F435495

General Info

Members Datasets Scaffolds Average Seq Length
403 263 806 149

Family's Representative Sequence

Representative Sequence 3300046675|Ga0495657_0272910|Ga0495657_0272910_90_635
Length 181
Sequence MVVFLFSLALGRRKLDCATSSRLEVKRVRHLDIAEVAQQSGVPASTLRFYDEKGLIASTGRRGLRRLFDPGVLERLALIALGRAAGFSLDEIARMFAPEGQPRIDRQMLAAKADELDRTIRKLSAMRDGLRHAAACPAPSHMECPTFRRIVRAAGSGAVGARRKRVPKAPGGSSKRIACAT

Samples

Sample ID Description Type Environment
1 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
74 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
111 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
112 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
113 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
114 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
119 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
141 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
142 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
143 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
144 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
145 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
148 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
151 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
152 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
153 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
154 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
155 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
156 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
157 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
158 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
159 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
160 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
161 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
162 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
169 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
170 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
188 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
235 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
242 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
249 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
250 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
251 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
258 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
259 2738541307 Variovorax sp. GV008 Isolate Unclassified
260 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
261 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
262 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
263 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 0
Isolates 1.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.39
Nodule 2.23
Rhizoplane 0.74
Rhizosphere 78.91
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495657_0272910 3300046675 Bacteria 1014
2 JGI24738J21930_10005799 3300002075 Bacteria 2934
3 Ga0055537_1000195 3300003773 Bacteria 45368
4 Ga0055524_1009438 3300003775 Bacteria 3966
5 Ga0055534_1000262 3300003784 Bacteria 36545
6 Ga0055534_1032372 3300003784 Bacteria 800
7 Ga0055528_1000371 3300003790 Bacteria 36548
8 Ga0055528_1031250 3300003790 Bacteria 1390
9 Ga0055540_1000994 3300003792 Bacteria 18313
10 Ga0070658_10031052 3300005327 Bacteria 4289
11 Ga0068869_100770139 3300005334 Bacteria 825
12 Ga0070689_100686150 3300005340 Bacteria 893
13 Ga0070692_10059972 3300005345 Bacteria 2001
14 Ga0070674_100555117 3300005356 Bacteria 964
15 Ga0070659_101333723 3300005366 Bacteria 637
16 Ga0070667_101771232 3300005367 Bacteria 581
17 Ga0070701_10042345 3300005438 Bacteria 2324
18 Ga0070701_10174822 3300005438 Bacteria 1253
19 Ga0070700_101017977 3300005441 Bacteria 682
20 Ga0070663_100365012 3300005455 Bacteria 1172
21 Ga0070678_100799853 3300005456 Bacteria 856
22 Ga0070662_100056388 3300005457 Bacteria 2852
23 Ga0070685_10313271 3300005466 Bacteria 1061
24 Ga0070685_10424000 3300005466 Bacteria 926
25 Ga0068853_100737170 3300005539 Bacteria 941
26 Ga0070686_100074582 3300005544 Bacteria 2230
27 Ga0070686_100270479 3300005544 Bacteria 1249
28 Ga0070686_100371237 3300005544 Bacteria 1080
29 Ga0070665_100002288 3300005548 Bacteria 21306
30 Ga0070665_100009745 3300005548 Bacteria 9714
31 Ga0070665_100693805 3300005548 Bacteria 1031
32 Ga0070664_100482331 3300005564 Bacteria 1141
33 Ga0068857_100022094 3300005577 Bacteria 5597
