F435763

General Info

Members Datasets Scaffolds Average Seq Length
404 273 806 142

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0057811|Ga0495588_0057811_692_1192
Length 166
Sequence MAFPLSLPRVFQPKIFPPTERKPMKTLYTAEALASGEGRDGTAVSKDGKLSVTLASPVELGGDGAGTNPEQLFAAGYAACFHSALRLVGRQQKADLTDSAVAARIHLGALDGGTGYGIAAELEIALPAVDRETAEALVAKAHEVCPYSNATRGNITVDITILEVAA

Samples

Sample ID Description Type Environment
1 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
37 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
87 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
102 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
103 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
104 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
105 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
106 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
125 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059606 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 2506783011 Frankia datiscae Dg1 Isolate Nodule
237 2508501039 Frankia saprophytica CN3 Isolate Nodule
238 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
239 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
240 2671180195 Frankia sp. CcI49 Isolate Nodule
241 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
242 2687453737 Frankia sp. BMG5.36 Isolate Nodule
243 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
244 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
245 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
246 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
247 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
248 2773857922 Frankia sp. CcI49 Isolate Nodule
249 2773857933 Frankia sp. BMG5.30 Isolate Nodule
250 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
251 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
252 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
253 2855683550 Micromonospora sp. RP3T Isolate Unclassified
254 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
255 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
256 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
257 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
258 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
259 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
260 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
261 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
262 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
263 2919069694 Microbacterium sp. 1154 Isolate Unclassified
264 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
265 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
266 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
267 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
268 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
269 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
270 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
271 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
272 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
273 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.41
Metatranscriptomes 31.19
Isolates 9.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.44
Nodule 2.48
Rhizoplane 8.42
Rhizosphere 75.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495588_0057811 3300046674 Bacteria 2004
2 JGI25152J39213_1000021 3300002773 Bacteria 107057
3 JGI25151J46595_10021513 3300003187 Bacteria 2698
4 JGI25404J52841_10014854 3300003659 Bacteria 1690
5 Ga0055542_1004191 3300003762 Bacteria 3595
6 Ga0055541_1017960 3300003841 Bacteria 884
7 Ga0058860_12045408 3300004801 Bacteria 795
8 Ga0058860_12180319 3300004801 Bacteria 733
9 Ga0065714_10017020 3300005288 Bacteria 1771
10 Ga0070676_10070521 3300005328 Bacteria 2097
11 Ga0070683_100274829 3300005329 Bacteria 1603
12 Ga0070690_100971845 3300005330 Bacteria 668
13 Ga0070670_100512530 3300005331 Bacteria 1067
14 Ga0070677_10012414 3300005333 Bacteria 2958
15 Ga0070677_10180597 3300005333 Bacteria 1005
