F435523

General Info

Members Datasets Scaffolds Average Seq Length
403 247 806 123

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0345607|Ga0501034_0345607_20_457
Length 145
Sequence MRASGEDLPQILGLQQLSRSNAMKTNPVVWFEIYVQDMERAKTFYEGVLQGKLERIPSPDIELWAFPMSEEGYGAAGALAKMEGCPSGGSSILVYFKCEDCAVEAARAAEHGGRLFKEKMSIGQYGFIALVLDTEGNMIGLHSMQ

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
120 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
121 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
122 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
131 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
132 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
133 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
150 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
151 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
152 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
155 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
156 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
191 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
204 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
224 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
225 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
226 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
227 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
228 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
232 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
244 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
245 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.26
Metatranscriptomes 1.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 3.23
Rhizosphere 94.04
Stem 0
Stem Tuber 0
Unclassified 13.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0345607 3300049571 Bacteria 1417
2 Ga0065712_10004983 3300005290 Bacteria 8476
3 Ga0065712_10007295 3300005290 Bacteria 2972
4 Ga0065715_10104612 3300005293 Unclassified 2949
5 Ga0065707_10084718 3300005295 Bacteria 6855
6 Ga0065707_10122634 3300005295 Bacteria 2083
7 Ga0070676_10006233 3300005328 Bacteria 6372
8 Ga0070683_100146182 3300005329 Unclassified 2240
9 Ga0070690_100040298 3300005330 Bacteria 2954
10 Ga0070677_10137984 3300005333 Bacteria 1121
11 Ga0070677_10198153 3300005333 Bacteria 967
12 Ga0068869_100420111 3300005334 Bacteria 1103
13 Ga0070680_100331979 3300005336 Bacteria 1291
14 Ga0070680_100966792 3300005336 Bacteria 735
15 Ga0070682_100007448 3300005337 Bacteria 6172
16 Ga0070682_100058917 3300005337 Bacteria 2423
17 Ga0070682_100180174 3300005337 Bacteria 1475
18 Ga0070682_100244887 3300005337 Bacteria 1289
19 Ga0068868_100065943 3300005338 Bacteria 2877
20 Ga0070660_100002856 3300005339 Bacteria 11893
21 Ga0070660_100104689 3300005339 Bacteria 2245
22 Ga0070660_100325034 3300005339 Bacteria 1264
23 Ga0070661_100007701 3300005344 Bacteria 7440
24 Ga0070668_100346678 3300005347 Bacteria 1256
25 Ga0070669_100142449 3300005353 Bacteria 1849
26 Ga0070675_100081456 3300005354 Bacteria 2699
27 Ga0070671_101729115 3300005355 Unclassified 555
28 Ga0070674_100676187 3300005356 Bacteria 880
29 Ga0070688_100746608 3300005365 Bacteria 761
30 Ga0070659_100004956 3300005366 Bacteria 9526
31 Ga0070659_100066271 3300005366 Bacteria 2861
32 Ga0070659_100159796 3300005366 Bacteria 1842
33 Ga0070659_100302680 3300005366 Bacteria 1334
34 Ga0070659_101766244 3300005366 Unclassified 554
35 Ga0070667_100576219 3300005367 Bacteria 1036
36 Ga0070714_100032107 3300005435 Unclassified 4383
37 Ga0070705_101106674 3300005440 Unclassified 648
38 Ga0070700_100040786 3300005441 Unclassified 2844
39 Ga0070663_100103843 3300005455 Bacteria 2125
40 Ga0070663_100305541 3300005455 Bacteria 1275
41 Ga0070663_101385088 3300005455 Bacteria 622
42 Ga0070663_101425540 3300005455 Bacteria 614
43 Ga0070678_100013182 3300005456 Bacteria 5172
44 Ga0070662_100070451 3300005457 Bacteria 2576
45 Ga0070662_100099912 3300005457 Bacteria 2194
46 Ga0070662_100365175 3300005457 Bacteria 1185