34 Ga0068852_100688846 3300005616 Bacteria 1031
35 Ga0068859_100115356 3300005617 Bacteria 2751
36 Ga0068859_100527238 3300005617 Bacteria 1276
37 Ga0068859_100638231 3300005617 Bacteria 1157
38 Ga0068861_101521901 3300005719 Bacteria 657
39 Ga0068863_101077770 3300005841 Bacteria 808
40 Ga0068858_100144953 3300005842 Bacteria 2230
41 Ga0068860_100169515 3300005843 Bacteria 2108
42 Ga0068860_100951092 3300005843 Bacteria 876
43 Ga0068862_100866291 3300005844 Bacteria 886
44 Ga0081538_10062822 3300005981 Bacteria 2114
45 Ga0081540_1000273 3300005983 Bacteria 53925
46 Ga0075363_100004499 3300006048 Bacteria 6111
47 Ga0075363_100858134 3300006048 Bacteria 554
48 Ga0075364_10147644 3300006051 Bacteria 1584
49 Ga0075364_10401950 3300006051 Bacteria 935
50 Ga0075364_10537588 3300006051 Bacteria 799
51 Ga0075364_10682306 3300006051 Bacteria 701
52 Ga0075364_10945969 3300006051 Bacteria 586
53 Ga0075432_10008825 3300006058 Bacteria 3440
54 Ga0075432_10103982 3300006058 Bacteria 1052
55 Ga0070715_10177889 3300006163 Bacteria 1065
56 Ga0075362_10001166 3300006177 Bacteria 8218
57 Ga0075362_10005155 3300006177 Bacteria 4760
58 Ga0075362_10026065 3300006177 Bacteria 2494
59 Ga0075367_10187013 3300006178 Bacteria 1292
60 Ga0075367_10955052 3300006178 Bacteria 547
61 Ga0075369_10253242 3300006186 Bacteria 818
62 Ga0075369_10387600 3300006186 Bacteria 658
63 Ga0075366_10036307 3300006195 Bacteria 2905
64 Ga0075366_10468861 3300006195 Bacteria 777
65 Ga0097621_101921134 3300006237 Bacteria 565
66 Ga0075370_10000051 3300006353 Bacteria 35306
67 Ga0075370_10165497 3300006353 Bacteria 1299
68 Ga0075430_100017340 3300006846 Bacteria 6132
69 Ga0075430_100269581 3300006846 Bacteria 1409
70 Ga0075431_100000264 3300006847 Bacteria 40417
71 Ga0075431_100635248 3300006847 Bacteria 1049
72 Ga0075429_100013313 3300006880 Bacteria 7132
73 Ga0097620_100115348 3300006931 Bacteria 2751
74 Ga0097620_100527241 3300006931 Bacteria 1276
75 Ga0097620_100638249 3300006931 Bacteria 1157
76 Ga0079104_1029681 3300006946 Bacteria 1375
77 Ga0099826_10013873 3300006948 Bacteria 6089
78 Ga0099826_10406592 3300006948 Bacteria 660
79 Ga0105244_10329586 3300009036 Bacteria 704
80 Ga0111539_10402565 3300009094 Bacteria 1594
81 Ga0114129_11000057 3300009147 Bacteria 1053
82 Ga0105243_10135339 3300009148 Bacteria 2096
83 Ga0105243_10661822 3300009148 Bacteria 1013
84 Ga0105237_10300468 3300009545 Unclassified 1608
85 Ga0105238_10236998 3300009551 Unclassified 1802
86 Ga0099796_10341802 3300010159 Bacteria 643
87 Ga0105246_10035852 3300011119 Bacteria 3318
88 Ga0157373_10006094 3300013100 Bacteria 9015
89 Ga0157373_10184009 3300013100 Bacteria 1471
90 Ga0157370_10001585 3300013104 Bacteria 28149
91 Ga0157369_10757552 3300013105 Bacteria 999
92 Ga0157378_11989012 3300013297 Bacteria 631
93 Ga0163162_10628001 3300013306 Bacteria 1199
94 Ga0157372_10455849 3300013307 Bacteria 1490
95 Ga0157375_11078435 3300013308 Bacteria 940
96 Ga0163163_10237561 3300014325 Bacteria 1872
97 Ga0157380_10002921 3300014326 Bacteria 11616
98 Ga0182008_10091764 3300014497 Bacteria 1498
99 Ga0182008_10513815 3300014497 Bacteria 660
100 Ga0157379_10069888 3300014968 Bacteria 3141
101 Ga0157379_10298097 3300014968 Bacteria 1469
102 Ga0182006_1048303 3300015261 Bacteria 1647
103 Ga0182005_1110738 3300015265 Bacteria 775
104 Ga0163161_10024646 3300017792 Bacteria 4252
105 Ga0207425_1052068 3300025245 Bacteria 744
106 Ga0209565_1000087 3300025263 Bacteria 152027
107 Ga0209673_1000145 3300025273 Bacteria 152027
108 Ga0209673_1002177 3300025273 Bacteria 14448
109 Ga0209675_1000085 3300025291 Bacteria 152027
110 Ga0209676_1013811 3300025292 Bacteria 3080
111 Ga0209025_1000256 3300025294 Bacteria 125758
112 Ga0209025_1000406 3300025294 Bacteria 87410
113 Ga0209025_1011175 3300025294 Bacteria 5966
114 Ga0209564_1044164 3300025295 Bacteria 1160
115 Ga0209051_1000397 3300025303 Bacteria 60597
116 Ga0209257_1016963 3300025304 Bacteria 2901
117 Ga0207696_1126985 3300025711 Bacteria 686
118 Ga0207713_1014803 3300025735 Bacteria 4029
119 Ga0207647_10007290 3300025904 Bacteria 8005
120 Ga0207685_10090054 3300025905 Bacteria 1289
121 Ga0207699_10559963 3300025906 Bacteria 830
122 Ga0207705_10057278 3300025909 Bacteria 2811
123 Ga0207671_10217861 3300025914 Bacteria 1495
124 Ga0207671_10768527 3300025914 Unclassified 765
125 Ga0207662_10118401 3300025918 Bacteria 1658
126 Ga0207694_10178387 3300025924 Unclassified 1722
127 Ga0207687_10442785 3300025927 Bacteria 1076
