F435830

General Info

Members Datasets Scaffolds Average Seq Length
404 258 808 404

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2773857925|2774868919
Length 477
Sequence VALFYFRVRIAERWIPWLLAALALAGALGPTITNEGLVMKTTPAGSETLHHHTRRMGGRDPHEAHRVATPLELLFDLTFVVSFGLAASQFAHELAEGHYAAALIGFGFASFAICWAWVNFSWFSSAYDTDDWIFRLVTMVQMIGVLVLAIGLPRMFASIEHGEHLDNSVMVLGYVIMRVAMVFQWLRAARQDPARHRACLTYAVAISIAQLGWVVLIFFDFSLGVTFILVCTLVLIELAGPVTAERKDGGTPWHAHHIAERHGLFAIIALGEGIVGTLATLSAVVEEQGWTTDAALVCIAGIGLTFGMWWVYYILPSAQILEAHRNRSFVWGYGQMVIVGSIVATGAGLHVAAYFIEHKAHIGALATVLCVAIPVSVYLGSIYALYTYLVGRFDPFHAWLLIGTATVATLAVIAAFAGIDMAACLVILMLAPAVTVFGYEILGHRHQAEALVKEDAATLIEHQRVHVDSSLPHTHRQ

Samples

Sample ID Description Type Environment
1 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
65 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
66 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
98 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
99 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
118 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
119 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
120 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
121 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
122 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
172 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
173 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
174 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
175 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
176 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
184 2773857925 Microvirga vignae BR3299 Isolate Unclassified
185 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
186 2509276019 Ensifer aridi TW10 Isolate Nodule
187 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
188 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
189 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
190 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
191 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
192 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
193 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
194 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
195 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
196 2643221557 Ensifer sp. Root558 Isolate Unclassified
197 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
198 2643221610 Ensifer sp. Root74 Isolate Unclassified
199 2643221615 Nocardioides sp. Root224 Isolate Unclassified
200 2643221618 Ensifer sp. Root231 Isolate Unclassified
201 2643221626 Ensifer sp. Root31 Isolate Unclassified
202 2643221655 Ensifer sp. Root1252 Isolate Unclassified
203 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
204 2643221659 Ensifer sp. Root127 Isolate Unclassified
205 2643221668 Ensifer sp. Root423 Isolate Unclassified
206 2643221675 Ensifer sp. Root1298 Isolate Unclassified
207 2643221680 Ensifer sp. Root1312 Isolate Unclassified
208 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
209 2643221698 Ensifer sp. Root142 Isolate Unclassified
210 2643221712 Ensifer sp. Root258 Isolate Unclassified
211 2643221726 Ensifer sp. Root954 Isolate Unclassified
212 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
213 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
214 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
215 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
216 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
217 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
218 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
219 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
220 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
221 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
222 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
223 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
224 2844163670 Ensifer sp. 1H6 Isolate Unclassified
225 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
226 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
227 2855730933 Achromobacter sp. HZ28 Isolate Nodule
228 2855767633 Achromobacter sp. HZ34 Isolate Nodule
229 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
230 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
231 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
232 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
233 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