47 Ga0070681_10064191 3300005458 Bacteria 3643
48 Ga0068867_100828915 3300005459 Bacteria 827
49 Ga0070685_10865649 3300005466 Unclassified 670
50 Ga0070679_100357368 3300005530 Bacteria 1408
51 Ga0070679_100631728 3300005530 Bacteria 1014
52 Ga0070684_101408026 3300005535 Unclassified 657
53 Ga0070697_100228753 3300005536 Bacteria 1586
54 Ga0068853_100080535 3300005539 Bacteria 2849
55 Ga0068853_100132233 3300005539 Bacteria 2235
56 Ga0070672_100118555 3300005543 Bacteria 2164
57 Ga0070672_100531846 3300005543 Bacteria 1019
58 Ga0070686_100740517 3300005544 Bacteria 787
59 Ga0070696_100058287 3300005546 Bacteria 2696
60 Ga0070696_100220694 3300005546 Bacteria 1422
61 Ga0070693_100293671 3300005547 Bacteria 1093
62 Ga0070693_100883613 3300005547 Bacteria 668
63 Ga0070665_101877851 3300005548 Unclassified 605
64 Ga0070704_100448715 3300005549 Bacteria 1110
65 Ga0068855_100729284 3300005563 Bacteria 1058
66 Ga0068855_101522005 3300005563 Bacteria 686
67 Ga0070664_100004295 3300005564 Bacteria 11458
68 Ga0070664_101095603 3300005564 Bacteria 750
69 Ga0070664_101134503 3300005564 Bacteria 737
70 Ga0068854_100232921 3300005578 Bacteria 1463
71 Ga0068856_100104918 3300005614 Unclassified 2821
72 Ga0068856_100340506 3300005614 Bacteria 1518
73 Ga0068852_100173065 3300005616 Bacteria 2025
74 Ga0068859_101204634 3300005617 Unclassified 834
75 Ga0068866_10491064 3300005718 Bacteria 811
76 Ga0068861_100181414 3300005719 Bacteria 1753
77 Ga0068863_100135681 3300005841 Bacteria 2351
78 Ga0068863_101656040 3300005841 Bacteria 649
79 Ga0068862_100583470 3300005844 Bacteria 1071
80 Ga0081538_10364873 3300005981 Bacteria 522
81 Ga0075370_10071164 3300006353 Bacteria 1990
82 Ga0068871_100329387 3300006358 Bacteria 1347
83 Ga0075433_10093918 3300006852 Bacteria 2654
84 Ga0075433_10111881 3300006852 Unclassified 2422
85 Ga0075433_10176278 3300006852 Bacteria 1903
86 Ga0075434_100046916 3300006871 Bacteria 4287
87 Ga0075434_100101254 3300006871 Bacteria 2887
88 Ga0075434_100352900 3300006871 Bacteria 1492
89 Ga0075429_100675100 3300006880 Bacteria 905
90 Ga0075429_101269543 3300006880 Unclassified 642
91 Ga0075436_100297541 3300006914 Bacteria 1156
92 Ga0097620_101204737 3300006931 Unclassified 834
93 Ga0075435_100034669 3300007076 Bacteria 4000
94 Ga0075435_100066212 3300007076 Bacteria 2939
95 Ga0075435_100185703 3300007076 Bacteria 1758
96 Ga0075435_101149568 3300007076 Unclassified 679
97 Ga0105250_10000022 3300009092 Bacteria 231610
98 Ga0111539_10452410 3300009094 Bacteria 1495
99 Ga0111539_10733470 3300009094 Bacteria 1150
100 Ga0105245_10198157 3300009098 Bacteria 1927
101 Ga0114129_10055264 3300009147 Bacteria 5565
102 Ga0114129_10091436 3300009147 Bacteria 4216
103 Ga0114129_10139358 3300009147 Bacteria 3326
104 Ga0114129_10700687 3300009147 Bacteria 1301
105 Ga0114129_11437599 3300009147 Unclassified 850
106 Ga0105241_10916090 3300009174 Bacteria 815
107 Ga0105242_10440551 3300009176 Bacteria 1226
108 Ga0105242_10684469 3300009176 Unclassified 1001
109 Ga0105242_10848571 3300009176 Bacteria 909
110 Ga0105237_10327266 3300009545 Bacteria 1536
111 Ga0105238_12915152 3300009551 Unclassified 514
112 Ga0105249_10083326 3300009553 Bacteria 2976
113 Ga0105239_11978249 3300010375 Unclassified 676
114 Ga0157373_10613435 3300013100 Bacteria 793
115 Ga0157369_12666280 3300013105 Bacteria 504
116 Ga0157374_10001171 3300013296 Bacteria 22370
117 Ga0157374_10063249 3300013296 Unclassified 3470
118 Ga0157378_10074447 3300013297 Unclassified 3056
119 Ga0157378_10556390 3300013297 Bacteria 1153
120 Ga0163162_10316803 3300013306 Bacteria 1692
121 Ga0163162_10524557 3300013306 Unclassified 1314
122 Ga0157372_10142700 3300013307 Bacteria 2761
123 Ga0182008_10021709 3300014497 Bacteria 3296
124 Ga0157379_10000176 3300014968 Bacteria 48211
125 Ga0157376_10043353 3300014969 Bacteria 3692
126 Ga0163161_10135792 3300017792 Bacteria 1859
127 Ga0206352_10980403 3300020078 Bacteria 666
128 Ga0213872_10017747 3300021361 Bacteria 3285