128 Ga0207706_10071482 3300025933 Bacteria 3052
129 Ga0207706_10107496 3300025933 Bacteria 2455
130 Ga0207686_11200879 3300025934 Bacteria 621
131 Ga0207709_10092845 3300025935 Bacteria 1977
132 Ga0207709_10277780 3300025935 Bacteria 1236
133 Ga0207670_10675156 3300025936 Bacteria 854
134 Ga0207689_10060850 3300025942 Bacteria 3105
135 Ga0207689_11184644 3300025942 Bacteria 643
136 Ga0207703_10355627 3300026035 Bacteria 1349
137 Ga0207703_10724225 3300026035 Bacteria 947
138 Ga0207708_11210214 3300026075 Bacteria 661
139 Ga0207641_11610380 3300026088 Bacteria 651
140 Ga0207674_10030641 3300026116 Bacteria 5655
141 Ga0207675_100040936 3300026118 Bacteria 4328
142 Ga0207675_100171661 3300026118 Bacteria 2073
143 Ga0207675_101161740 3300026118 Bacteria 792
144 Ga0207683_10805856 3300026121 Bacteria 872
145 Ga0209282_1023359 3300027666 Bacteria 3888
146 Ga0209282_1355860 3300027666 Bacteria 596
147 Ga0268266_10001667 3300028379 Bacteria 25593
148 Ga0268266_10012112 3300028379 Bacteria 7464
149 Ga0268266_10618109 3300028379 Bacteria 1041
150 Ga0268265_10332033 3300028380 Bacteria 1381
151 Ga0268265_10881773 3300028380 Bacteria 877
152 Ga0265337_1003475 3300028556 Bacteria 6819
153 Ga0307517_10521077 3300028786 Bacteria 600
154 Ga0307515_10266435 3300028794 Bacteria 1441
155 Ga0265338_10034735 3300028800 Bacteria 4865
156 Ga0316177_1085023 3300030731 Bacteria 4634
157 Ga0316176_1010983 3300030732 Bacteria 2834
158 Ga0316179_1059345 3300030734 Bacteria 2330
159 Ga0316178_1017516 3300030735 Bacteria 3200
160 Ga0316180_1107911 3300030736 Bacteria 957
161 Ga0307513_10095985 3300031456 Bacteria 3004
162 Ga0307513_10691651 3300031456 Bacteria 726
163 Ga0307408_100030346 3300031548 Bacteria 3753
164 Ga0307408_100119508 3300031548 Bacteria 2039
165 Ga0307408_100236665 3300031548 Bacteria 1498
166 Ga0307408_100395344 3300031548 Bacteria 1185
167 Ga0307408_100444249 3300031548 Bacteria 1123
168 Ga0307408_101158401 3300031548 Bacteria 719
169 Ga0307408_101210548 3300031548 Bacteria 705
170 Ga0265313_10052841 3300031595 Bacteria 1937
171 Ga0307508_10002666 3300031616 Bacteria 18709
172 Ga0307514_10004898 3300031649 Bacteria 12165
173 Ga0265314_10079280 3300031711 Bacteria 2172
174 Ga0307405_10085503 3300031731 Bacteria 2073
175 Ga0307405_10365212 3300031731 Bacteria 1118
176 Ga0307405_10757628 3300031731 Bacteria 809
177 Ga0307405_11399518 3300031731 Bacteria 611
178 Ga0307413_10123323 3300031824 Bacteria 1759
179 Ga0307413_11184501 3300031824 Bacteria 664
180 Ga0307413_11801092 3300031824 Bacteria 548
181 Ga0307410_10292504 3300031852 Bacteria 1282
182 Ga0307410_11378876 3300031852 Bacteria 618
183 Ga0307410_11872924 3300031852 Bacteria 534
184 Ga0307406_10001798 3300031901 Bacteria 11713
185 Ga0307406_10073357 3300031901 Bacteria 2250
186 Ga0307406_10524019 3300031901 Bacteria 965
187 Ga0307406_10894715 3300031901 Bacteria 755
188 Ga0307406_10995682 3300031901 Bacteria 719
189 Ga0307407_10750613 3300031903 Bacteria 739
190 Ga0307407_11065835 3300031903 Bacteria 627
191 Ga0307412_10361807 3300031911 Bacteria 1168
192 Ga0307412_10460448 3300031911 Bacteria 1050
193 Ga0307412_10988240 3300031911 Bacteria 743
194 Ga0307412_11737910 3300031911 Bacteria 572
195 Ga0307409_100170076 3300031995 Bacteria 1917
196 Ga0307409_101034216 3300031995 Bacteria 840
197 Ga0307416_100015953 3300032002 Bacteria 5205
198 Ga0307416_100157432 3300032002 Bacteria 2093
199 Ga0307416_100157908 3300032002 Bacteria 2091
200 Ga0307416_100200653 3300032002 Bacteria 1892
201 Ga0307416_100644533 3300032002 Bacteria 1143
202 Ga0307414_10040144 3300032004 Bacteria 3158
203 Ga0307414_10803063 3300032004 Bacteria 858
204 Ga0307411_10027280 3300032005 Bacteria 3452
205 Ga0307411_10138466 3300032005 Bacteria 1791
206 Ga0307411_10275419 3300032005 Bacteria 1336
207 Ga0307411_10353529 3300032005 Bacteria 1199
208 Ga0307411_11071730 3300032005 Bacteria 725
209 Ga0307415_100081775 3300032126 Bacteria 2309
210 Ga0307415_100141384 3300032126 Bacteria 1839
211 Ga0307415_100525444 3300032126 Bacteria 1039
212 Ga0315911_1000033 3300033442 Bacteria 67159
213 Ga0373931_0340015 3300035691 Bacteria 937
214 Ga0316584_0130503 3300036712 Bacteria 1877
215 Ga0395899_0194176 3300037312 Bacteria 1419
216 Ga0395900_0998440 3300037418 Bacteria 757
217 Ga0395898_0118859 3300037466 Bacteria 2532
218 Ga0395898_0854426 3300037466 Bacteria 849
219 Ga0395905_0015721 3300037471 Bacteria 7189
220 Ga0395905_0770332 3300037471 Bacteria 865