16 Ga0070666_10087498 3300005335 Bacteria 2135
17 Ga0070669_100745688 3300005353 Bacteria 829
18 Ga0070675_100182760 3300005354 Bacteria 1813
19 Ga0070671_100042895 3300005355 Bacteria 3761
20 Ga0070674_100202806 3300005356 Bacteria 1533
21 Ga0070667_100336050 3300005367 Bacteria 1365
22 Ga0070705_100400672 3300005440 Bacteria 1016
23 Ga0070700_100685856 3300005441 Bacteria 813
24 Ga0070663_100248836 3300005455 Bacteria 1406
25 Ga0070678_100103793 3300005456 Bacteria 2209
26 Ga0070698_100133619 3300005471 Bacteria 2436
27 Ga0070672_100394443 3300005543 Bacteria 1185
28 Ga0070665_100720981 3300005548 Bacteria 1010
29 Ga0068863_101485076 3300005841 Bacteria 686
30 Ga0068862_102190941 3300005844 Bacteria 564
31 Ga0081539_10000895 3300005985 Bacteria 56919
32 Ga0070717_10850220 3300006028 Bacteria 830
33 Ga0075365_10550808 3300006038 Bacteria 816
34 Ga0075364_10002196 3300006051 Bacteria 10945
35 Ga0075364_10093050 3300006051 Bacteria 2001
36 Ga0075364_10660385 3300006051 Bacteria 714
37 Ga0075362_10107431 3300006177 Bacteria 1311
38 Ga0075370_10234057 3300006353 Bacteria 1087
39 Ga0075430_100646612 3300006846 Bacteria 872
40 Ga0105251_10077379 3300009011 Bacteria 1543
41 Ga0105244_10062186 3300009036 Bacteria 1877
42 Ga0105244_10072729 3300009036 Bacteria 1712
43 Ga0105244_10084937 3300009036 Bacteria 1562
44 Ga0105244_10112940 3300009036 Bacteria 1320
45 Ga0105245_10246822 3300009098 Bacteria 1733
46 Ga0105245_10303115 3300009098 Bacteria 1568
47 Ga0105245_10444325 3300009098 Bacteria 1304
48 Ga0105245_10466198 3300009098 Bacteria 1274
49 Ga0105243_10051834 3300009148 Bacteria 3247
50 Ga0105243_10172279 3300009148 Bacteria 1876
51 Ga0105243_12419923 3300009148 Bacteria 564
52 Ga0105248_10022933 3300009177 Bacteria 6932
53 Ga0105238_11570571 3300009551 Bacteria 688
54 Ga0105246_10017156 3300011119 Bacteria 4599
55 Ga0105246_10099727 3300011119 Bacteria 2112
56 Ga0105246_10347012 3300011119 Bacteria 1215
57 Ga0157373_10004969 3300013100 Bacteria 9993
58 Ga0157373_10174286 3300013100 Bacteria 1514
59 Ga0157369_10328769 3300013105 Bacteria 1588
60 Ga0157369_12320449 3300013105 Bacteria 544
61 Ga0163162_10049622 3300013306 Bacteria 4206
62 Ga0163162_10655509 3300013306 Bacteria 1173
63 Ga0157375_10103829 3300013308 Bacteria 2930
64 Ga0157375_10266328 3300013308 Bacteria 1875
65 Ga0157375_12158108 3300013308 Bacteria 663
66 Ga0157380_11288889 3300014326 Bacteria 777
67 Ga0157380_12150933 3300014326 Bacteria 621
68 Ga0163161_10094871 3300017792 Bacteria 2212
69 Ga0197907_11152192 3300020069 Bacteria 2143
70 Ga0206356_10234190 3300020070 Bacteria 1617
71 Ga0206349_1222662 3300020075 Bacteria 597
72 Ga0206349_1809058 3300020075 Bacteria 907
73 Ga0206352_10507655 3300020078 Bacteria 1479
74 Ga0206352_10831262 3300020078 Bacteria 1217
75 Ga0206352_10952531 3300020078 Bacteria 965
76 Ga0206350_11076300 3300020080 Bacteria 615
77 Ga0206354_10322157 3300020081 Bacteria 1027
78 Ga0206353_10357207 3300020082 Bacteria 894
79 Ga0206353_11478853 3300020082 Bacteria 704
80 Ga0209566_100222 3300025225 Bacteria 56485
81 Ga0209148_1001768 3300025254 Bacteria 9298
82 Ga0209759_1025234 3300025256 Bacteria 1269
83 Ga0209129_1000059 3300025258 Bacteria 250603
84 Ga0209129_1032837 3300025258 Bacteria 856
85 Ga0209025_1001413 3300025294 Bacteria 31790
86 Ga0209051_1021155 3300025303 Bacteria 2780
87 Ga0207697_10003826 3300025315 Bacteria 7348
88 Ga0207655_1010437 3300025728 Bacteria 5631
89 Ga0207655_1079608 3300025728 Bacteria 1187
90 Ga0207655_1087251 3300025728 Bacteria 1108
91 Ga0207713_1103795 3300025735 Bacteria 977
92 Ga0207682_10012601 3300025893 Bacteria 3299
93 Ga0207682_10424755 3300025893 Bacteria 629
94 Ga0207688_10075447 3300025901 Bacteria 1919
95 Ga0207680_10142400 3300025903 Bacteria 1590
96 Ga0207645_10001262 3300025907 Bacteria 20827
97 Ga0207643_10107406 3300025908 Bacteria 1641
98 Ga0207681_10314850 3300025923 Bacteria 1242
99 Ga0207650_10164791 3300025925 Bacteria 1758
100 Ga0207659_10094673 3300025926 Bacteria 2238
101 Ga0207644_10140835 3300025931 Bacteria 1857
102 Ga0207686_11381614 3300025934 Bacteria 579