129 Ga0207697_10096065 3300025315 Bacteria 1260
130 Ga0207696_1000450 3300025711 Bacteria 36003
131 Ga0207682_10053730 3300025893 Bacteria 1671
132 Ga0207645_10003857 3300025907 Bacteria 11220
133 Ga0207684_11185840 3300025910 Unclassified 633
134 Ga0207654_10112048 3300025911 Bacteria 1699
135 Ga0207707_10240354 3300025912 Bacteria 1574
136 Ga0207657_10018511 3300025919 Bacteria 6644
137 Ga0207657_10203955 3300025919 Bacteria 1590
138 Ga0207649_10025866 3300025920 Bacteria 3428
139 Ga0207652_11736399 3300025921 Bacteria 529
140 Ga0207650_10812782 3300025925 Bacteria 792
141 Ga0207687_10456933 3300025927 Bacteria 1060
142 Ga0207664_10026408 3300025929 Unclassified 4389
143 Ga0207690_10013185 3300025932 Bacteria 4961
144 Ga0207690_10100735 3300025932 Bacteria 2062
145 Ga0207690_10182649 3300025932 Bacteria 1581
146 Ga0207690_11650653 3300025932 Bacteria 535
147 Ga0207706_10086056 3300025933 Bacteria 2763
148 Ga0207706_10382401 3300025933 Bacteria 1221
149 Ga0207669_10615298 3300025937 Bacteria 884
150 Ga0207704_10958210 3300025938 Bacteria 722
151 Ga0207691_10027107 3300025940 Bacteria 5376
152 Ga0207689_10287639 3300025942 Bacteria 1361
153 Ga0207661_10373164 3300025944 Unclassified 1290
154 Ga0207679_10002348 3300025945 Bacteria 11641
155 Ga0207679_10019717 3300025945 Bacteria 4538
156 Ga0207679_10189552 3300025945 Bacteria 1708
157 Ga0207679_10412307 3300025945 Bacteria 1190
158 Ga0207668_10073825 3300025972 Bacteria 2446
159 Ga0207668_10290003 3300025972 Bacteria 1346
160 Ga0207639_11392945 3300026041 Bacteria 658
161 Ga0207678_10332488 3300026067 Bacteria 1308
162 Ga0207678_10793670 3300026067 Bacteria 836
163 Ga0207678_10872959 3300026067 Unclassified 795
164 Ga0207708_10015042 3300026075 Bacteria 5799
165 Ga0207702_10335885 3300026078 Bacteria 1442
166 Ga0207702_10501666 3300026078 Bacteria 1183
167 Ga0207702_12459819 3300026078 Unclassified 507
168 Ga0207641_11001882 3300026088 Bacteria 832
169 Ga0207676_12322051 3300026095 Unclassified 534
170 Ga0207675_100512090 3300026118 Bacteria 1195
171 Ga0207683_10006671 3300026121 Bacteria 9876
172 Ga0207698_10063037 3300026142 Bacteria 2899
173 Ga0207428_10174273 3300027907 Bacteria 1628
174 Ga0207428_10376057 3300027907 Bacteria 1043
175 Ga0207428_10888679 3300027907 Bacteria 630
176 Ga0268266_10628300 3300028379 Bacteria 1033
177 Ga0268264_12433108 3300028381 Unclassified 529
178 Ga0307513_10003182 3300031456 Bacteria 22416
179 Ga0307408_102197218 3300031548 Bacteria 533
180 Ga0316575_10023600 3300031665 Unclassified 2378
181 Ga0316579_10010757 3300031691 Bacteria 3875
182 Ga0316579_10085626 3300031691 Bacteria 1504
183 Ga0316576_10002164 3300031727 Bacteria 11080
184 Ga0316576_10086068 3300031727 Bacteria 2337
185 Ga0316576_10437900 3300031727 Bacteria 966
186 Ga0316577_10047640 3300031733 Unclassified 2393
187 Ga0307413_10981347 3300031824 Bacteria 723
188 Ga0307406_11194023 3300031901 Bacteria 660
189 Ga0307412_10551212 3300031911 Bacteria 968
190 Ga0307416_102229142 3300032002 Unclassified 649
191 Ga0307414_10053284 3300032004 Bacteria 2820
192 Ga0307414_11205692 3300032004 Bacteria 701
193 Ga0307411_11375322 3300032005 Bacteria 645
194 Ga0307415_102487009 3300032126 Bacteria 510
195 Ga0316583_10001108 3300032133 Bacteria 8772
196 Ga0316585_10003539 3300032137 Bacteria 4297
197 Ga0316580_10000320 3300032139 Bacteria 10517
198 Ga0316593_10077443 3300032168 Bacteria 1156
199 Ga0316592_1024285 3300033524 Unclassified 1303
200 Ga0316586_1018650 3300033527 Bacteria 1127
201 Ga0316588_1002255 3300033528 Bacteria 3344
202 Ga0316587_1018205 3300033529 Bacteria 1182
203 Ga0316596_1037089 3300033541 Unclassified 1275
204 Ga0373929_0000001 3300035085 Bacteria 956023
205 Ga0373951_0006849 3300035091 Bacteria 2604
206 Ga0373960_0147251 3300035121 Unclassified 802
207 Ga0316574_0043511 3300035398 Unclassified 2774
208 Ga0316574_0426583 3300035398 Bacteria 833
209 Ga0373931_0030551 3300035691 Bacteria 2774
210 Ga0373937_0487755 3300036401 Unclassified 1171