221 Ga0395901_0163101 3300038443 Bacteria 2340
222 Ga0395901_0463121 3300038443 Bacteria 1295
223 Ga0439436_0049137 3300041404 Bacteria 1195
224 Ga0439438_027393 3300041405 Bacteria 1538
225 Ga0439439_0016296 3300041406 Bacteria 1819
226 Ga0439447_031106 3300041407 Bacteria 1341
227 Ga0439465_0155344 3300041413 Bacteria 819
228 Ga0439431_0055938 3300041997 Bacteria 1031
229 Ga0439433_0118011 3300041999 Bacteria 667
230 Ga0439448_0042686 3300042005 Bacteria 1470
231 Ga0439432_013361 3300042006 Bacteria 2794
232 Ga0439449_0047620 3300042007 Bacteria 1587
233 Ga0439449_0057438 3300042007 Bacteria 1436
234 Ga0439452_020964 3300042010 Bacteria 1708
235 Ga0439455_0040185 3300042012 Bacteria 1195
236 Ga0439457_027922 3300042014 Bacteria 1249
237 Ga0439462_0003298 3300042015 Bacteria 3860
238 Ga0439462_0012293 3300042015 Bacteria 2186
239 Ga0450915_012745 3300042119 Bacteria 610
240 Ga0450923_018143 3300042125 Bacteria 1344
241 Ga0450890_005923 3300042127 Bacteria 1572
242 Ga0450897_032263 3300042128 Bacteria 596
243 Ga0450894_007603 3300042131 Bacteria 1400
244 Ga0450896_011616 3300042133 Bacteria 1241
245 Ga0450898_022540 3300042134 Bacteria 1116
246 Ga0450906_006132 3300042145 Bacteria 2437
247 Ga0450907_025342 3300042146 Bacteria 1003
248 Ga0439458_0036147 3300042157 Bacteria 1188
249 Ga0439458_0091048 3300042157 Bacteria 785
250 Ga0439434_0012031 3300042435 Bacteria 2558
251 Ga0450918_046736 3300042531 Bacteria 783
252 Ga0466969_0036865 3300044656 Bacteria 2467
253 Ga0466972_0019377 3300044658 Bacteria 3402
254 Ga0466977_0323221 3300044666 Bacteria 924
255 Ga0466978_0037321 3300044671 Bacteria 2995
256 Ga0466982_0056902 3300044672 Bacteria 2402
257 Ga0466965_0068923 3300044683 Bacteria 1776
258 Ga0466966_0161330 3300044684 Bacteria 1365
259 Ga0466961_0043170 3300044693 Bacteria 2888
260 Ga0466964_0015525 3300044706 Bacteria 2899
261 Ga0466971_0039009 3300044719 Bacteria 2132
262 Ga0466968_0013804 3300044735 Bacteria 3180
263 Ga0466970_0029979 3300044765 Bacteria 2867
264 Ga0466957_0039402 3300044842 Bacteria 2850
265 Ga0466959_0061324 3300045049 Bacteria 2734
266 Ga0466967_0219610 3300045976 Bacteria 1805
267 Ga0495603_0014089 3300046455 Bacteria 4836
268 Ga0495629_0010060 3300046459 Bacteria 6901
269 Ga0495629_0011177 3300046459 Bacteria 6518
270 Ga0495641_0088043 3300046461 Bacteria 1389
271 Ga0495582_0025849 3300046473 Bacteria 3217
272 Ga0495639_0038192 3300046475 Bacteria 2156
273 Ga0495662_0021219 3300046476 Bacteria 3140
274 Ga0495662_0054339 3300046476 Bacteria 1934
275 Ga0495620_0178143 3300046515 Bacteria 822
276 Ga0495637_0009707 3300046520 Bacteria 4686
277 Ga0495648_0406300 3300046524 Bacteria 607
278 Ga0495654_0144594 3300046530 Bacteria 1057
279 Ga0495654_0313259 3300046530 Bacteria 638
280 Ga0495586_0496455 3300046535 Bacteria 704
281 Ga0495656_0531631 3300046615 Bacteria 626
282 Ga0495625_0000012 3300046660 Bacteria 363006
283 Ga0495625_0201319 3300046660 Bacteria 1314
284 Ga0495661_0334606 3300046665 Bacteria 749
285 Ga0495588_0012406 3300046674 Bacteria 4028
286 Ga0495613_0226619 3300046689 Bacteria 1310
287 Ga0495613_0536252 3300046689 Bacteria 785
288 Ga0495600_0297974 3300046809 Bacteria 1018
289 Ga0495581_0274574 3300047315 Bacteria 985
290 Ga0495636_0004623 3300047318 Bacteria 5398
291 Ga0495593_0138405 3300047673 Bacteria 1234
292 Ga0496105_0321581 3300048908 Bacteria 1240
293 Ga0496109_0038038 3300048912 Bacteria 4349
294 Ga0496110_0524446 3300048913 Bacteria 1077
295 Ga0496122_0083092 3300048925 Bacteria 2222
296 Ga0496123_0061387 3300048926 Bacteria 2415
297 Ga0496125_0277298 3300048928 Bacteria 1041
298 Ga0496126_0434749 3300048929 Bacteria 1059
299 Ga0501031_0197381 3300049568 Bacteria 1313
300 Ga0501031_0210835 3300049568 Bacteria 1266
301 Ga0501032_0001599 3300049569 Bacteria 18059
302 Ga0501032_0245709 3300049569 Bacteria 1162
303 Ga0501033_0002274 3300049570 Bacteria 16425
304 Ga0501033_0037353 3300049570 Bacteria 3636
305 Ga0501034_0298725 3300049571 Bacteria 1547
306 Ga0501036_0003841 3300049572 Bacteria 12049
307 Ga0501036_0438293 3300049572 Bacteria 1089
308 Ga0501038_0022634 3300049574 Bacteria 5627
309 Ga0501038_0500156 3300049574 Bacteria 929
310 Ga0501039_0002125 3300049575 Bacteria 14676
311 Ga0501039_0523355 3300049575 Bacteria 931
312 Ga0501039_0730304 3300049575 Bacteria 774
313 Ga0501039_1080798 3300049575 Bacteria 622
314 Ga0501042_0655608 3300049578 Bacteria 763
315 Ga0501043_0002296 3300049579 Bacteria 16225