234 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
235 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
236 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
237 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
238 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
239 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
240 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
241 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
242 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
243 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
244 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
245 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
246 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
247 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
248 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
249 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
250 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
251 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
252 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
253 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
254 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
255 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
256 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
257 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
258 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80.94
Metatranscriptomes 0
Isolates 19.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.35
Nodule 5.94
Rhizoplane 0.5
Rhizosphere 66.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1000555 3300002741 Bacteria 22318
2 JGI25152J39213_1000109 3300002773 Bacteria 57724
3 JGI25159J45721_1000014 3300002987 Bacteria 147809
4 JGI25151J46595_10000265 3300003187 Bacteria 59850
5 JGI25151J46595_10027148 3300003187 Bacteria 2300
6 JGI25165J46597_1000079 3300003214 Bacteria 179163
7 rootH1_10078654 3300003316 Bacteria 4457
8 JGI25160J50197_1000020 3300003354 Bacteria 232739
9 JGI25161J50226_1001410 3300003374 Bacteria 7292
10 Ga0055526_1005168 3300003771 Bacteria 7591
11 Ga0055524_1012812 3300003775 Bacteria 3199
12 Ga0055536_1011464 3300003781 Bacteria 3396
13 Ga0055543_1000768 3300004625 Bacteria 15975
14 Ga0065165_1000013 3300005262 Bacteria 301887
15 Ga0070658_10059953 3300005327 Bacteria 3098
16 Ga0070661_100000160 3300005344 Bacteria 55287
17 Ga0070669_100288757 3300005353 Bacteria 1316
18 Ga0070671_100028503 3300005355 Bacteria 4598
19 Ga0070674_100010566 3300005356 Bacteria 5586
20 Ga0070711_100064083 3300005439 Bacteria 2567
21 Ga0070700_100094806 3300005441 Bacteria 1955
22 Ga0070694_100026016 3300005444 Bacteria 3790
23 Ga0070663_100006263 3300005455 Bacteria 7137
24 Ga0070707_100048564 3300005468 Bacteria 4065
25 Ga0070698_100002736 3300005471 Bacteria 19380
26 Ga0070698_100018030 3300005471 Bacteria 7432
27 Ga0070698_100057431 3300005471 Bacteria 3938
28 Ga0070698_100077026 3300005471 Bacteria 3335
29 Ga0070699_100031660 3300005518 Bacteria 4567
30 Ga0070697_100069285 3300005536 Bacteria 2889
31 Ga0070697_100095588 3300005536 Bacteria 2464
32 Ga0070697_100177655 3300005536 Bacteria 1804
33 Ga0070697_100303398 3300005536 Bacteria 1373
34 Ga0070695_100050769 3300005545 Bacteria 2659
35 Ga0070695_100110119 3300005545 Bacteria 1867
36 Ga0070695_100122129 3300005545 Bacteria 1783
37 Ga0070696_100032741 3300005546 Bacteria 3567
38 Ga0070696_100133070 3300005546 Bacteria 1811
39 Ga0070696_100158173 3300005546 Bacteria 1668
40 Ga0068855_100163637 3300005563 Bacteria 2523
41 Ga0070702_100034685 3300005615 Bacteria 2782
42 Ga0068862_100027289 3300005844 Bacteria 4806
43 Ga0068862_100081978 3300005844 Bacteria 2799
44 Ga0081455_10109110 3300005937 Bacteria 2203
45 Ga0075365_10077899 3300006038 Bacteria 2240
46 Ga0075363_100024754 3300006048 Bacteria 3054
47 Ga0075363_100036061 3300006048 Bacteria 2592
48 Ga0075364_10109113 3300006051 Bacteria 1846
49 Ga0075364_10172951 3300006051 Bacteria 1460
50 Ga0075362_10033188 3300006177 Bacteria 2244
51 Ga0075369_10007294 3300006186 Bacteria 4206
52 Ga0075370_10091246 3300006353 Bacteria 1757
53 Ga0075428_100027390 3300006844 Bacteria 6305
54 Ga0075428_100119622 3300006844 Bacteria 2867
55 Ga0075428_100129698 3300006844 Bacteria 2743
56 Ga0075428_100295322 3300006844 Bacteria 1742
57 Ga0075431_100024725 3300006847 Bacteria 6158
58 Ga0075431_100295130 3300006847 Bacteria 1639
59 Ga0075433_10025954 3300006852 Bacteria 4956