211 Ga0316582_0015380 3300036647 Bacteria 4373
212 Ga0316584_0004312 3300036712 Bacteria 9404
213 Ga0451802_1788758 3300041460 Unclassified 605
214 Ga0451807_2703505 3300041486 Bacteria 958
215 Ga0451833_1300444 3300041491 Bacteria 1014
216 Ga0451841_0003756 3300041498 Bacteria 885
217 Ga0451845_0756109 3300041501 Bacteria 2427
218 Ga0451843_0087507 3300041509 Bacteria 1118
219 Ga0451853_0704546 3300041512 Bacteria 1302
220 Ga0439441_022431 3300042001 Bacteria 1173
221 Ga0439455_0123478 3300042012 Unclassified 727
222 Ga0450923_055264 3300042125 Unclassified 859
223 Ga0451577_0032678 3300042876 Bacteria 4688
224 Ga0451577_1025449 3300042876 Unclassified 740
225 Ga0453683_0024591 3300044673 Unclassified 3831
226 Ga0453684_0794242 3300044712 Bacteria 1021
227 Ga0453684_0860226 3300044712 Bacteria 974
228 Ga0466957_0046622 3300044842 Bacteria 2632
229 Ga0451576_0064941 3300045051 Bacteria 3801
230 Ga0451576_0367296 3300045051 Unclassified 1507
231 Ga0451576_1786228 3300045051 Unclassified 636
232 Ga0451576_1961660 3300045051 Unclassified 603
233 Ga0495592_0432996 3300046454 Unclassified 827
234 Ga0495590_0213481 3300046457 Bacteria 711
235 Ga0495641_0084411 3300046461 Bacteria 1422
236 Ga0495582_0670078 3300046473 Unclassified 600
237 Ga0495605_0103178 3300046474 Bacteria 1308
238 Ga0495594_0067133 3300046499 Bacteria 1990
239 Ga0495594_0281063 3300046499 Bacteria 948
240 Ga0495607_0016564 3300046501 Bacteria 4755
241 Ga0495607_0188905 3300046501 Bacteria 1027
242 Ga0495583_0008390 3300046506 Bacteria 6323
243 Ga0495616_0004752 3300046513 Bacteria 8512
244 Ga0495631_0000356 3300046518 Bacteria 31531
245 Ga0495631_0049853 3300046518 Bacteria 1832
246 Ga0495632_0155179 3300046519 Bacteria 1057
247 Ga0495643_0283798 3300046522 Bacteria 761
248 Ga0495648_0019518 3300046524 Bacteria 4763
249 Ga0495648_0133396 3300046524 Bacteria 1317
250 Ga0495648_0133742 3300046524 Bacteria 1315
251 Ga0495648_0174938 3300046524 Bacteria 1096
252 Ga0495666_0180182 3300046526 Bacteria 976
253 Ga0495654_0012195 3300046530 Bacteria 4623
254 Ga0495586_0003759 3300046535 Bacteria 8133
255 Ga0495597_0000658 3300046542 Bacteria 28082
256 Ga0495597_0087201 3300046542 Bacteria 1328
257 Ga0495633_0110863 3300046558 Bacteria 1272
258 Ga0495633_0245338 3300046558 Bacteria 818
259 Ga0495633_0249970 3300046558 Bacteria 809
260 Ga0495668_0001640 3300046616 Bacteria 20874
261 Ga0495611_0326762 3300046648 Bacteria 705
262 Ga0495661_0055618 3300046665 Bacteria 2371
263 Ga0495661_0079266 3300046665 Bacteria 1897
264 Ga0495588_0038899 3300046674 Bacteria 2421
265 Ga0495658_0060400 3300046683 Bacteria 2174
266 Ga0495669_0059272 3300046684 Bacteria 1728
267 Ga0495670_0176289 3300046691 Bacteria 1127
268 Ga0495671_0139250 3300046692 Bacteria 1182
269 Ga0495671_0315316 3300046692 Bacteria 751
270 Ga0495660_0055877 3300046810 Bacteria 2135
271 Ga0495660_0086390 3300046810 Bacteria 1637
272 Ga0495660_0455607 3300046810 Bacteria 552
273 Ga0495676_0426128 3300047321 Bacteria 877
274 Ga0495679_011835 3300047446 Bacteria 3351
275 Ga0495685_004416 3300047447 Bacteria 4544
276 Ga0495673_0200818 3300047469 Bacteria 746
277 Ga0495681_0001441 3300047470 Bacteria 17863
278 Ga0495681_0120432 3300047470 Bacteria 1126
279 Ga0495626_0082725 3300048091 Bacteria 1423
280 Ga0495626_0090966 3300048091 Bacteria 1341
281 Ga0496100_1182525 3300048903 Unclassified 603
282 Ga0496102_0080138 3300048905 Bacteria 3008
283 Ga0496102_0089379 3300048905 Bacteria 2849
284 Ga0496104_1117537 3300048907 Bacteria 692
285 Ga0496109_1979857 3300048912 Unclassified 515
286 Ga0496110_0000531 3300048913 Bacteria 25914
287 Ga0496110_0013829 3300048913 Bacteria 6688
288 Ga0496111_0315142 3300048914 Bacteria 1159
289 Ga0496111_0321823 3300048914 Bacteria 1145
290 Ga0496113_0181405 3300048916 Bacteria 1669
291 Ga0496115_0905464 3300048918 Bacteria 680
292 Ga0495678_000462 3300049459 Bacteria 40442
293 Ga0495678_000695 3300049459 Bacteria 30589
294 Ga0495678_015480 3300049459 Bacteria 3506