103 Ga0207709_10105117 3300025935 Bacteria 1875
104 Ga0207709_10147516 3300025935 Bacteria 1625
105 Ga0207669_10150985 3300025937 Bacteria 1627
106 Ga0207691_10000200 3300025940 Bacteria 57566
107 Ga0207711_10608938 3300025941 Bacteria 1019
108 Ga0207667_11587262 3300025949 Bacteria 623
109 Ga0207651_10102837 3300025960 Bacteria 2125
110 Ga0207668_11679128 3300025972 Bacteria 573
111 Ga0207658_10632891 3300025986 Bacteria 963
112 Ga0207708_10673508 3300026075 Bacteria 882
113 Ga0207641_11090217 3300026088 Bacteria 797
114 Ga0207683_10146377 3300026121 Bacteria 2130
115 Ga0307511_10298417 3300030521 Bacteria 730
116 Ga0316182_1213394 3300030745 Bacteria 700
117 Ga0307513_10023706 3300031456 Bacteria 7163
118 Ga0307413_10102621 3300031824 Bacteria 1894
119 Ga0307406_10009542 3300031901 Bacteria 5447
120 Ga0307412_10035798 3300031911 Bacteria 3174
121 Ga0307412_10040805 3300031911 Bacteria 3005
122 Ga0307412_10152811 3300031911 Bacteria 1705
123 Ga0307412_10917361 3300031911 Bacteria 769
124 Ga0307414_10745220 3300032004 Bacteria 890
125 Ga0307415_100439156 3300032126 Bacteria 1125
126 Ga0373926_0187075 3300035083 Bacteria 795
127 Ga0316584_0529831 3300036712 Bacteria 825
128 Ga0395900_0773467 3300037418 Bacteria 889
129 Ga0436364_1400651 3300037853 Bacteria 915
130 Ga0395901_0026936 3300038443 Bacteria 5902
131 Ga0395901_0866369 3300038443 Bacteria 887
132 Ga0436365_1207250 3300039437 Bacteria 708
133 Ga0436363_0892102 3300039450 Bacteria 1513
134 Ga0439465_0260867 3300041413 Bacteria 643
135 Ga0451789_0531265 3300041443 Bacteria 1070
136 Ga0451800_0622492 3300041459 Bacteria 712
137 Ga0451802_1121795 3300041460 Bacteria 510
138 Ga0451843_1213301 3300041509 Bacteria 632
139 Ga0450907_049882 3300042146 Bacteria 719
140 Ga0466972_0203242 3300044658 Bacteria 928
141 Ga0466963_0451382 3300044694 Bacteria 907
142 Ga0466959_0899751 3300045049 Bacteria 590
143 Ga0466958_0308998 3300045836 Bacteria 1015
144 Ga0466958_1009844 3300045836 Bacteria 543
145 Ga0495629_0535241 3300046459 Bacteria 787
146 Ga0495653_0191637 3300046463 Bacteria 1394
147 Ga0495580_0102532 3300046472 Bacteria 1989
148 Ga0495580_0118719 3300046472 Bacteria 1836
149 Ga0495580_0153242 3300046472 Bacteria 1597
150 Ga0495582_0005006 3300046473 Bacteria 7424
151 Ga0495582_0121200 3300046473 Bacteria 1473
152 Ga0495582_0387966 3300046473 Bacteria 805
153 Ga0495639_0006567 3300046475 Bacteria 5001
154 Ga0495662_0595125 3300046476 Bacteria 541
155 Ga0495664_0186482 3300046477 Bacteria 1257
156 Ga0495583_0113542 3300046506 Bacteria 1146
157 Ga0495606_0533193 3300046507 Bacteria 587
158 Ga0495630_0078240 3300046517 Bacteria 2494
159 Ga0495630_0279658 3300046517 Bacteria 1275
160 Ga0495665_0041575 3300046531 Bacteria 2447
161 Ga0495665_0099606 3300046531 Bacteria 1525
162 Ga0495665_0511030 3300046531 Bacteria 605
163 Ga0495586_0013555 3300046535 Bacteria 4323
164 Ga0495586_0034352 3300046535 Bacteria 2723
165 Ga0495587_0001374 3300046536 Bacteria 16172
166 Ga0495598_0055464 3300046537 Bacteria 1207
167 Ga0495598_0438172 3300046537 Bacteria 516
168 Ga0495621_0237606 3300046539 Bacteria 742
169 Ga0495645_0093228 3300046543 Bacteria 2149
170 Ga0495622_0336940 3300046557 Bacteria 654
171 Ga0495633_0209794 3300046558 Bacteria 893
172 Ga0495667_0183841 3300046559 Bacteria 1340
173 Ga0495656_0030425 3300046615 Bacteria 2182
174 Ga0495668_0160597 3300046616 Bacteria 1231
175 Ga0495588_0007013 3300046674 Bacteria 5108
176 Ga0495588_0015353 3300046674 Bacteria 3684
177 Ga0495588_0064672 3300046674 Bacteria 1897
178 Ga0495588_0134552 3300046674 Bacteria 1304
179 Ga0495657_0062375 3300046675 Bacteria 2463
180 Ga0495670_0031798 3300046691 Bacteria 2623
181 Ga0495670_0156356 3300046691 Bacteria 1197
182 Ga0495600_0026358 3300046809 Bacteria 3751
183 Ga0495600_0044283 3300046809 Bacteria 2904
184 Ga0495581_0056011 3300047315 Bacteria 2275
185 Ga0495581_0133887 3300047315 Bacteria 1444
186 Ga0495581_0157561 3300047315 Bacteria 1327
187 Ga0495581_0321154 3300047315 Bacteria 904
188 Ga0495581_0391641 3300047315 Bacteria 811