60 Ga0075433_10049418 3300006852 Bacteria 3659
61 Ga0075434_100018861 3300006871 Bacteria 6668
62 Ga0075434_100021346 3300006871 Bacteria 6293
63 Ga0075434_100026066 3300006871 Bacteria 5724
64 Ga0075434_100114987 3300006871 Bacteria 2703
65 Ga0075429_100069895 3300006880 Bacteria 3057
66 Ga0075436_100029961 3300006914 Bacteria 3743
67 Ga0075436_100033872 3300006914 Bacteria 3520
68 Ga0075436_100085548 3300006914 Bacteria 2189
69 Ga0075436_100105574 3300006914 Bacteria 1964
70 Ga0075435_100040305 3300007076 Bacteria 3729
71 Ga0075435_100070668 3300007076 Bacteria 2849
72 Ga0075435_100093268 3300007076 Bacteria 2487
73 Ga0075435_100149562 3300007076 Bacteria 1962
74 Ga0099795_10033514 3300007788 Bacteria 1784
75 Ga0105244_10006177 3300009036 Bacteria 7813
76 Ga0105240_10055861 3300009093 Bacteria 4942
77 Ga0111539_10010027 3300009094 Bacteria 11939
78 Ga0111539_10017652 3300009094 Bacteria 8833
79 Ga0111539_10089667 3300009094 Bacteria 3614
80 Ga0114129_10022110 3300009147 Bacteria 9025
81 Ga0114129_10149360 3300009147 Bacteria 3198
82 Ga0114129_10223646 3300009147 Bacteria 2538
83 Ga0114129_10236456 3300009147 Bacteria 2458
84 Ga0114129_10311679 3300009147 Bacteria 2094
85 Ga0105243_10009399 3300009148 Bacteria 7450
86 Ga0105242_10249376 3300009176 Bacteria 1599
87 Ga0105237_10038673 3300009545 Bacteria 4817
88 Ga0105238_10040306 3300009551 Bacteria 4733
89 Ga0105239_10030437 3300010375 Bacteria 5936
90 Ga0105239_10177334 3300010375 Bacteria 2384
91 Ga0105246_10019309 3300011119 Bacteria 4353
92 Ga0105246_10082297 3300011119 Bacteria 2297
93 Ga0105246_10095545 3300011119 Bacteria 2152
94 Ga0105246_10155886 3300011119 Bacteria 1734
95 Ga0157371_10176178 3300013102 Bacteria 1529
96 Ga0157370_10009575 3300013104 Bacteria 10318
97 Ga0157369_10086635 3300013105 Bacteria 3345
98 Ga0171463_1003 3300013249 Bacteria 695693
99 Ga0157378_10104510 3300013297 Bacteria 2589
100 Ga0157372_10121860 3300013307 Bacteria 2996
101 Ga0157380_10024473 3300014326 Bacteria 4571
102 Ga0157380_10059550 3300014326 Bacteria 3048
103 Ga0183363_1085 3300015690 Bacteria 28396
104 Ga0214542_1012200 3300021321 Bacteria 11255
105 Ga0214543_1000038 3300021327 Bacteria 182106
106 Ga0207425_1007216 3300025245 Bacteria 2956
107 Ga0209026_1000118 3300025250 Bacteria 130611
108 Ga0209759_1000076 3300025256 Bacteria 175911
109 Ga0209129_1000180 3300025258 Bacteria 90882
110 Ga0209233_1000247 3300025261 Bacteria 87890
111 Ga0209673_1026592 3300025273 Bacteria 1896
112 Ga0209130_1000034 3300025284 Bacteria 302439
113 Ga0209130_1017690 3300025284 Bacteria 1692
114 Ga0209676_1019352 3300025292 Bacteria 2343
115 Ga0209025_1000026 3300025294 Bacteria 519850
116 Ga0209025_1000311 3300025294 Bacteria 108141
117 Ga0209025_1001362 3300025294 Bacteria 32778
118 Ga0209564_1000013 3300025295 Bacteria 775755
119 Ga0209758_1034104 3300025297 Bacteria 2031
120 Ga0209050_1009685 3300025298 Bacteria 4887
121 Ga0209256_1000396 3300025299 Bacteria 69216
122 Ga0209256_1003573 3300025299 Bacteria 10736
123 Ga0207426_1000006 3300025302 Bacteria 1025969
124 Ga0209051_1003723 3300025303 Bacteria 9823
125 Ga0209051_1004857 3300025303 Bacteria 8079
126 Ga0209051_1008029 3300025303 Bacteria 5656
127 Ga0209051_1010204 3300025303 Bacteria 4770
128 Ga0209051_1032204 3300025303 Bacteria 2004
129 Ga0207688_10016441 3300025901 Bacteria 4013
130 Ga0207699_10061925 3300025906 Bacteria 2253
131 Ga0207695_10000190 3300025913 Bacteria 176747
132 Ga0207695_10263570 3300025913 Bacteria 1620
133 Ga0207671_10035935 3300025914 Bacteria 3674
134 Ga0207663_10003106 3300025916 Bacteria 8059
135 Ga0207649_10000029 3300025920 Bacteria 156557
136 Ga0207646_10065117 3300025922 Bacteria 3253
137 Ga0207646_10107832 3300025922 Bacteria 2499
138 Ga0207694_10008166 3300025924 Bacteria 7909
139 Ga0207694_10055941 3300025924 Bacteria 3064
140 Ga0207700_10074734 3300025928 Bacteria 2623
141 Ga0207709_10186218 3300025935 Bacteria 1470
142 Ga0207665_10034950 3300025939 Bacteria 3335
143 Ga0207639_10156129 3300026041 Bacteria 1917
144 Ga0209971_1013523 3300027682 Bacteria 1933
145 Ga0207428_10002027 3300027907 Bacteria 20466
146 Ga0307515_10000154 3300028794 Bacteria 166582
147 Ga0307515_10000285 3300028794 Bacteria 124535
148 Ga0307515_10004744 3300028794 Bacteria 27847
149 Ga0307515_10058049 3300028794 Bacteria 5584
150 Ga0307515_10087371 3300028794 Bacteria 3958
151 Ga0316176_1193234 3300030732 Bacteria 2744
152 Ga0314311_1151601 3300030733 Bacteria 4083