295 Ga0495682_0123618 3300049460 Bacteria 926
296 Ga0501031_0017802 3300049568 Unclassified 4620
297 Ga0501031_0046475 3300049568 Bacteria 2830
298 Ga0501031_1030915 3300049568 Bacteria 525
299 Ga0501032_0003174 3300049569 Bacteria 12649
300 Ga0501032_0098035 3300049569 Bacteria 1942
301 Ga0501032_0127454 3300049569 Bacteria 1680
302 Ga0501032_0131766 3300049569 Bacteria 1649
303 Ga0501032_0324811 3300049569 Bacteria 993
304 Ga0501032_0639002 3300049569 Bacteria 676
305 Ga0501033_0000064 3300049570 Bacteria 100787
306 Ga0501033_0001733 3300049570 Bacteria 19073
307 Ga0501033_0024817 3300049570 Bacteria 4521
308 Ga0501033_0589559 3300049570 Bacteria 763
309 Ga0501034_0305147 3300049571 Bacteria 1528
310 Ga0501036_0002263 3300049572 Bacteria 15039
311 Ga0501036_0002767 3300049572 Bacteria 13888
312 Ga0501036_0100960 3300049572 Bacteria 2440
313 Ga0501036_0105541 3300049572 Bacteria 2383
314 Ga0501036_0113051 3300049572 Bacteria 2295
315 Ga0501036_0215594 3300049572 Bacteria 1613
316 Ga0501037_0014180 3300049573 Bacteria 5868
317 Ga0501037_0044095 3300049573 Bacteria 3277
318 Ga0501037_0157515 3300049573 Bacteria 1620
319 Ga0501037_0186337 3300049573 Bacteria 1470
320 Ga0501037_0878114 3300049573 Bacteria 589
321 Ga0501038_0000824 3300049574 Bacteria 27598
322 Ga0501038_0008142 3300049574 Bacteria 9646
323 Ga0501038_0009674 3300049574 Bacteria 8841
324 Ga0501038_0021420 3300049574 Bacteria 5802
325 Ga0501038_0053771 3300049574 Bacteria 3465
326 Ga0501038_0173083 3300049574 Bacteria 1746
327 Ga0501038_0187950 3300049574 Bacteria 1663
328 Ga0501038_0397861 3300049574 Bacteria 1066
329 Ga0501038_0521522 3300049574 Bacteria 906
330 Ga0501039_0032541 3300049575 Bacteria 4021
331 Ga0501039_0200624 3300049575 Bacteria 1568
332 Ga0501039_0239510 3300049575 Bacteria 1426
333 Ga0501039_0411377 3300049575 Bacteria 1062
334 Ga0501039_0530310 3300049575 Bacteria 924
335 Ga0501040_0027120 3300049576 Bacteria 3855
336 Ga0501042_0008708 3300049578 Bacteria 6728
337 Ga0501043_0021225 3300049579 Bacteria 5090
338 Ga0501043_0030446 3300049579 Bacteria 4242
339 Ga0501043_0031905 3300049579 Bacteria 4140
340 Ga0501043_0068834 3300049579 Bacteria 2779
341 Ga0501043_0105294 3300049579 Bacteria 2216
342 Ga0501043_0187567 3300049579 Bacteria 1609
343 Ga0501046_0027932 3300049580 Bacteria 4599
344 Ga0501046_0063416 3300049580 Bacteria 2885
345 Ga0501047_0004825 3300049581 Bacteria 12671
346 Ga0501047_0071914 3300049581 Unclassified 3329
347 Ga0501047_0257600 3300049581 Bacteria 1592
348 Ga0501047_0338934 3300049581 Bacteria 1341
349 Ga0501048_0011875 3300049582 Bacteria 6494
350 Ga0501068_0036437 3300049584 Bacteria 2941
351 Ga0501070_0819854 3300049586 Bacteria 730
352 Ga0501073_0158072 3300049589 Bacteria 1570
353 Ga0501074_0352845 3300049590 Bacteria 1044
354 Ga0501077_0399317 3300049593 Bacteria 879
355 Ga0501198_147175 3300049649 Bacteria 516
356 Ga0501209_266425 3300049656 Bacteria 537
357 Ga0501235_147512 3300049669 Bacteria 607
358 Ga0501239_016444 3300049672 Bacteria 873
359 Ga0501242_054580 3300049674 Bacteria 594
360 Ga0501261_058480 3300049690 Bacteria 649
361 Ga0501080_0800450 3300049742 Bacteria 827
362 Ga0501083_0035431 3300049744 Bacteria 3409
363 Ga0501241_095305 3300049758 Bacteria 635
364 Ga0501270_089939 3300049767 Bacteria 625
365 Ga0501035_0000386 3300049822 Bacteria 50709
366 Ga0501035_0020071 3300049822 Bacteria 6136
367 Ga0501035_0029085 3300049822 Bacteria 5039
368 Ga0501035_0061215 3300049822 Bacteria 3350
369 Ga0501035_0108736 3300049822 Bacteria 2431
370 Ga0501035_0259270 3300049822 Bacteria 1474
371 Ga0501044_0000384 3300049823 Bacteria 54969
372 Ga0501044_0005650 3300049823 Bacteria 13870
373 Ga0501044_0012367 3300049823 Bacteria 9239
374 Ga0501044_0058571 3300049823 Bacteria 3950
375 Ga0501044_0112285 3300049823 Bacteria 2732
376 Ga0501044_0115158 3300049823 Bacteria 2693
377 Ga0501044_0205271 3300049823 Bacteria 1927
378 nmdc:mga0k408_575402_c1 3300050493 Bacteria 665