316 Ga0501043_0079677 3300049579 Bacteria 2573
317 Ga0501043_0257072 3300049579 Bacteria 1344
318 Ga0501046_0313068 3300049580 Bacteria 1145
319 Ga0501047_0007755 3300049581 Bacteria 10105
320 Ga0501047_0019107 3300049581 Bacteria 6575
321 Ga0501047_0029821 3300049581 Bacteria 5258
322 Ga0501047_0038256 3300049581 Bacteria 4641
323 Ga0501047_0203801 3300049581 Bacteria 1838
324 Ga0501048_0028737 3300049582 Bacteria 4036
325 Ga0501068_0128872 3300049584 Bacteria 1581
326 Ga0501069_0000121 3300049585 Bacteria 34673
327 Ga0501069_0283618 3300049585 Bacteria 969
328 Ga0501070_0000827 3300049586 Bacteria 28106
329 Ga0501070_0165328 3300049586 Bacteria 1823
330 Ga0501070_0740776 3300049586 Bacteria 775
331 Ga0501071_0027924 3300049587 Bacteria 3972
332 Ga0501071_0755328 3300049587 Bacteria 749
333 Ga0501072_0023818 3300049588 Bacteria 4757
334 Ga0501073_0000257 3300049589 Bacteria 34956
335 Ga0501073_0173798 3300049589 Bacteria 1491
336 Ga0501073_0566678 3300049589 Bacteria 784
337 Ga0501073_0731506 3300049589 Bacteria 682
338 Ga0501074_0001412 3300049590 Bacteria 15992
339 Ga0501074_0006854 3300049590 Bacteria 8228
340 Ga0501074_0320922 3300049590 Bacteria 1100
341 Ga0501074_0860961 3300049590 Bacteria 638
342 Ga0501076_0284820 3300049592 Bacteria 1354
343 Ga0501076_0549645 3300049592 Bacteria 952
344 Ga0501077_0195752 3300049593 Bacteria 1284
345 Ga0501077_0293174 3300049593 Bacteria 1036
346 Ga0501209_072665 3300049656 Bacteria 980
347 Ga0501079_0309160 3300049741 Bacteria 1237
348 Ga0501080_0002825 3300049742 Bacteria 15267
349 Ga0501080_0047861 3300049742 Bacteria 3980
350 Ga0501080_0065670 3300049742 Bacteria 3375
351 Ga0501080_0442794 3300049742 Bacteria 1165
352 Ga0501081_1375179 3300049743 Bacteria 536
353 Ga0501083_0001058 3300049744 Bacteria 18358
354 Ga0501241_112897 3300049758 Bacteria 596
355 Ga0501272_028729 3300049769 Bacteria 699
356 Ga0501035_0002374 3300049822 Bacteria 18494
357 Ga0501035_0016656 3300049822 Bacteria 6777
358 Ga0501035_0081997 3300049822 Bacteria 2846
359 Ga0501035_0247037 3300049822 Bacteria 1516
360 Ga0501035_0442103 3300049822 Bacteria 1077
361 Ga0501044_0187184 3300049823 Bacteria 2034
362 Ga0501044_0231813 3300049823 Bacteria 1793
363 Ga0501044_0556704 3300049823 Bacteria 1043
364 Ga0501044_0595130 3300049823 Bacteria 999
365 Ga0501045_0033052 3300049824 Bacteria 3751
366 nmdc:mga03683_49744_c1 3300050489 Bacteria 1746
367 nmdc:mga00v17_353850_c1 3300050491 Bacteria 955
368 nmdc:mga00v17_62022_c1 3300050491 Bacteria 2299
369 nmdc:mga00v17_748082_c1 3300050491 Bacteria 625
370 nmdc:mga0yw44_25782_c1 3300050492 Bacteria 3349
371 nmdc:mga0k408_12406_c1 3300050493 Bacteria 4657
372 nmdc:mga0k408_23939_c1 3300050493 Bacteria 3448
373 nmdc:mga0k408_32427_c1 3300050493 Bacteria 2985
374 nmdc:mga0k408_927110_c1 3300050493 Bacteria 505
375 nmdc:mga07m45_2737_c1 3300050496 Bacteria 8313
376 nmdc:mga07m45_303846_c1 3300050496 Bacteria 928
377 nmdc:mga07m45_540041_c1 3300050496 Bacteria 674
378 nmdc:mga07m45_948_c1 3300050496 Bacteria 12716
379 nmdc:mga09592_683315_c1 3300050508 Bacteria 874
380 nmdc:mga0qj67_41_c1 3300050509 Bacteria 89688
381 nmdc:mga06r32_419660_c1 3300050510 Bacteria 1319
382 nmdc:mga06r32_5033_c1 3300050510 Bacteria 11900
383 nmdc:mga08y16_827010_c1 3300050511 Bacteria 917
384 nmdc:mga0sz30_60953_c1 3300050516 Bacteria 1611
385 Ga0500610_0000288 3300053079 Bacteria 15151
386 Ga0500610_0014980 3300053079 Bacteria 3656
387 Ga0500643_057023 3300053087 Bacteria 1103
388 Ga0500593_000170 3300053117 Bacteria 26287
389 Ga0500593_018954 3300053117 Bacteria 3006
390 Ga0500595_062401 3300053119 Bacteria 1122
391 Ga0500607_019954 3300053121 Bacteria 3788
392 Ga0501084_0029996 3300054114 Bacteria 4549
393 Ga0501084_0129291 3300054114 Bacteria 2126
394 Ga0501082_0328026 3300060353 Bacteria 1333
395 Ga0501082_0433246 3300060353 Bacteria 1148
396 Ga0466962_0049651 3300061719 Bacteria 2005
397 Ga0530510_0634509 3300061734 Bacteria 813
398 2513694915 2513237101 Bacteria 7952346
399 2738879286 2738541307 Bacteria 8606193
400 2834644370 2834641062 Bacteria 5559922
401 2874610350 2874604998 Bacteria 7834745
402 2904547441 2904541872 Bacteria 8915136
403 8007000256 8006994254 Bacteria 8309700
404 Ga0495657_0272910
405 JGI24738J21930_10005799
406 Ga0055537_1000195
407 Ga0055524_1009438
408 Ga0055534_1000262
409 Ga0055534_1032372
410 Ga0055528_1000371
411 Ga0055528_1031250
412 Ga0055540_1000994
413 Ga0070658_10031052
414 Ga0068869_100770139