153 Ga0316178_1118312 3300030735 Bacteria 4115
154 Ga0265327_10016080 3300031251 Bacteria 4779
155 Ga0307513_10005286 3300031456 Bacteria 17089
156 Ga0307408_100014633 3300031548 Bacteria 5213
157 Ga0307408_100019143 3300031548 Bacteria 4607
158 Ga0307408_100020305 3300031548 Bacteria 4481
159 Ga0307408_100026368 3300031548 Bacteria 3991
160 Ga0307408_100049545 3300031548 Bacteria 3017
161 Ga0307408_100053051 3300031548 Bacteria 2926
162 Ga0307408_100133610 3300031548 Bacteria 1938
163 Ga0307405_10001802 3300031731 Bacteria 9165
164 Ga0307405_10002619 3300031731 Bacteria 7997
165 Ga0307405_10024590 3300031731 Bacteria 3443
166 Ga0307405_10026595 3300031731 Bacteria 3341
167 Ga0307405_10083646 3300031731 Bacteria 2093
168 Ga0307413_10002843 3300031824 Bacteria 7144
169 Ga0307413_10009752 3300031824 Bacteria 4613
170 Ga0307413_10069557 3300031824 Bacteria 2209
171 Ga0307413_10089694 3300031824 Bacteria 1998
172 Ga0307413_10111376 3300031824 Bacteria 1833
173 Ga0307413_10138112 3300031824 Bacteria 1680
174 Ga0307410_10003768 3300031852 Bacteria 7687
175 Ga0307410_10011738 3300031852 Bacteria 5027
176 Ga0307410_10066040 3300031852 Bacteria 2490
177 Ga0307410_10091329 3300031852 Bacteria 2162
178 Ga0307406_10038434 3300031901 Bacteria 2963
179 Ga0307406_10149696 3300031901 Bacteria 1663
180 Ga0307407_10012633 3300031903 Bacteria 4066
181 Ga0307407_10027097 3300031903 Bacteria 3044
182 Ga0307412_10031683 3300031911 Bacteria 3341
183 Ga0307412_10069295 3300031911 Bacteria 2400
184 Ga0307412_10112477 3300031911 Bacteria 1946
185 Ga0307409_100028147 3300031995 Bacteria 3997
186 Ga0307409_100029899 3300031995 Bacteria 3906
187 Ga0307416_100016859 3300032002 Bacteria 5091
188 Ga0307416_100073539 3300032002 Bacteria 2850
189 Ga0307416_100138331 3300032002 Bacteria 2208
190 Ga0307416_100232203 3300032002 Bacteria 1779
191 Ga0307416_100318243 3300032002 Bacteria 1556
192 Ga0307416_100357748 3300032002 Bacteria 1480
193 Ga0307414_10074763 3300032004 Bacteria 2456
194 Ga0307414_10162615 3300032004 Bacteria 1775
195 Ga0307414_10188109 3300032004 Bacteria 1668
196 Ga0307411_10055312 3300032005 Bacteria 2610
197 Ga0307411_10111637 3300032005 Bacteria 1958
198 Ga0307510_10049407 3300033180 Bacteria 4474
199 Ga0395900_0156842 3300037418 Bacteria 2325
200 Ga0395900_0282730 3300037418 Bacteria 1650
201 Ga0395905_0006501 3300037471 Bacteria 11753
202 Ga0395905_0067978 3300037471 Bacteria 3338
203 Ga0395901_0149970 3300038443 Bacteria 2450
204 Ga0439436_0001436 3300041404 Bacteria 6905
205 Ga0439461_0012447 3300041410 Bacteria 1593
206 Ga0439466_0020270 3300041411 Bacteria 2370
207 Ga0439442_000177 3300042002 Bacteria 16193
208 Ga0439449_0000036 3300042007 Bacteria 39721
209 Ga0439457_002655 3300042014 Bacteria 5046
210 Ga0495638_0005593 3300046460 Bacteria 9289
211 Ga0495638_0014322 3300046460 Bacteria 5367
212 Ga0495645_0057610 3300046543 Bacteria 2820
213 Ga0495668_0028229 3300046616 Bacteria 3174
214 Ga0495625_0005589 3300046660 Bacteria 11404
215 Ga0495625_0182590 3300046660 Bacteria 1394
216 Ga0495686_0005550 3300047472 Bacteria 9921
217 Ga0495686_0145557 3300047472 Bacteria 1395
218 Ga0496112_0013726 3300048915 Bacteria 7489
219 Ga0496119_0046931 3300048922 Bacteria 2692
220 Ga0496120_0002072 3300048923 Bacteria 21552
221 Ga0496126_0019399 3300048929 Bacteria 6697
222 Ga0501031_0035988 3300049568 Bacteria 3229
223 Ga0501032_0000946 3300049569 Bacteria 23464
224 Ga0501032_0003609 3300049569 Bacteria 11782
225 Ga0501032_0075514 3300049569 Bacteria 2245
226 Ga0501033_0000429 3300049570 Bacteria 40229
227 Ga0501034_0000038 3300049571 Bacteria 237795
228 Ga0501034_0225953 3300049571 Bacteria 1822
229 Ga0501036_0024315 3300049572 Bacteria 5107
230 Ga0501037_0000293 3300049573 Bacteria 42480
231 Ga0501037_0009830 3300049573 Bacteria 7020
232 Ga0501038_0091852 3300049574 Bacteria 2542
233 Ga0501038_0117218 3300049574 Bacteria 2199
234 Ga0501039_0014696 3300049575 Bacteria 5988
235 Ga0501039_0058100 3300049575 Bacteria 2995
236 Ga0501040_0053104 3300049576 Bacteria 2775
237 Ga0501040_0192225 3300049576 Bacteria 1448
238 Ga0501043_0000042 3300049579 Bacteria 116080
239 Ga0501043_0057385 3300049579 Bacteria 3057
240 Ga0501047_0228799 3300049581 Bacteria 1714
241 Ga0501048_0016644 3300049582 Bacteria 5421
242 Ga0501048_0027862 3300049582 Bacteria 4102
243 Ga0501048_0112823 3300049582 Bacteria 1920
244 Ga0501067_0019361 3300049583 Bacteria 3767
245 Ga0501069_0000001 3300049585 Bacteria 289100