189 Ga0495636_0091142 3300047318 Bacteria 1323
190 Ga0495674_1130896 3300047319 Bacteria 595
191 Ga0495676_0660618 3300047321 Bacteria 678
192 Ga0495675_0158317 3300047444 Bacteria 1395
193 Ga0495685_147824 3300047447 Bacteria 764
194 Ga0495593_0161253 3300047673 Bacteria 1132
195 Ga0495614_0218128 3300048089 Bacteria 867
196 Ga0496100_0035646 3300048903 Bacteria 3131
197 Ga0496100_0219794 3300048903 Bacteria 1393
198 Ga0496100_0261522 3300048903 Bacteria 1283
199 Ga0496101_0316773 3300048904 Bacteria 1223
200 Ga0496101_0327887 3300048904 Bacteria 1201
201 Ga0496102_0172130 3300048905 Bacteria 2038
202 Ga0496102_0336533 3300048905 Bacteria 1421
203 Ga0496102_1247909 3300048905 Bacteria 662
204 Ga0496103_0046330 3300048906 Bacteria 2684
205 Ga0496103_0071535 3300048906 Bacteria 2171
206 Ga0496104_0347286 3300048907 Bacteria 1396
207 Ga0496105_0096648 3300048908 Bacteria 2439
208 Ga0496105_0134590 3300048908 Bacteria 2036
209 Ga0496106_0086055 3300048909 Bacteria 2420
210 Ga0496106_0164113 3300048909 Bacteria 1758
211 Ga0496107_0050208 3300048910 Bacteria 3006
212 Ga0496107_0222717 3300048910 Bacteria 1403
213 Ga0496108_0834808 3300048911 Bacteria 793
214 Ga0496109_0445353 3300048912 Bacteria 1223
215 Ga0496109_1350358 3300048912 Bacteria 648
216 Ga0496110_0294754 3300048913 Bacteria 1477
217 Ga0496110_1074920 3300048913 Bacteria 712
218 Ga0496110_1212527 3300048913 Bacteria 663
219 Ga0496111_0332705 3300048914 Bacteria 1124
220 Ga0496112_0068497 3300048915 Bacteria 3504
221 Ga0496112_0239698 3300048915 Bacteria 1766
222 Ga0496113_0028595 3300048916 Bacteria 4011
223 Ga0496113_0279481 3300048916 Bacteria 1335
224 Ga0496113_0483414 3300048916 Bacteria 995
225 Ga0496114_0240352 3300048917 Bacteria 1592
226 Ga0496114_1094759 3300048917 Bacteria 681
227 Ga0496117_0318986 3300048920 Bacteria 815
228 Ga0496119_0004565 3300048922 Bacteria 13701
229 Ga0496120_0004311 3300048923 Bacteria 12051
230 Ga0496122_0164245 3300048925 Bacteria 1349
231 Ga0496124_0086864 3300048927 Bacteria 2559
232 Ga0496124_0241383 3300048927 Bacteria 1343
233 Ga0496125_0141841 3300048928 Bacteria 1669
234 Ga0496125_0179463 3300048928 Bacteria 1413
235 Ga0496125_0577586 3300048928 Bacteria 618
236 Ga0496126_0643640 3300048929 Bacteria 830
237 Ga0501308_010995 3300049128 Bacteria 1014
238 Ga0501304_005589 3300049160 Bacteria 989
239 Ga0501313_009124 3300049529 Bacteria 1114
240 Ga0501316_010211 3300049532 Bacteria 1066
241 Ga0501316_026016 3300049532 Bacteria 764
242 Ga0501319_004518 3300049535 Bacteria 970
243 Ga0501322_001132 3300049538 Bacteria 1438
244 Ga0501323_008508 3300049539 Bacteria 1192
245 Ga0501323_018420 3300049539 Bacteria 904
246 Ga0501324_004558 3300049540 Bacteria 1105
247 Ga0501325_005972 3300049541 Bacteria 985
248 Ga0501069_0082422 3300049585 Bacteria 1813
249 Ga0501071_1299382 3300049587 Bacteria 562
250 Ga0501080_0945933 3300049742 Bacteria 749
251 Ga0501083_0015386 3300049744 Bacteria 5359
252 Ga0501083_0232912 3300049744 Bacteria 1199
253 Ga0501044_0420680 3300049823 Bacteria 1246
254 nmdc:mga03683_29120_c1 3300050489 Bacteria 2200
255 nmdc:mga03n38_65956_c1 3300050490 Bacteria 1661
256 nmdc:mga03n38_714170_c1 3300050490 Bacteria 578
257 nmdc:mga00v17_1972_c1 3300050491 Bacteria 10614
258 nmdc:mga00v17_578471_c1 3300050491 Bacteria 725
259 nmdc:mga00v17_602680_c1 3300050491 Bacteria 708
260 nmdc:mga06z11_746609_c1 3300050494 Bacteria 596
261 nmdc:mga07m45_229438_c1 3300050496 Bacteria 1080
262 Ga0495619_0040069 3300053085 Bacteria 3061
263 Ga0500577_0190953 3300053142 Bacteria 881
264 Ga0500616_0079655 3300053153 Bacteria 1649
265 Ga0587084_001220 3300059477 Bacteria 2384
266 Ga0587084_001963 3300059477 Bacteria 2056
267 Ga0587084_007278 3300059477 Bacteria 1369
268 Ga0587093_013099 3300059478 Bacteria 1016
269 Ga0587066_000296 3300059490 Bacteria 3677
270 Ga0587066_021854 3300059490 Bacteria 1065
271 Ga0587070_019011 3300059491 Bacteria 1133
272 Ga0587070_029297 3300059491 Bacteria 987
273 Ga0587070_029843 3300059491 Bacteria 981
274 Ga0587070_151231 3300059491 Bacteria 582
275 Ga0587073_0014085 3300059492 Bacteria 1417