415 Ga0070689_100686150
416 Ga0070692_10059972
417 Ga0070674_100555117
418 Ga0070659_101333723
419 Ga0070667_101771232
420 Ga0070701_10042345
421 Ga0070701_10174822
422 Ga0070700_101017977
423 Ga0070663_100365012
424 Ga0070678_100799853
425 Ga0070662_100056388
426 Ga0070685_10313271
427 Ga0070685_10424000
428 Ga0068853_100737170
429 Ga0070686_100074582
430 Ga0070686_100270479
431 Ga0070686_100371237
432 Ga0070665_100002288
433 Ga0070665_100009745
434 Ga0070665_100693805
435 Ga0070664_100482331
436 Ga0068857_100022094
437 Ga0068852_100688846
438 Ga0068859_100115356
439 Ga0068859_100527238
440 Ga0068859_100638231
441 Ga0068861_101521901
442 Ga0068863_101077770
443 Ga0068858_100144953
444 Ga0068860_100169515
445 Ga0068860_100951092
446 Ga0068862_100866291
447 Ga0081538_10062822
448 Ga0081540_1000273
449 Ga0075363_100004499
450 Ga0075363_100858134
451 Ga0075364_10147644
452 Ga0075364_10401950
453 Ga0075364_10537588
454 Ga0075364_10682306
455 Ga0075364_10945969
456 Ga0075432_10008825
457 Ga0075432_10103982
458 Ga0070715_10177889
459 Ga0075362_10001166
460 Ga0075362_10005155
461 Ga0075362_10026065
462 Ga0075367_10187013
463 Ga0075367_10955052
464 Ga0075369_10253242
465 Ga0075369_10387600
466 Ga0075366_10036307
467 Ga0075366_10468861
468 Ga0097621_101921134
469 Ga0075370_10000051
470 Ga0075370_10165497
471 Ga0075430_100017340
472 Ga0075430_100269581
473 Ga0075431_100000264
474 Ga0075431_100635248
475 Ga0075429_100013313
476 Ga0097620_100115348
477 Ga0097620_100527241
478 Ga0097620_100638249
479 Ga0079104_1029681
480 Ga0099826_10013873
481 Ga0099826_10406592
482 Ga0105244_10329586
483 Ga0111539_10402565
484 Ga0114129_11000057
485 Ga0105243_10135339
486 Ga0105243_10661822
487 Ga0105237_10300468
488 Ga0105238_10236998
489 Ga0099796_10341802
490 Ga0105246_10035852
491 Ga0157373_10006094
492 Ga0157373_10184009
493 Ga0157370_10001585
494 Ga0157369_10757552
495 Ga0157378_11989012
496 Ga0163162_10628001
497 Ga0157372_10455849
498 Ga0157375_11078435
499 Ga0163163_10237561
500 Ga0157380_10002921
501 Ga0182008_10091764
502 Ga0182008_10513815
503 Ga0157379_10069888
504 Ga0157379_10298097
505 Ga0182006_1048303
506 Ga0182005_1110738
507 Ga0163161_10024646
508 Ga0207425_1052068
509 Ga0209565_1000087
510 Ga0209673_1000145
511 Ga0209673_1002177
512 Ga0209675_1000085
513 Ga0209676_1013811
514 Ga0209025_1000256
515 Ga0209025_1000406
516 Ga0209025_1011175
517 Ga0209564_1044164
518 Ga0209051_1000397
519 Ga0209257_1016963
520 Ga0207696_1126985
521 Ga0207713_1014803
522 Ga0207647_10007290
523 Ga0207685_10090054
524 Ga0207699_10559963
525 Ga0207705_10057278
526 Ga0207671_10217861
527 Ga0207671_10768527
528 Ga0207662_10118401
529 Ga0207694_10178387
530 Ga0207687_10442785
531 Ga0207706_10071482
532 Ga0207706_10107496
533 Ga0207686_11200879
534 Ga0207709_10092845
535 Ga0207709_10277780
536 Ga0207670_10675156
537 Ga0207689_10060850
538 Ga0207689_11184644
539 Ga0207703_10355627
540 Ga0207703_10724225
541 Ga0207708_11210214
542 Ga0207641_11610380
543 Ga0207674_10030641
544 Ga0207675_100040936
545 Ga0207675_100171661
546 Ga0207675_101161740
547 Ga0207683_10805856
548 Ga0209282_1023359
549 Ga0209282_1355860
550 Ga0268266_10001667
551 Ga0268266_10012112
552 Ga0268266_10618109
553 Ga0268265_10332033
554 Ga0268265_10881773
555 Ga0265337_1003475
556 Ga0307517_10521077
557 Ga0307515_10266435
558 Ga0265338_10034735
559 Ga0316177_1085023
560 Ga0316176_1010983
561 Ga0316179_1059345
562 Ga0316178_1017516
563 Ga0316180_1107911
564 Ga0307513_10095985
565 Ga0307513_10691651
566 Ga0307408_100030346
567 Ga0307408_100119508
568 Ga0307408_100236665
569 Ga0307408_100395344
570 Ga0307408_100444249
571 Ga0307408_101158401
572 Ga0307408_101210548
573 Ga0265313_10052841
574 Ga0307508_10002666
575 Ga0307514_10004898
576 Ga0265314_10079280
577 Ga0307405_10085503
578 Ga0307405_10365212
579 Ga0307405_10757628
580 Ga0307405_11399518
581 Ga0307413_10123323
582 Ga0307413_11184501
583 Ga0307413_11801092
584 Ga0307410_10292504
585 Ga0307410_11378876
586 Ga0307410_11872924
587 Ga0307406_10001798
588 Ga0307406_10073357
589 Ga0307406_10524019
590 Ga0307406_10894715
591 Ga0307406_10995682
592 Ga0307407_10750613
593 Ga0307407_11065835
594 Ga0307412_10361807
595 Ga0307412_10460448
596 Ga0307412_10988240
597 Ga0307412_11737910
598 Ga0307409_100170076
599 Ga0307409_101034216
600 Ga0307416_100015953
601 Ga0307416_100157432
602 Ga0307416_100157908
603 Ga0307416_100200653
604 Ga0307416_100644533
605 Ga0307414_10040144
606 Ga0307414_10803063
