748
711 Ga0501046_0044424
712 Ga0501046_0061539
713 Ga0501047_0000910
714 Ga0501047_0015974
715 Ga0501047_0023095
716 Ga0501047_0288194
717 Ga0501048_0042842
718 Ga0501048_0168077
719 Ga0501070_0000050
720 Ga0501070_0026852
721 Ga0501070_0041918
722 Ga0501070_0060776
723 Ga0501071_0185465
724 Ga0501072_0008109
725 Ga0501073_0103983
726 Ga0501073_0209763
727 Ga0501073_0386475
728 Ga0501077_0014985
729 Ga0501079_0012865
730 Ga0501079_0024080
731 Ga0501080_0017544
732 Ga0501081_0064246
733 Ga0501083_0000016
734 Ga0501035_0001210
735 Ga0501035_0001900
736 Ga0501035_0007227
737 Ga0501035_0016878
738 Ga0501035_0166836
739 Ga0501044_0003000
740 Ga0501044_0004758
741 Ga0501044_0025651
742 Ga0501044_0054266
743 Ga0501044_0151442
744 Ga0501045_0033315
745 nmdc:mga00v17_2839_c1
746 nmdc:mga0yw44_6040_c1
747 nmdc:mga0yw44_7099_c1
748 nmdc:mga06z11_243891_c1
749 nmdc:mga05p37_133640_c1
750 nmdc:mga05p37_786237_c1
751 nmdc:mga06r32_38161_c1
752 nmdc:mga08x19_172626_c1
753 Ga0495601_0026519
754 Ga0495612_0014810
755 Ga0500635_0029514
756 Ga0495619_0032605
757 Ga0500646_0072120
758 Ga0500651_0004187
759 Ga0500556_0000085
760 Ga0500593_003237
761 Ga0500595_007947
762 Ga0500642_0021756
763 Ga0500559_0000163
764 Ga0500559_0000532
765 Ga0500559_0018971
766 Ga0500568_0000161
767 Ga0500568_0000165
768 Ga0500568_0000852
769 Ga0500568_0003488
770 Ga0500568_0008765
771 Ga0500588_0001377
772 Ga0500616_0000403
773 Ga0500616_0074302
774 Ga0500622_0000001
775 Ga0500645_003678
776 Ga0501084_0248458
777 Ga0501084_0305259
778 Ga0466962_0007370
779 Ga0530510_0042572
780 Ga0530510_0140137
781 2516086902
782 2644180980
783 2644197082
784 2753302580
785 2808902917
786 2852646297
787 2852680883
788 2857732174
789 2857735994
790 2857737531
791 2887483088
792 2897562218
793 2904433599
794 2904503878
795 2908676844
796 2909076969
797 2919039581
798 2919042978
799 2919057159
800 2919527214
801 2928105906
802 2928124928
803 2928154933
804 2928501986
805 2939660189
806 2966926409
807 2984554738
808 8046355743
809 8055040534
810 8057345791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

15

251

0.98

PF12804

NTP_transf_3

MobA-like NTP transferase domain

16

179

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mp4-assembly1.cif.gz_A w224h variant of s. enterica rmla 0.9885 2 284
1iim-assembly1.cif.gz_A thymidylyltransferase complexed with ttp 0.9844 2 284
6b5e-assembly1.cif.gz_H mycobacterium tuberculosis rmla in complex with dtdp-glucose 0.9843 1 285
6b5k-assembly1.cif.gz_A-2 mycobacterium tuberculosis rmla in complex with mg/dttp 0.9843 1 285
6b5e-assembly1.cif.gz_A mycobacterium tuberculosis rmla in complex with dtdp-glucose 0.9842 1 285
ID Description Score Start End Superfamily
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9825 2 289 3.90.550.10
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9627 2 289 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9506 1 237 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9056 1 237 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8995 1 222 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A6I0DZI6-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9988 1 106 GO:0008879
GO:0045226
AF-A0A351VA12-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9987 1 112 GO:0008879
GO:0045226
AF-A0A6I3TEG1-F1-model_v4 deleted 0.9982 14 122
AF-A0A846Q3P9-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9975 1 98 GO:0008879
GO:0045226
AF-A0A3D3QY14-F1-model_v4 deleted 0.9974 1 200

Map