246 Ga0501070_0000358 3300049586 Bacteria 41528
247 Ga0501071_0010567 3300049587 Bacteria 6191
248 Ga0501071_0175704 3300049587 Bacteria 1604
249 Ga0501072_0048025 3300049588 Bacteria 3361
250 Ga0501073_0000015 3300049589 Bacteria 157300
251 Ga0501073_0018082 3300049589 Bacteria 5098
252 Ga0501074_0001569 3300049590 Bacteria 15457
253 Ga0501075_0052513 3300049591 Bacteria 3065
254 Ga0501076_0022312 3300049592 Bacteria 4865
255 Ga0501076_0101611 3300049592 Bacteria 2317
256 Ga0501079_0044838 3300049741 Bacteria 3413
257 Ga0501079_0257467 3300049741 Bacteria 1364
258 Ga0501080_0001963 3300049742 Bacteria 17746
259 Ga0501080_0063194 3300049742 Bacteria 3446
260 Ga0501080_0104031 3300049742 Bacteria 2633
261 Ga0501080_0195343 3300049742 Bacteria 1859
262 Ga0501080_0214145 3300049742 Bacteria 1765
263 Ga0501083_0000578 3300049744 Bacteria 23504
264 Ga0501035_0000903 3300049822 Bacteria 31389
265 Ga0501035_0030073 3300049822 Bacteria 4951
266 Ga0501035_0124686 3300049822 Bacteria 2249
267 Ga0501035_0218584 3300049822 Bacteria 1628
268 Ga0501044_0000018 3300049823 Bacteria 225885
269 Ga0501044_0020593 3300049823 Bacteria 7040
270 Ga0501044_0082408 3300049823 Bacteria 3255
271 Ga0501044_0142841 3300049823 Bacteria 2381
272 Ga0501044_0155845 3300049823 Bacteria 2263
273 Ga0501044_0222125 3300049823 Bacteria 1840
274 nmdc:mga03683_14634_c1 3300050489 Bacteria 2906
275 nmdc:mga03683_7962_c1 3300050489 Bacteria 3705
276 nmdc:mga03n38_7203_c1 3300050490 Bacteria 3921
277 nmdc:mga00v17_156406_c1 3300050491 Bacteria 1466
278 nmdc:mga00v17_56636_c1 3300050491 Bacteria 2397
279 nmdc:mga0yw44_32227_c1 3300050492 Bacteria 3052
280 nmdc:mga0yw44_44028_c1 3300050492 Bacteria 2668
281 nmdc:mga0k408_71908_c1 3300050493 Bacteria 2019
282 nmdc:mga07m45_15579_c1 3300050496 Bacteria 4060
283 nmdc:mga05p37_101196_c1 3300050507 Bacteria 3549
284 nmdc:mga05p37_139934_c1 3300050507 Bacteria 2966
285 nmdc:mga05p37_154235_c1 3300050507 Bacteria 2808
286 nmdc:mga05p37_183716_c1 3300050507 Bacteria 2543
287 nmdc:mga05p37_25188_c1 3300050507 Bacteria 7235
288 nmdc:mga05p37_448503_c1 3300050507 Bacteria 1494
289 nmdc:mga05p37_83434_c1 3300050507 Bacteria 3937
290 nmdc:mga05p37_932_c1 3300050507 Bacteria 32971
291 nmdc:mga09592_44817_c1 3300050508 Bacteria 3724
292 nmdc:mga09592_77723_c1 3300050508 Bacteria 2823
293 nmdc:mga08y16_15899_c1 3300050511 Bacteria 7909
294 nmdc:mga08y16_24270_c1 3300050511 Bacteria 6401
295 nmdc:mga08y16_439137_c1 3300050511 Bacteria 1332
296 nmdc:mga0n895_123253_c1 3300050512 Bacteria 2614
297 nmdc:mga0n895_35887_c1 3300050512 Bacteria 4784
298 nmdc:mga0n895_5555_c1 3300050512 Bacteria 10555
299 nmdc:mga0n895_5751_c1 3300050512 Bacteria 10404
300 nmdc:mga0n895_6418_c1 3300050512 Bacteria 9981
301 nmdc:mga0n895_67595_c1 3300050512 Bacteria 3539
302 nmdc:mga0rr50_105821_c1 3300050513 Bacteria 2219
303 nmdc:mga0rr50_124480_c1 3300050513 Bacteria 2056
304 nmdc:mga0rr50_14916_c1 3300050513 Bacteria 5114
305 nmdc:mga08x19_3441_c1 3300050514 Bacteria 9438
306 nmdc:mga08x19_43549_c1 3300050514 Bacteria 2864
307 nmdc:mga08x19_52202_c1 3300050514 Bacteria 2629
308 nmdc:mga08x19_83589_c1 3300050514 Bacteria 2099
309 nmdc:mga08x19_95699_c1 3300050514 Bacteria 1965
310 nmdc:mga0a205_18829_c1 3300050515 Bacteria 6499
311 nmdc:mga0a205_66667_c1 3300050515 Bacteria 3478
312 nmdc:mga0sz30_5768_c1 3300050516 Bacteria 4559
313 Ga0500643_000008 3300053087 Bacteria 457931
314 Ga0500556_0000470 3300053104 Bacteria 28389
315 Ga0500569_031269 3300053109 Bacteria 1496
316 Ga0500593_000830 3300053117 Bacteria 11557
317 Ga0500608_005776 3300053122 Bacteria 4958
318 Ga0500568_0006178 3300053139 Bacteria 6058
319 Ga0500568_0039539 3300053139 Bacteria 1904
320 Ga0500616_0005045 3300053153 Bacteria 9130
321 Ga0500616_0092997 3300053153 Bacteria 1489
322 Ga0500622_0007110 3300053156 Bacteria 6396
323 Ga0500627_0048656 3300053158 Bacteria 1842
324 Ga0501084_0056751 3300054114 Bacteria 3276
325 Ga0501082_0051216 3300060353 Bacteria 3559
326 Ga0501082_0231954 3300060353 Bacteria 1606
327 Ga0530510_0212974 3300061734 Bacteria 1435
328 2774868919 2773857925 Bacteria 6472445
329 2509108353 2508501122 Bacteria 6292184
330 2509376514 2509276019 Bacteria 6802256
331 2510315065 2510065059 Bacteria 6847884
332 2513999795 2513237159 Bacteria 6810126
333 2514421996 2513237305 Bacteria 7293571
334 2558861125 2558860100 Bacteria 8458965
335 2558864417 2558860100 Bacteria 8458965
336 2572253750 2571042365 Bacteria 3289345