607 Ga0307411_10027280
608 Ga0307411_10138466
609 Ga0307411_10275419
610 Ga0307411_10353529
611 Ga0307411_11071730
612 Ga0307415_100081775
613 Ga0307415_100141384
614 Ga0307415_100525444
615 Ga0315911_1000033
616 Ga0373931_0340015
617 Ga0316584_0130503
618 Ga0395899_0194176
619 Ga0395900_0998440
620 Ga0395898_0118859
621 Ga0395898_0854426
622 Ga0395905_0015721
623 Ga0395905_0770332
624 Ga0395901_0163101
625 Ga0395901_0463121
626 Ga0439436_0049137
627 Ga0439438_027393
628 Ga0439439_0016296
629 Ga0439447_031106
630 Ga0439465_0155344
631 Ga0439431_0055938
632 Ga0439433_0118011
633 Ga0439448_0042686
634 Ga0439432_013361
635 Ga0439449_0047620
636 Ga0439449_0057438
637 Ga0439452_020964
638 Ga0439455_0040185
639 Ga0439457_027922
640 Ga0439462_0003298
641 Ga0439462_0012293
642 Ga0450915_012745
643 Ga0450923_018143
644 Ga0450890_005923
645 Ga0450897_032263
646 Ga0450894_007603
647 Ga0450896_011616
648 Ga0450898_022540
649 Ga0450906_006132
650 Ga0450907_025342
651 Ga0439458_0036147
652 Ga0439458_0091048
653 Ga0439434_0012031
654 Ga0450918_046736
655 Ga0466969_0036865
656 Ga0466972_0019377
657 Ga0466977_0323221
658 Ga0466978_0037321
659 Ga0466982_0056902
660 Ga0466965_0068923
661 Ga0466966_0161330
662 Ga0466961_0043170
663 Ga0466964_0015525
664 Ga0466971_0039009
665 Ga0466968_0013804
666 Ga0466970_0029979
667 Ga0466957_0039402
668 Ga0466959_0061324
669 Ga0466967_0219610
670 Ga0495603_0014089
671 Ga0495629_0010060
672 Ga0495629_0011177
673 Ga0495641_0088043
674 Ga0495582_0025849
675 Ga0495639_0038192
676 Ga0495662_0021219
677 Ga0495662_0054339
678 Ga0495620_0178143
679 Ga0495637_0009707
680 Ga0495648_0406300
681 Ga0495654_0144594
682 Ga0495654_0313259
683 Ga0495586_0496455
684 Ga0495656_0531631
685 Ga0495625_0000012
686 Ga0495625_0201319
687 Ga0495661_0334606
688 Ga0495588_0012406
689 Ga0495613_0226619
690 Ga0495613_0536252
691 Ga0495600_0297974
692 Ga0495581_0274574
693 Ga0495636_0004623
694 Ga0495593_0138405
695 Ga0496105_0321581
696 Ga0496109_0038038
697 Ga0496110_0524446
698 Ga0496122_0083092
699 Ga0496123_0061387
700 Ga0496125_0277298
701 Ga0496126_0434749
702 Ga0501031_0197381
703 Ga0501031_0210835
704 Ga0501032_0001599
705 Ga0501032_0245709
706 Ga0501033_0002274
707 Ga0501033_0037353
708 Ga0501034_0298725
709 Ga0501036_0003841
710 Ga0501036_0438293
711 Ga0501038_0022634
712 Ga0501038_0500156
713 Ga0501039_0002125
714 Ga0501039_0523355
715 Ga0501039_0730304
716 Ga0501039_1080798
717 Ga0501042_0655608
718 Ga0501043_0002296
719 Ga0501043_0079677
720 Ga0501043_0257072
721 Ga0501046_0313068
722 Ga0501047_0007755
723 Ga0501047_0019107
724 Ga0501047_0029821
725 Ga0501047_0038256
726 Ga0501047_0203801
727 Ga0501048_0028737
728 Ga0501068_0128872
729 Ga0501069_0000121
730 Ga0501069_0283618
731 Ga0501070_0000827
732 Ga0501070_0165328
733 Ga0501070_0740776
734 Ga0501071_0027924
735 Ga0501071_0755328
736 Ga0501072_0023818
737 Ga0501073_0000257
738 Ga0501073_0173798
739 Ga0501073_0566678
740 Ga0501073_0731506
741 Ga0501074_0001412
742 Ga0501074_0006854
743 Ga0501074_0320922
744 Ga0501074_0860961
745 Ga0501076_0284820
746 Ga0501076_0549645
747 Ga0501077_0195752
748 Ga0501077_0293174
749 Ga0501209_072665
750 Ga0501079_0309160
751 Ga0501080_0002825
752 Ga0501080_0047861
753 Ga0501080_0065670
754 Ga0501080_0442794
755 Ga0501081_1375179
756 Ga0501083_0001058
757 Ga0501241_112897
758 Ga0501272_028729
759 Ga0501035_0002374
760 Ga0501035_0016656
761 Ga0501035_0081997
762 Ga0501035_0247037
763 Ga0501035_0442103
764 Ga0501044_0187184
765 Ga0501044_0231813
766 Ga0501044_0556704
767 Ga0501044_0595130
768 Ga0501045_0033052
769 nmdc:mga03683_49744_c1
770 nmdc:mga00v17_353850_c1
771 nmdc:mga00v17_62022_c1
772 nmdc:mga00v17_748082_c1
773 nmdc:mga0yw44_25782_c1
774 nmdc:mga0k408_12406_c1
775 nmdc:mga0k408_23939_c1
776 nmdc:mga0k408_32427_c1
777 nmdc:mga0k408_927110_c1
778 nmdc:mga07m45_2737_c1
779 nmdc:mga07m45_303846_c1
780 nmdc:mga07m45_540041_c1
781 nmdc:mga07m45_948_c1
782 nmdc:mga09592_683315_c1
783 nmdc:mga0qj67_41_c1
784 nmdc:mga06r32_419660_c1
785 nmdc:mga06r32_5033_c1
786 nmdc:mga08y16_827010_c1
787 nmdc:mga0sz30_60953_c1
788 Ga0500610_0000288
789 Ga0500610_0014980
790 Ga0500643_057023
791 Ga0500593_000170
792 Ga0500593_018954
793 Ga0500595_062401
794 Ga0500607_019954
795 Ga0501084_0029996
796 Ga0501084_0129291
797 Ga0501082_0328026
798 Ga0501082_0433246
799 Ga0466962_0049651
800 Ga0530510_0634509
801 2513694915
802 2738879286
803 2834644370
804 2874610350
805 2904547441
806 8007000256