379 nmdc:mga05p37_148423_c1 3300050507 Bacteria 2870
380 nmdc:mga05p37_28147_c1 3300050507 Bacteria 6850
381 nmdc:mga05p37_758781_c1 3300050507 Bacteria 1068
382 nmdc:mga09592_1188576_c1 3300050508 Unclassified 631
383 nmdc:mga08y16_30681_c1 3300050511 Bacteria 5654
384 nmdc:mga08y16_453874_c1 3300050511 Bacteria 1307
385 nmdc:mga08y16_722107_c1 3300050511 Unclassified 994
386 nmdc:mga08y16_904802_c1 3300050511 Bacteria 868
387 nmdc:mga0n895_15866_c1 3300050512 Bacteria 6889
388 nmdc:mga0n895_377495_c1 3300050512 Bacteria 1435
389 nmdc:mga0n895_47856_c1 3300050512 Bacteria 4183
390 nmdc:mga0n895_81665_c1 3300050512 Unclassified 3221
391 nmdc:mga0rr50_325085_c1 3300050513 Bacteria 1290
392 nmdc:mga0rr50_43605_c1 3300050513 Bacteria 3284
393 nmdc:mga0rr50_478181_c1 3300050513 Bacteria 1058
394 nmdc:mga08x19_238419_c1 3300050514 Bacteria 1253
395 nmdc:mga08x19_583294_c1 3300050514 Bacteria 792
396 nmdc:mga0a205_203999_c1 3300050515 Bacteria 1867
397 nmdc:mga0a205_317633_c1 3300050515 Bacteria 1429
398 nmdc:mga0a205_35833_c1 3300050515 Bacteria 4766
399 Ga0500590_045665 3300053148 Bacteria 2242
400 Ga0500636_0000673 3300053177 Bacteria 18364
401 Ga0500637_0000924 3300053178 Bacteria 11866
402 Ga0501084_0805385 3300054114 Bacteria 791
403 Ga0530510_0017580 3300061734 Bacteria 5068
404 Ga0501034_0345607
405 Ga0065712_10004983
406 Ga0065712_10007295
407 Ga0065715_10104612
408 Ga0065707_10084718
409 Ga0065707_10122634
410 Ga0070676_10006233
411 Ga0070683_100146182
412 Ga0070690_100040298
413 Ga0070677_10137984
414 Ga0070677_10198153
415 Ga0068869_100420111
416 Ga0070680_100331979
417 Ga0070680_100966792
418 Ga0070682_100007448
419 Ga0070682_100058917
420 Ga0070682_100180174
421 Ga0070682_100244887
422 Ga0068868_100065943
423 Ga0070660_100002856
424 Ga0070660_100104689
425 Ga0070660_100325034
426 Ga0070661_100007701
427 Ga0070668_100346678
428 Ga0070669_100142449
429 Ga0070675_100081456
430 Ga0070671_101729115
431 Ga0070674_100676187
432 Ga0070688_100746608
433 Ga0070659_100004956
434 Ga0070659_100066271
435 Ga0070659_100159796
436 Ga0070659_100302680
437 Ga0070659_101766244
438 Ga0070667_100576219
439 Ga0070714_100032107
440 Ga0070705_101106674
441 Ga0070700_100040786
442 Ga0070663_100103843
443 Ga0070663_100305541
444 Ga0070663_101385088
445 Ga0070663_101425540
446 Ga0070678_100013182
447 Ga0070662_100070451
448 Ga0070662_100099912
449 Ga0070662_100365175
450 Ga0070681_10064191
451 Ga0068867_100828915
452 Ga0070685_10865649
453 Ga0070679_100357368
454 Ga0070679_100631728
455 Ga0070684_101408026
456 Ga0070697_100228753
457 Ga0068853_100080535
458 Ga0068853_100132233
459 Ga0070672_100118555
460 Ga0070672_100531846
461 Ga0070686_100740517
462 Ga0070696_100058287
463 Ga0070696_100220694
464 Ga0070693_100293671
465 Ga0070693_100883613
466 Ga0070665_101877851
467 Ga0070704_100448715
468 Ga0068855_100729284
469 Ga0068855_101522005
470 Ga0070664_100004295
471 Ga0070664_101095603
472 Ga0070664_101134503
473 Ga0068854_100232921
474 Ga0068856_100104918
475 Ga0068856_100340506
476 Ga0068852_100173065
477 Ga0068859_101204634
478 Ga0068866_10491064
479 Ga0068861_100181414
480 Ga0068863_100135681
481 Ga0068863_101656040
482 Ga0068862_100583470
483 Ga0081538_10364873
484 Ga0075370_10071164
485 Ga0068871_100329387
486 Ga0075433_10093918
487 Ga0075433_10111881
488 Ga0075433_10176278
489 Ga0075434_100046916
490 Ga0075434_100101254
491 Ga0075434_100352900
492 Ga0075429_100675100
493 Ga0075429_101269543
494 Ga0075436_100297541
495 Ga0097620_101204737
496 Ga0075435_100034669
497 Ga0075435_100066212
498 Ga0075435_100185703
499 Ga0075435_101149568
500 Ga0105250_10000022
501 Ga0111539_10452410
502 Ga0111539_10733470
503 Ga0105245_10198157
504 Ga0114129_10055264
505 Ga0114129_10091436
506 Ga0114129_10139358
507 Ga0114129_10700687
508 Ga0114129_11437599
509 Ga0105241_10916090
510 Ga0105242_10440551
511 Ga0105242_10684469
512 Ga0105242_10848571
513 Ga0105237_10327266
514 Ga0105238_12915152
515 Ga0105249_10083326
516 Ga0105239_11978249
517 Ga0157373_10613435