276 Ga0587073_0055633 3300059492 Bacteria 911
277 Ga0587077_056661 3300059493 Bacteria 837
278 Ga0587080_003400 3300059503 Bacteria 1976
279 Ga0587080_112466 3300059503 Bacteria 595
280 Ga0587082_016384 3300059504 Bacteria 1156
281 Ga0587082_024554 3300059504 Bacteria 1007
282 Ga0587082_033184 3300059504 Bacteria 911
283 Ga0587083_0003245 3300059505 Bacteria 2135
284 Ga0587085_009854 3300059506 Bacteria 1255
285 Ga0587085_015304 3300059506 Bacteria 1095
286 Ga0587085_016295 3300059506 Bacteria 1074
287 Ga0587086_006610 3300059507 Bacteria 1301
288 Ga0587088_000951 3300059508 Bacteria 2778
289 Ga0587088_003146 3300059508 Bacteria 1965
290 Ga0587088_019086 3300059508 Bacteria 1124
291 Ga0587088_020736 3300059508 Bacteria 1093
292 Ga0587088_022272 3300059508 Bacteria 1067
293 Ga0587088_033329 3300059508 Bacteria 933
294 Ga0587089_001110 3300059509 Bacteria 2392
295 Ga0587089_023960 3300059509 Bacteria 862
296 Ga0587090_001854 3300059510 Bacteria 2215
297 Ga0587090_005391 3300059510 Bacteria 1600
298 Ga0587090_007487 3300059510 Bacteria 1435
299 Ga0587090_038094 3300059510 Bacteria 835
300 Ga0587090_039860 3300059510 Bacteria 823
301 Ga0587090_073494 3300059510 Bacteria 672
302 Ga0587091_017200 3300059511 Bacteria 1215
303 Ga0587091_051838 3300059511 Bacteria 845
304 Ga0587092_003159 3300059512 Bacteria 1843
305 Ga0587094_000812 3300059513 Bacteria 2689
306 Ga0587094_009784 3300059513 Bacteria 1231
307 Ga0587094_024378 3300059513 Bacteria 900
308 Ga0587098_051072 3300059604 Bacteria 628
309 Ga0587106_004881 3300059605 Bacteria 1502
310 Ga0587106_008865 3300059605 Bacteria 1265
311 Ga0587106_025595 3300059605 Bacteria 911
312 Ga0587106_038234 3300059605 Bacteria 803
313 Ga0587121_01767 3300059606 Bacteria 1096
314 Ga0587121_07413 3300059606 Bacteria 657
315 Ga0587125_011725 3300059607 Bacteria 924
316 Ga0587131_001319 3300059609 Bacteria 1197
317 Ga0587131_003310 3300059609 Bacteria 923
318 Ga0587099_005631 3300059622 Bacteria 1133
319 Ga0587101_011036 3300059623 Bacteria 1147
320 Ga0587101_018804 3300059623 Bacteria 972
321 Ga0587109_023249 3300059624 Bacteria 1122
322 Ga0587113_010794 3300059625 Bacteria 847
323 Ga0587115_031817 3300059626 Bacteria 788
324 Ga0587117_009905 3300059627 Bacteria 1152
325 Ga0587117_017237 3300059627 Bacteria 970
326 Ga0587128_015542 3300059630 Bacteria 1105
327 Ga0587130_004056 3300059631 Bacteria 1267
328 Ga0587062_001621 3300059639 Bacteria 1990
329 Ga0587062_004181 3300059639 Bacteria 1516
330 Ga0587067_001590 3300059640 Bacteria 2506
331 Ga0587067_015523 3300059640 Bacteria 1236
332 Ga0587068_017155 3300059641 Bacteria 1155
333 Ga0587068_020510 3300059641 Bacteria 1081
334 Ga0587069_012508 3300059642 Bacteria 1152
335 Ga0587069_019676 3300059642 Bacteria 1000
336 Ga0587072_002353 3300059643 Bacteria 2512
337 Ga0587075_001116 3300059644 Bacteria 2497
338 Ga0587075_019979 3300059644 Bacteria 986
339 Ga0587076_028484 3300059645 Bacteria 974
340 Ga0587076_038318 3300059645 Bacteria 885
341 Ga0587076_121793 3300059645 Bacteria 605
342 Ga0587078_000839 3300059646 Bacteria 2520
343 Ga0587078_015471 3300059646 Bacteria 921
344 Ga0587078_017666 3300059646 Bacteria 877
345 Ga0587079_014173 3300059647 Bacteria 1334
346 Ga0587079_022766 3300059647 Bacteria 1140
347 Ga0587079_030374 3300059647 Bacteria 1034
348 Ga0587079_057324 3300059647 Bacteria 835
349 Ga0587079_110056 3300059647 Bacteria 668
350 Ga0587079_140906 3300059647 Bacteria 615
351 Ga0587105_006941 3300059651 Bacteria 790
352 Ga0587107_011786 3300059652 Bacteria 1077
353 Ga0587108_002820 3300059653 Bacteria 1191
354 Ga0587110_005797 3300059654 Bacteria 1124
355 Ga0587110_007382 3300059654 Bacteria 1039
356 Ga0587114_015635 3300059655 Bacteria 1007
357 Ga0587116_04445 3300059656 Bacteria 816
358 Ga0587119_009468 3300059658 Bacteria 1089
359 Ga0587124_005609 3300059660 Bacteria 1009
360 Ga0587124_023943 3300059660 Bacteria 640
361 Ga0587071_001334 3300060344 Bacteria 3039
362 Ga0587111_0001573 3300060346 Bacteria 2798
363 Ga0587111_0009849 3300060346 Bacteria 1625