337 2585270424 2582581306 Bacteria 6450535
338 2585387756 2582581865 Bacteria 6644329
339 2585397935 2582581866 Bacteria 6859583
340 2600195473 2599185352 Bacteria 7228948
341 2643803040 2643221557 Bacteria 7184309
342 2643836670 2643221564 Bacteria 4193379
343 2644063402 2643221610 Bacteria 7480339
344 2644092627 2643221615 Bacteria 5487866
345 2644107235 2643221618 Bacteria 7717186
346 2644150800 2643221626 Bacteria 8069654
347 2644308630 2643221655 Bacteria 7722067
348 2644322240 2643221657 Bacteria 5490246
349 2644335447 2643221659 Bacteria 7890716
350 2644374685 2643221668 Bacteria 7306521
351 2644414165 2643221675 Bacteria 7473456
352 2644447693 2643221680 Bacteria 7473610
353 2644489348 2643221687 Bacteria 6500351
354 2644539852 2643221698 Bacteria 7756764
355 2644614571 2643221712 Bacteria 7729434
356 2644690166 2643221726 Bacteria 7455827
357 2656278950 2654587920 Bacteria 5475511
358 2691511828 2690315906 Bacteria 4517044
359 2694627776 2693429783 Bacteria 7019804
360 2694636049 2693429784 Bacteria 7241525
361 2694636890 2693429784 Bacteria 7241525
362 2723573254 2721755686 Bacteria 7343952
363 2756675107 2756170246 Bacteria 7451806
364 2758638561 2758568016 Bacteria 5645291
365 2776266141 2775506901 Bacteria 9631051
366 2792624924 2791355091 Bacteria 6135441
367 2838076814 2838074704 Bacteria 6785777
368 2842526367 2842521101 Bacteria 6569494
369 2844003400 2844002411 Bacteria 7168230
370 2844164622 2844163670 Bacteria 7266046
371 2844850583 2844849076 Bacteria 4091819
372 2850081512 2850079185 Bacteria 6848280
373 2855732350 2855730933 Bacteria 7047938
374 2855769058 2855767633 Bacteria 7049357
375 2857744861 2857740372 Bacteria 4782044
376 2869166075 2869162929 Bacteria 6399702
377 2871457006 2871451962 Bacteria 7336357
378 2871471708 2871466892 Bacteria 6923287
379 2874172501 2874168670 Bacteria 8062617
380 2876379259 2876377896 Bacteria 6565995
381 2881415065 2881412998 Bacteria 6492157
382 2882462054 2882456835 Bacteria 6863978
383 2882635281 2882632389 Bacteria 8154593
384 2896390392 2896384573 Bacteria 7700774
385 2899804454 2899803654 Bacteria 5577784
386 2904499105 2904497146 Bacteria 4731781
387 2906382017 2906378014 Bacteria 6911440
388 2919039081 2919034639 Bacteria 4763403
389 2919060920 2919059106 Bacteria 4991624
390 2919541329 2919538618 Bacteria 4677069
391 2920761473 2920760137 Bacteria 7427611
392 2920825264 2920822456 Bacteria 6897201
393 2932430159 2932426870 Bacteria 4547726
394 2933422153 2933418574 Bacteria 4476724
395 2937822698 2937822353 Bacteria 7290551
396 2938015147 2938014810 Bacteria 6700592
397 2939588765 2939582691 Bacteria 7088898
398 2939651229 2939647034 Bacteria 4681660
399 2939678961 2939674588 Bacteria 4844420
400 2941502090 2941499720 Bacteria 7599444
401 2945956228 2945956166 Bacteria 5110334
402 2946041566 2946037020 Bacteria 4900426
403 2954002767 2953998280 Bacteria 4812144
404 2974305007 2974302888 Bacteria 4369871
405 JGI25157J39369_1000555
406 JGI25152J39213_1000109
407 JGI25159J45721_1000014
408 JGI25151J46595_10000265
409 JGI25151J46595_10027148
410 JGI25165J46597_1000079
411 rootH1_10078654
412 JGI25160J50197_1000020
413 JGI25161J50226_1001410
414 Ga0055526_1005168
415 Ga0055524_1012812
416 Ga0055536_1011464
417 Ga0055543_1000768
418 Ga0065165_1000013
419 Ga0070658_10059953
420 Ga0070661_100000160
421 Ga0070669_100288757
422 Ga0070671_100028503
423 Ga0070674_100010566
424 Ga0070711_100064083
425 Ga0070700_100094806
426 Ga0070694_100026016
427 Ga0070663_100006263
428 Ga0070707_100048564
429 Ga0070698_100002736
430 Ga0070698_100018030
431 Ga0070698_100057431
432 Ga0070698_100077026
433 Ga0070699_100031660
434 Ga0070697_100069285
435 Ga0070697_100095588
436 Ga0070697_100177655
437 Ga0070697_100303398
438 Ga0070695_100050769
439 Ga0070695_100110119
440 Ga0070695_100122129
441 Ga0070696_100032741
442 Ga0070696_100133070
443 Ga0070696_100158173
444 Ga0068855_100163637
445 Ga0070702_100034685
446 Ga0068862_100027289
447 Ga0068862_100081978
448 Ga0081455_10109110
449 Ga0075365_10077899
450 Ga0075363_100024754
451 Ga0075363_100036061
452 Ga0075364_10109113
453 Ga0075364_10172951
454 Ga0075362_10033188
455 Ga0075369_10007294
456 Ga0075370_10091246
457 Ga0075428_100027390
458 Ga0075428_100119622
459 Ga0075428_100129698
460 Ga0075428_100295322
461 Ga0075431_100024725
462 Ga0075431_100295130
463 Ga0075433_10025954
464 Ga0075433_10049418
465 Ga0075434_100018861
466 Ga0075434_100021346
467 Ga0075434_100026066