518 Ga0157369_12666280
519 Ga0157374_10001171
520 Ga0157374_10063249
521 Ga0157378_10074447
522 Ga0157378_10556390
523 Ga0163162_10316803
524 Ga0163162_10524557
525 Ga0157372_10142700
526 Ga0182008_10021709
527 Ga0157379_10000176
528 Ga0157376_10043353
529 Ga0163161_10135792
530 Ga0206352_10980403
531 Ga0213872_10017747
532 Ga0207697_10096065
533 Ga0207696_1000450
534 Ga0207682_10053730
535 Ga0207645_10003857
536 Ga0207684_11185840
537 Ga0207654_10112048
538 Ga0207707_10240354
539 Ga0207657_10018511
540 Ga0207657_10203955
541 Ga0207649_10025866
542 Ga0207652_11736399
543 Ga0207650_10812782
544 Ga0207687_10456933
545 Ga0207664_10026408
546 Ga0207690_10013185
547 Ga0207690_10100735
548 Ga0207690_10182649
549 Ga0207690_11650653
550 Ga0207706_10086056
551 Ga0207706_10382401
552 Ga0207669_10615298
553 Ga0207704_10958210
554 Ga0207691_10027107
555 Ga0207689_10287639
556 Ga0207661_10373164
557 Ga0207679_10002348
558 Ga0207679_10019717
559 Ga0207679_10189552
560 Ga0207679_10412307
561 Ga0207668_10073825
562 Ga0207668_10290003
563 Ga0207639_11392945
564 Ga0207678_10332488
565 Ga0207678_10793670
566 Ga0207678_10872959
567 Ga0207708_10015042
568 Ga0207702_10335885
569 Ga0207702_10501666
570 Ga0207702_12459819
571 Ga0207641_11001882
572 Ga0207676_12322051
573 Ga0207675_100512090
574 Ga0207683_10006671
575 Ga0207698_10063037
576 Ga0207428_10174273
577 Ga0207428_10376057
578 Ga0207428_10888679
579 Ga0268266_10628300
580 Ga0268264_12433108
581 Ga0307513_10003182
582 Ga0307408_102197218
583 Ga0316575_10023600
584 Ga0316579_10010757
585 Ga0316579_10085626
586 Ga0316576_10002164
587 Ga0316576_10086068
588 Ga0316576_10437900
589 Ga0316577_10047640
590 Ga0307413_10981347
591 Ga0307406_11194023
592 Ga0307412_10551212
593 Ga0307416_102229142
594 Ga0307414_10053284
595 Ga0307414_11205692
596 Ga0307411_11375322
597 Ga0307415_102487009
598 Ga0316583_10001108
599 Ga0316585_10003539
600 Ga0316580_10000320
601 Ga0316593_10077443
602 Ga0316592_1024285
603 Ga0316586_1018650
604 Ga0316588_1002255
605 Ga0316587_1018205
606 Ga0316596_1037089
607 Ga0373929_0000001
608 Ga0373951_0006849
609 Ga0373960_0147251
610 Ga0316574_0043511
611 Ga0316574_0426583
612 Ga0373931_0030551
613 Ga0373937_0487755
614 Ga0316582_0015380
615 Ga0316584_0004312
616 Ga0451802_1788758
617 Ga0451807_2703505
618 Ga0451833_1300444
619 Ga0451841_0003756
620 Ga0451845_0756109
621 Ga0451843_0087507
622 Ga0451853_0704546
623 Ga0439441_022431
624 Ga0439455_0123478
625 Ga0450923_055264
626 Ga0451577_0032678
627 Ga0451577_1025449
628 Ga0453683_0024591
629 Ga0453684_0794242
630 Ga0453684_0860226
631 Ga0466957_0046622
632 Ga0451576_0064941
633 Ga0451576_0367296
634 Ga0451576_1786228
635 Ga0451576_1961660
636 Ga0495592_0432996
637 Ga0495590_0213481
638 Ga0495641_0084411
639 Ga0495582_0670078
640 Ga0495605_0103178
641 Ga0495594_0067133
642 Ga0495594_0281063
643 Ga0495607_0016564
644 Ga0495607_0188905
645 Ga0495583_0008390
646 Ga0495616_0004752
647 Ga0495631_0000356
648 Ga0495631_0049853
649 Ga0495632_0155179
650 Ga0495643_0283798
651 Ga0495648_0019518
652 Ga0495648_0133396
653 Ga0495648_0133742
654 Ga0495648_0174938
655 Ga0495666_0180182
656 Ga0495654_0012195
657 Ga0495586_0003759
658 Ga0495597_0000658
659 Ga0495597_0087201
660 Ga0495633_0110863
661 Ga0495633_0245338
662 Ga0495633_0249970
663 Ga0495668_0001640
664 Ga0495611_0326762
665 Ga0495661_0055618
666 Ga0495661_0079266
667 Ga0495588_0038899
668 Ga0495658_0060400
669 Ga0495669_0059272
670 Ga0495670_0176289
671 Ga0495671_0139250
672 Ga0495671_0315316
673 Ga0495660_0055877
674 Ga0495660_0086390
675 Ga0495660_0455607
676 Ga0495676_0426128
677 Ga0495679_011835
678 Ga0495685_004416
679 Ga0495673_0200818
680 Ga0495681_0001441
681 Ga0495681_0120432
682 Ga0495626_0082725
683 Ga0495626_0090966
684 Ga0496100_1182525
685 Ga0496102_0080138
686 Ga0496102_0089379
687 Ga0496104_1117537
688 Ga0496109_1979857
689 Ga0496110_0000531
690 Ga0496110_0013829
691 Ga0496111_0315142
692 Ga0496111_0321823
693 Ga0496113_0181405
694 Ga0496115_0905464