364 Ga0587111_0029624 3300060346 Bacteria 1110
365 Ga0587111_0052414 3300060346 Bacteria 905
366 2506867541 2506783011 Bacteria 5323186
367 2508677979 2508501039 Bacteria 9978592
368 2552107740 2551306166 Bacteria 9731570
369 2623590781 2622736626 Bacteria 7181580
370 2671836135 2671180195 Bacteria 9757215
371 2676204334 2675902999 Bacteria 9438463
372 2689958884 2687453737 Bacteria 11203906
373 2689991396 2687453743 Bacteria 8361025
374 2744955758 2744054611 Bacteria 5611514
375 2758224717 2757320536 Bacteria 3629334
376 2774378858 2773857758 Bacteria 3592392
377 2774848910 2773857921 Bacteria 9435764
378 2774854291 2773857922 Bacteria 9757215
379 2774902111 2773857933 Bacteria 5818019
380 2776373220 2775506925 Bacteria 7237746
381 2844851947 2844849076 Bacteria 4091819
382 2848551589 2848551377 Bacteria 3720646
383 2855684687 2855683550 Bacteria 7134265
384 2857729828 2857729791 Bacteria 4040535
385 2857740593 2857740372 Bacteria 4782044
386 2863070781 2863067949 Bacteria 8541735
387 2866555269 2866552031 Bacteria 5824618
388 2893685819 2893684298 Bacteria 2897960
389 2908678464 2908678064 Bacteria 3482747
390 2910814633 2910809715 Bacteria 4982797
391 2919035782 2919034639 Bacteria 4763403
392 2919063549 2919059106 Bacteria 4991624
393 2919070788 2919069694 Bacteria 3622919
394 2919539003 2919538618 Bacteria 4677069
395 2919717491 2919713450 Bacteria 7431245
396 2932427584 2932426870 Bacteria 4547726
397 2939648240 2939647034 Bacteria 4681660
398 2939677165 2939674588 Bacteria 4844420
399 8001783842 8001781756 Bacteria 9586736
400 8002320968 8002317523 Bacteria 8051857
401 8046994594 8046991243 Bacteria 8497463
402 8054109877 8054107350 Bacteria 5022511
403 8055413482 8055412473 Bacteria 6257500
404 Ga0495588_0057811
405 JGI25152J39213_1000021
406 JGI25151J46595_10021513
407 JGI25404J52841_10014854
408 Ga0055542_1004191
409 Ga0055541_1017960
410 Ga0058860_12045408
411 Ga0058860_12180319
412 Ga0065714_10017020
413 Ga0070676_10070521
414 Ga0070683_100274829
415 Ga0070690_100971845
416 Ga0070670_100512530
417 Ga0070677_10012414
418 Ga0070677_10180597
419 Ga0070666_10087498
420 Ga0070669_100745688
421 Ga0070675_100182760
422 Ga0070671_100042895
423 Ga0070674_100202806
424 Ga0070667_100336050
425 Ga0070705_100400672
426 Ga0070700_100685856
427 Ga0070663_100248836
428 Ga0070678_100103793
429 Ga0070698_100133619
430 Ga0070672_100394443
431 Ga0070665_100720981
432 Ga0068863_101485076
433 Ga0068862_102190941
434 Ga0081539_10000895
435 Ga0070717_10850220
436 Ga0075365_10550808
437 Ga0075364_10002196
438 Ga0075364_10093050
439 Ga0075364_10660385
440 Ga0075362_10107431
441 Ga0075370_10234057
442 Ga0075430_100646612
443 Ga0105251_10077379
444 Ga0105244_10062186
445 Ga0105244_10072729
446 Ga0105244_10084937
447 Ga0105244_10112940
448 Ga0105245_10246822
449 Ga0105245_10303115
450 Ga0105245_10444325
451 Ga0105245_10466198
452 Ga0105243_10051834
453 Ga0105243_10172279
454 Ga0105243_12419923
455 Ga0105248_10022933
456 Ga0105238_11570571
457 Ga0105246_10017156
458 Ga0105246_10099727
459 Ga0105246_10347012
460 Ga0157373_10004969
461 Ga0157373_10174286
462 Ga0157369_10328769
463 Ga0157369_12320449
464 Ga0163162_10049622
465 Ga0163162_10655509
466 Ga0157375_10103829
467 Ga0157375_10266328
468 Ga0157375_12158108
469 Ga0157380_11288889
470 Ga0157380_12150933
471 Ga0163161_10094871
472 Ga0197907_11152192
473 Ga0206356_10234190
474 Ga0206349_1222662
475 Ga0206349_1809058
476 Ga0206352_10507655
477 Ga0206352_10831262
478 Ga0206352_10952531
479 Ga0206350_11076300
480 Ga0206354_10322157
481 Ga0206353_10357207
482 Ga0206353_11478853
483 Ga0209566_100222
484 Ga0209148_1001768
485 Ga0209759_1025234
486 Ga0209129_1000059
487 Ga0209129_1032837
488 Ga0209025_1001413
489 Ga0209051_1021155
490 Ga0207697_10003826
491 Ga0207655_1010437
492 Ga0207655_1079608
493 Ga0207655_1087251
494 Ga0207713_1103795
495 Ga0207682_10012601
496 Ga0207682_10424755
497 Ga0207688_10075447
498 Ga0207680_10142400
499 Ga0207645_10001262
500 Ga0207643_10107406
501 Ga0207681_10314850
502 Ga0207650_10164791
503 Ga0207659_10094673
504 Ga0207644_10140835