468 Ga0075434_100114987
469 Ga0075429_100069895
470 Ga0075436_100029961
471 Ga0075436_100033872
472 Ga0075436_100085548
473 Ga0075436_100105574
474 Ga0075435_100040305
475 Ga0075435_100070668
476 Ga0075435_100093268
477 Ga0075435_100149562
478 Ga0099795_10033514
479 Ga0105244_10006177
480 Ga0105240_10055861
481 Ga0111539_10010027
482 Ga0111539_10017652
483 Ga0111539_10089667
484 Ga0114129_10022110
485 Ga0114129_10149360
486 Ga0114129_10223646
487 Ga0114129_10236456
488 Ga0114129_10311679
489 Ga0105243_10009399
490 Ga0105242_10249376
491 Ga0105237_10038673
492 Ga0105238_10040306
493 Ga0105239_10030437
494 Ga0105239_10177334
495 Ga0105246_10019309
496 Ga0105246_10082297
497 Ga0105246_10095545
498 Ga0105246_10155886
499 Ga0157371_10176178
500 Ga0157370_10009575
501 Ga0157369_10086635
502 Ga0171463_1003
503 Ga0157378_10104510
504 Ga0157372_10121860
505 Ga0157380_10024473
506 Ga0157380_10059550
507 Ga0183363_1085
508 Ga0214542_1012200
509 Ga0214543_1000038
510 Ga0207425_1007216
511 Ga0209026_1000118
512 Ga0209759_1000076
513 Ga0209129_1000180
514 Ga0209233_1000247
515 Ga0209673_1026592
516 Ga0209130_1000034
517 Ga0209130_1017690
518 Ga0209676_1019352
519 Ga0209025_1000026
520 Ga0209025_1000311
521 Ga0209025_1001362
522 Ga0209564_1000013
523 Ga0209758_1034104
524 Ga0209050_1009685
525 Ga0209256_1000396
526 Ga0209256_1003573
527 Ga0207426_1000006
528 Ga0209051_1003723
529 Ga0209051_1004857
530 Ga0209051_1008029
531 Ga0209051_1010204
532 Ga0209051_1032204
533 Ga0207688_10016441
534 Ga0207699_10061925
535 Ga0207695_10000190
536 Ga0207695_10263570
537 Ga0207671_10035935
538 Ga0207663_10003106
539 Ga0207649_10000029
540 Ga0207646_10065117
541 Ga0207646_10107832
542 Ga0207694_10008166
543 Ga0207694_10055941
544 Ga0207700_10074734
545 Ga0207709_10186218
546 Ga0207665_10034950
547 Ga0207639_10156129
548 Ga0209971_1013523
549 Ga0207428_10002027
550 Ga0307515_10000154
551 Ga0307515_10000285
552 Ga0307515_10004744
553 Ga0307515_10058049
554 Ga0307515_10087371
555 Ga0316176_1193234
556 Ga0314311_1151601
557 Ga0316178_1118312
558 Ga0265327_10016080
559 Ga0307513_10005286
560 Ga0307408_100014633
561 Ga0307408_100019143
562 Ga0307408_100020305
563 Ga0307408_100026368
564 Ga0307408_100049545
565 Ga0307408_100053051
566 Ga0307408_100133610
567 Ga0307405_10001802
568 Ga0307405_10002619
569 Ga0307405_10024590
570 Ga0307405_10026595
571 Ga0307405_10083646
572 Ga0307413_10002843
573 Ga0307413_10009752
574 Ga0307413_10069557
575 Ga0307413_10089694
576 Ga0307413_10111376
577 Ga0307413_10138112
578 Ga0307410_10003768
579 Ga0307410_10011738
580 Ga0307410_10066040
581 Ga0307410_10091329
582 Ga0307406_10038434
583 Ga0307406_10149696
584 Ga0307407_10012633
585 Ga0307407_10027097
586 Ga0307412_10031683
587 Ga0307412_10069295
588 Ga0307412_10112477
589 Ga0307409_100028147
590 Ga0307409_100029899
591 Ga0307416_100016859
592 Ga0307416_100073539
593 Ga0307416_100138331
594 Ga0307416_100232203
595 Ga0307416_100318243
596 Ga0307416_100357748
597 Ga0307414_10074763
598 Ga0307414_10162615
599 Ga0307414_10188109
600 Ga0307411_10055312
601 Ga0307411_10111637
602 Ga0307510_10049407
603 Ga0395900_0156842
604 Ga0395900_0282730
605 Ga0395905_0006501
606 Ga0395905_0067978
607 Ga0395901_0149970
608 Ga0439436_0001436
609 Ga0439461_0012447
610 Ga0439466_0020270
611 Ga0439442_000177
612 Ga0439449_0000036
613 Ga0439457_002655
614 Ga0495638_0005593
615 Ga0495638_0014322
616 Ga0495645_0057610
617 Ga0495668_0028229
618 Ga0495625_0005589
619 Ga0495625_0182590
620 Ga0495686_0005550
621 Ga0495686_0145557
622 Ga0496112_0013726
623 Ga0496119_0046931
624 Ga0496120_0002072
625 Ga0496126_0019399
626 Ga0501031_0035988
627 Ga0501032_0000946
628 Ga0501032_0003609
629 Ga0501032_0075514
630 Ga0501033_0000429
631 Ga0501034_0000038
632 Ga0501034_0225953
633 Ga0501036_0024315
634 Ga0501037_0000293
635 Ga0501037_0009830
636 Ga0501038_0091852
637 Ga0501038_0117218
638 Ga0501039_0014696
639 Ga0501039_0058100
640 Ga0501040_0053104
641 Ga0501040_0192225
642 Ga0501043_0000042
643 Ga0501043_0057385
644 Ga0501047_0228799
645 Ga0501048_0016644
646 Ga0501048_0027862
647 Ga0501048_0112823
648 Ga0501067_0019361
649 Ga0501069_0000001
650 Ga0501070_0000358
651 Ga0501071_0010567
652 Ga0501071_0175704
653 Ga0501072_0048025
654 Ga0501073_0000015
655 Ga0501073_0018082
656 Ga0501074_0001569
657 Ga0501075_0052513
658 Ga0501076_0022312
659 Ga0501076_0101611
660 Ga0501079_0044838
661 Ga0501079_0257467
662 Ga0501080_0001963
663 Ga0501080_0063194