695 Ga0495678_000462
696 Ga0495678_000695
697 Ga0495678_015480
698 Ga0495682_0123618
699 Ga0501031_0017802
700 Ga0501031_0046475
701 Ga0501031_1030915
702 Ga0501032_0003174
703 Ga0501032_0098035
704 Ga0501032_0127454
705 Ga0501032_0131766
706 Ga0501032_0324811
707 Ga0501032_0639002
708 Ga0501033_0000064
709 Ga0501033_0001733
710 Ga0501033_0024817
711 Ga0501033_0589559
712 Ga0501034_0305147
713 Ga0501036_0002263
714 Ga0501036_0002767
715 Ga0501036_0100960
716 Ga0501036_0105541
717 Ga0501036_0113051
718 Ga0501036_0215594
719 Ga0501037_0014180
720 Ga0501037_0044095
721 Ga0501037_0157515
722 Ga0501037_0186337
723 Ga0501037_0878114
724 Ga0501038_0000824
725 Ga0501038_0008142
726 Ga0501038_0009674
727 Ga0501038_0021420
728 Ga0501038_0053771
729 Ga0501038_0173083
730 Ga0501038_0187950
731 Ga0501038_0397861
732 Ga0501038_0521522
733 Ga0501039_0032541
734 Ga0501039_0200624
735 Ga0501039_0239510
736 Ga0501039_0411377
737 Ga0501039_0530310
738 Ga0501040_0027120
739 Ga0501042_0008708
740 Ga0501043_0021225
741 Ga0501043_0030446
742 Ga0501043_0031905
743 Ga0501043_0068834
744 Ga0501043_0105294
745 Ga0501043_0187567
746 Ga0501046_0027932
747 Ga0501046_0063416
748 Ga0501047_0004825
749 Ga0501047_0071914
750 Ga0501047_0257600
751 Ga0501047_0338934
752 Ga0501048_0011875
753 Ga0501068_0036437
754 Ga0501070_0819854
755 Ga0501073_0158072
756 Ga0501074_0352845
757 Ga0501077_0399317
758 Ga0501198_147175
759 Ga0501209_266425
760 Ga0501235_147512
761 Ga0501239_016444
762 Ga0501242_054580
763 Ga0501261_058480
764 Ga0501080_0800450
765 Ga0501083_0035431
766 Ga0501241_095305
767 Ga0501270_089939
768 Ga0501035_0000386
769 Ga0501035_0020071
770 Ga0501035_0029085
771 Ga0501035_0061215
772 Ga0501035_0108736
773 Ga0501035_0259270
774 Ga0501044_0000384
775 Ga0501044_0005650
776 Ga0501044_0012367
777 Ga0501044_0058571
778 Ga0501044_0112285
779 Ga0501044_0115158
780 Ga0501044_0205271
781 nmdc:mga0k408_575402_c1
782 nmdc:mga05p37_148423_c1
783 nmdc:mga05p37_28147_c1
784 nmdc:mga05p37_758781_c1
785 nmdc:mga09592_1188576_c1
786 nmdc:mga08y16_30681_c1
787 nmdc:mga08y16_453874_c1
788 nmdc:mga08y16_722107_c1
789 nmdc:mga08y16_904802_c1
790 nmdc:mga0n895_15866_c1
791 nmdc:mga0n895_377495_c1
792 nmdc:mga0n895_47856_c1
793 nmdc:mga0n895_81665_c1
794 nmdc:mga0rr50_325085_c1
795 nmdc:mga0rr50_43605_c1
796 nmdc:mga0rr50_478181_c1
797 nmdc:mga08x19_238419_c1
798 nmdc:mga08x19_583294_c1
799 nmdc:mga0a205_203999_c1
800 nmdc:mga0a205_317633_c1
801 nmdc:mga0a205_35833_c1
802 Ga0500590_045665
803 Ga0500636_0000673
804 Ga0500637_0000924
805 Ga0501084_0805385
806 Ga0530510_0017580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

28

59

0.93

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

141

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e5d-assembly1.cif.gz_A-2 crystal structure of a putative glyoxalase i (lmof2365_0426) from listeria monocytogenes str. 4b f2365 at 2.70 a resolution 0.7744 6 120
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.7674 6 121
6bnx-assembly1.cif.gz_A crystal structure of v278e-glyoxalase i mutant from zea mays in space group p6(3) 0.7613 3 122
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.7584 4 121
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.7559 6 121
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8779 70 121 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8196 71 121 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7955 71 119 3.30.720.110
af_P15179_25_134_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.787 91 123 2.40.50.140
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7798 71 121 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A850K1R0-F1-model_v4 deleted 0.9801 3 123
AF-A0A3D0SIU7-F1-model_v4 Lactoylglutathione lyase 0.9755 68 123 GO:0016829
AF-A0A5C9C0U8-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9751 3 123 GO:0051213
AF-A0A1E4PTA3-F1-model_v4 deleted 0.9715 3 123
AF-A0A142Y6G6-F1-model_v4 YCII-related domain protein 0.9616 4 123

Map