505 Ga0207686_11381614
506 Ga0207709_10105117
507 Ga0207709_10147516
508 Ga0207669_10150985
509 Ga0207691_10000200
510 Ga0207711_10608938
511 Ga0207667_11587262
512 Ga0207651_10102837
513 Ga0207668_11679128
514 Ga0207658_10632891
515 Ga0207708_10673508
516 Ga0207641_11090217
517 Ga0207683_10146377
518 Ga0307511_10298417
519 Ga0316182_1213394
520 Ga0307513_10023706
521 Ga0307413_10102621
522 Ga0307406_10009542
523 Ga0307412_10035798
524 Ga0307412_10040805
525 Ga0307412_10152811
526 Ga0307412_10917361
527 Ga0307414_10745220
528 Ga0307415_100439156
529 Ga0373926_0187075
530 Ga0316584_0529831
531 Ga0395900_0773467
532 Ga0436364_1400651
533 Ga0395901_0026936
534 Ga0395901_0866369
535 Ga0436365_1207250
536 Ga0436363_0892102
537 Ga0439465_0260867
538 Ga0451789_0531265
539 Ga0451800_0622492
540 Ga0451802_1121795
541 Ga0451843_1213301
542 Ga0450907_049882
543 Ga0466972_0203242
544 Ga0466963_0451382
545 Ga0466959_0899751
546 Ga0466958_0308998
547 Ga0466958_1009844
548 Ga0495629_0535241
549 Ga0495653_0191637
550 Ga0495580_0102532
551 Ga0495580_0118719
552 Ga0495580_0153242
553 Ga0495582_0005006
554 Ga0495582_0121200
555 Ga0495582_0387966
556 Ga0495639_0006567
557 Ga0495662_0595125
558 Ga0495664_0186482
559 Ga0495583_0113542
560 Ga0495606_0533193
561 Ga0495630_0078240
562 Ga0495630_0279658
563 Ga0495665_0041575
564 Ga0495665_0099606
565 Ga0495665_0511030
566 Ga0495586_0013555
567 Ga0495586_0034352
568 Ga0495587_0001374
569 Ga0495598_0055464
570 Ga0495598_0438172
571 Ga0495621_0237606
572 Ga0495645_0093228
573 Ga0495622_0336940
574 Ga0495633_0209794
575 Ga0495667_0183841
576 Ga0495656_0030425
577 Ga0495668_0160597
578 Ga0495588_0007013
579 Ga0495588_0015353
580 Ga0495588_0064672
581 Ga0495588_0134552
582 Ga0495657_0062375
583 Ga0495670_0031798
584 Ga0495670_0156356
585 Ga0495600_0026358
586 Ga0495600_0044283
587 Ga0495581_0056011
588 Ga0495581_0133887
589 Ga0495581_0157561
590 Ga0495581_0321154
591 Ga0495581_0391641
592 Ga0495636_0091142
593 Ga0495674_1130896
594 Ga0495676_0660618
595 Ga0495675_0158317
596 Ga0495685_147824
597 Ga0495593_0161253
598 Ga0495614_0218128
599 Ga0496100_0035646
600 Ga0496100_0219794
601 Ga0496100_0261522
602 Ga0496101_0316773
603 Ga0496101_0327887
604 Ga0496102_0172130
605 Ga0496102_0336533
606 Ga0496102_1247909
607 Ga0496103_0046330
608 Ga0496103_0071535
609 Ga0496104_0347286
610 Ga0496105_0096648
611 Ga0496105_0134590
612 Ga0496106_0086055
613 Ga0496106_0164113
614 Ga0496107_0050208
615 Ga0496107_0222717
616 Ga0496108_0834808
617 Ga0496109_0445353
618 Ga0496109_1350358
619 Ga0496110_0294754
620 Ga0496110_1074920
621 Ga0496110_1212527
622 Ga0496111_0332705
623 Ga0496112_0068497
624 Ga0496112_0239698
625 Ga0496113_0028595
626 Ga0496113_0279481
627 Ga0496113_0483414
628 Ga0496114_0240352
629 Ga0496114_1094759
630 Ga0496117_0318986
631 Ga0496119_0004565
632 Ga0496120_0004311
633 Ga0496122_0164245
634 Ga0496124_0086864
635 Ga0496124_0241383
636 Ga0496125_0141841
637 Ga0496125_0179463
638 Ga0496125_0577586
639 Ga0496126_0643640
640 Ga0501308_010995
641 Ga0501304_005589
642 Ga0501313_009124
643 Ga0501316_010211
644 Ga0501316_026016
645 Ga0501319_004518
646 Ga0501322_001132
647 Ga0501323_008508
648 Ga0501323_018420
649 Ga0501324_004558
650 Ga0501325_005972
651 Ga0501069_0082422
652 Ga0501071_1299382
653 Ga0501080_0945933
654 Ga0501083_0015386
655 Ga0501083_0232912
656 Ga0501044_0420680
657 nmdc:mga03683_29120_c1
658 nmdc:mga03n38_65956_c1
659 nmdc:mga03n38_714170_c1
660 nmdc:mga00v17_1972_c1
661 nmdc:mga00v17_578471_c1
662 nmdc:mga00v17_602680_c1
663 nmdc:mga06z11_746609_c1
664 nmdc:mga07m45_229438_c1
665 Ga0495619_0040069
666 Ga0500577_0190953
667 Ga0500616_0079655
668 Ga0587084_001220
669 Ga0587084_001963
670 Ga0587084_007278
671 Ga0587093_013099
672 Ga0587066_000296
673 Ga0587066_021854
674 Ga0587070_019011
675 Ga0587070_029297
676 Ga0587070_029843
677 Ga0587070_151231
678 Ga0587073_0014085
679 Ga0587073_0055633
680 Ga0587077_056661
681 Ga0587080_003400
682 Ga0587080_112466
683 Ga0587082_016384
684 Ga0587082_024554
685 Ga0587082_033184
686 Ga0587083_0003245
687 Ga0587085_009854