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13411

MerR_1

MerR HTH family regulatory protein

31

98

0.95

PF09278

MerR-DNA-bind

MerR, DNA binding

73

133

0.91

PF00376

MerR

MerR family regulatory protein

32

68

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.8882 1 67
4r4e-assembly1.cif.gz_A structure of glnr-dna complex 0.8622 1 67
5c8d-assembly2.cif.gz_E crystal structure of full-length thermus thermophilus carh bound to adenosylcobalamin (dark state) 0.8582 4 61
4r4e-assembly1.cif.gz_B structure of glnr-dna complex 0.8528 1 67
5i41-assembly1.cif.gz_B structure of the apo raca dna binding domain 0.8522 2 65
ID Description Score Start End Superfamily
3hh0D01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8908 2 67 1.10.1660.10
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8891 2 69 1.10.1660.10
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8889 1 67 1.10.1660.10
1exjA02 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8841 1 67 1.10.1660.10
3hh0C01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8812 2 67 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A227JBP4-F1-model_v4 MerR family transcriptional regulator 0.9738 2 68 GO:0003677
GO:0003700
AF-A0A530M347-F1-model_v4 MerR family transcriptional regulator 0.9453 2 67 GO:0003677
GO:0003700
AF-A4EPG8-F1-model_v4 MerR-family transcriptional regulator 0.9451 1 75 GO:0003677
GO:0006355
AF-A0A2S3QPL1-F1-model_v4 MerR family transcriptional regulator 0.9393 4 127 GO:0003677
GO:0003700
AF-U4E055-F1-model_v4 deleted 0.9383 4 125

Map