664 Ga0501080_0104031
665 Ga0501080_0195343
666 Ga0501080_0214145
667 Ga0501083_0000578
668 Ga0501035_0000903
669 Ga0501035_0030073
670 Ga0501035_0124686
671 Ga0501035_0218584
672 Ga0501044_0000018
673 Ga0501044_0020593
674 Ga0501044_0082408
675 Ga0501044_0142841
676 Ga0501044_0155845
677 Ga0501044_0222125
678 nmdc:mga03683_14634_c1
679 nmdc:mga03683_7962_c1
680 nmdc:mga03n38_7203_c1
681 nmdc:mga00v17_156406_c1
682 nmdc:mga00v17_56636_c1
683 nmdc:mga0yw44_32227_c1
684 nmdc:mga0yw44_44028_c1
685 nmdc:mga0k408_71908_c1
686 nmdc:mga07m45_15579_c1
687 nmdc:mga05p37_101196_c1
688 nmdc:mga05p37_139934_c1
689 nmdc:mga05p37_154235_c1
690 nmdc:mga05p37_183716_c1
691 nmdc:mga05p37_25188_c1
692 nmdc:mga05p37_448503_c1
693 nmdc:mga05p37_83434_c1
694 nmdc:mga05p37_932_c1
695 nmdc:mga09592_44817_c1
696 nmdc:mga09592_77723_c1
697 nmdc:mga08y16_15899_c1
698 nmdc:mga08y16_24270_c1
699 nmdc:mga08y16_439137_c1
700 nmdc:mga0n895_123253_c1
701 nmdc:mga0n895_35887_c1
702 nmdc:mga0n895_5555_c1
703 nmdc:mga0n895_5751_c1
704 nmdc:mga0n895_6418_c1
705 nmdc:mga0n895_67595_c1
706 nmdc:mga0rr50_105821_c1
707 nmdc:mga0rr50_124480_c1
708 nmdc:mga0rr50_14916_c1
709 nmdc:mga08x19_3441_c1
710 nmdc:mga08x19_43549_c1
711 nmdc:mga08x19_52202_c1
712 nmdc:mga08x19_83589_c1
713 nmdc:mga08x19_95699_c1
714 nmdc:mga0a205_18829_c1
715 nmdc:mga0a205_66667_c1
716 nmdc:mga0sz30_5768_c1
717 Ga0500643_000008
718 Ga0500556_0000470
719 Ga0500569_031269
720 Ga0500593_000830
721 Ga0500608_005776
722 Ga0500568_0006178
723 Ga0500568_0039539
724 Ga0500616_0005045
725 Ga0500616_0092997
726 Ga0500622_0007110
727 Ga0500627_0048656
728 Ga0501084_0056751
729 Ga0501082_0051216
730 Ga0501082_0231954
731 Ga0530510_0212974
732 2774868919
733 2509108353
734 2509376514
735 2510315065
736 2513999795
737 2514421996
738 2558861125
739 2558864417
740 2572253750
741 2585270424
742 2585387756
743 2585397935
744 2600195473
745 2643803040
746 2643836670
747 2644063402
748 2644092627
749 2644107235
750 2644150800
751 2644308630
752 2644322240
753 2644335447
754 2644374685
755 2644414165
756 2644447693
757 2644489348
758 2644539852
759 2644614571
760 2644690166
761 2656278950
762 2691511828
763 2694627776
764 2694636049
765 2694636890
766 2723573254
767 2756675107
768 2758638561
769 2776266141
770 2792624924
771 2838076814
772 2842526367
773 2844003400
774 2844164622
775 2844850583
776 2850081512
777 2855732350
778 2855769058
779 2857744861
780 2869166075
781 2871457006
782 2871471708
783 2874172501
784 2876379259
785 2881415065
786 2882462054
787 2882635281
788 2896390392
789 2899804454
790 2904499105
791 2906382017
792 2919039081
793 2919060920
794 2919541329
795 2920761473
796 2920825264
797 2932430159
798 2933422153
799 2937822698
800 2938015147
801 2939588765
802 2939651229
803 2939678961
804 2941502090
805 2945956228
806 2946041566
807 2954002767
808 2974305007

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06772

LtrA

Bacterial low temperature requirement A protein (LtrA)

67

432

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6w8n-assembly1.cif.gz_B structure of a trans-membrane protein 0.5587 30 389
7lf6-assembly1.cif.gz_B structure of lysosomal membrane protein 0.5233 30 388
6w8n-assembly1.cif.gz_B structure of a trans-membrane protein 0.5092 30 389
4gp8-assembly1.cif.gz_A structure of recombinant cytochrome ba3 oxidase mutant y133w+t231f from thermus thermophilus 0.3414 31 382
6eid-assembly2.cif.gz_B crystal structure of wild-type channelrhodopsin 2 0.3383 48 345
ID Description Score Start End Superfamily
af_Q9Y7U1_22_240_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5129 35 207 1.20.1070.10
af_I1NB82_29_177_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.4867 224 389 1.20.140.40
af_Q9FKW5_2_121_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.4861 228 348 1.20.930.20
af_K7KC87_1_156_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.4792 228 357 1.20.1410.10
af_Q9FKW5_2_121_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.469 228 348 1.20.930.20
ID Description Score Start End GO Terms
AF-A0A1G9NV35-F1-model_v4 Low temperature requirement protein LtrA 0.9848 14 357 GO:0016020
AF-A0A2W4JCK6-F1-model_v4 Low temperature requirement protein A 0.9745 2 336 GO:0016020
AF-A0A359IPU6-F1-model_v4 deleted 0.9714 18 183
AF-A0A2W4JCK6-F1-model_v4 Low temperature requirement protein A 0.9688 2 336 GO:0016020
AF-A0A3C1E1H9-F1-model_v4 Low temperature requirement protein A 0.9672 18 313 GO:0016020

Map