688 Ga0587085_015304
689 Ga0587085_016295
690 Ga0587086_006610
691 Ga0587088_000951
692 Ga0587088_003146
693 Ga0587088_019086
694 Ga0587088_020736
695 Ga0587088_022272
696 Ga0587088_033329
697 Ga0587089_001110
698 Ga0587089_023960
699 Ga0587090_001854
700 Ga0587090_005391
701 Ga0587090_007487
702 Ga0587090_038094
703 Ga0587090_039860
704 Ga0587090_073494
705 Ga0587091_017200
706 Ga0587091_051838
707 Ga0587092_003159
708 Ga0587094_000812
709 Ga0587094_009784
710 Ga0587094_024378
711 Ga0587098_051072
712 Ga0587106_004881
713 Ga0587106_008865
714 Ga0587106_025595
715 Ga0587106_038234
716 Ga0587121_01767
717 Ga0587121_07413
718 Ga0587125_011725
719 Ga0587131_001319
720 Ga0587131_003310
721 Ga0587099_005631
722 Ga0587101_011036
723 Ga0587101_018804
724 Ga0587109_023249
725 Ga0587113_010794
726 Ga0587115_031817
727 Ga0587117_009905
728 Ga0587117_017237
729 Ga0587128_015542
730 Ga0587130_004056
731 Ga0587062_001621
732 Ga0587062_004181
733 Ga0587067_001590
734 Ga0587067_015523
735 Ga0587068_017155
736 Ga0587068_020510
737 Ga0587069_012508
738 Ga0587069_019676
739 Ga0587072_002353
740 Ga0587075_001116
741 Ga0587075_019979
742 Ga0587076_028484
743 Ga0587076_038318
744 Ga0587076_121793
745 Ga0587078_000839
746 Ga0587078_015471
747 Ga0587078_017666
748 Ga0587079_014173
749 Ga0587079_022766
750 Ga0587079_030374
751 Ga0587079_057324
752 Ga0587079_110056
753 Ga0587079_140906
754 Ga0587105_006941
755 Ga0587107_011786
756 Ga0587108_002820
757 Ga0587110_005797
758 Ga0587110_007382
759 Ga0587114_015635
760 Ga0587116_04445
761 Ga0587119_009468
762 Ga0587124_005609
763 Ga0587124_023943
764 Ga0587071_001334
765 Ga0587111_0001573
766 Ga0587111_0009849
767 Ga0587111_0029624
768 Ga0587111_0052414
769 2506867541
770 2508677979
771 2552107740
772 2623590781
773 2671836135
774 2676204334
775 2689958884
776 2689991396
777 2744955758
778 2758224717
779 2774378858
780 2774848910
781 2774854291
782 2774902111
783 2776373220
784 2844851947
785 2848551589
786 2855684687
787 2857729828
788 2857740593
789 2863070781
790 2866555269
791 2893685819
792 2908678464
793 2910814633
794 2919035782
795 2919063549
796 2919070788
797 2919539003
798 2919717491
799 2932427584
800 2939648240
801 2939677165
802 8001783842
803 8002320968
804 8046994594
805 8054109877
806 8055413482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

61

160

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mjn-assembly2.cif.gz_C crystal structure of an organic hydroperoxide resistance protein osmc, predicted redox protein, regulator of sulfide bond formation from legionella pneumophila 0.9612 2 138
3lus-assembly1.cif.gz_A crystal structure of a putative organic hydroperoxide resistance protein with molecule of captopril bound in one of the active sites from vibrio cholerae o1 biovar eltor str. n16961 0.9582 2 138
1n2f-assembly1.cif.gz_B crystal structure of p. aeruginosa ohr 0.949 1 139
6d9n-assembly1.cif.gz_A crystal structure of an organic hydroperoxide resistance protein from elizabethkingia anophelis with crystallant-derived thiocyanate bound 0.9462 1 141
6ed0-assembly1.cif.gz_B "ohra (organic hydroperoxide resistance protein) mutant (c61s) in the ""open conformation"" from chromobacterium violaceum" 0.9435 2 139
ID Description Score Start End Superfamily
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9462 45 141 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9368 45 141 3.30.300.20
af_Q2G1T3_42_139_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9281 45 141 3.30.300.20
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9279 45 139 3.30.300.20
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9184 45 139 3.30.300.20
ID Description Score Start End GO Terms
AF-L7FIR8-F1-model_v4 Peroxiredoxin, Ohr family protein 0.9868 2 139 GO:0006979
AF-A0A0U3F9M2-F1-model_v4 Organic hydroperoxide resistance protein 0.9849 2 139 GO:0006979
AF-S5VP15-F1-model_v4 Stress response protein 0.9848 2 139 GO:0006979
AF-A0A538PH62-F1-model_v4 Ohr family peroxiredoxin 0.984 46 139 GO:0006979
AF-E3B874-F1-model_v4 deleted 0.9831 1 139

Map