F434592

General Info

Members Datasets Scaffolds Average Seq Length
400 231 382 203

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10395823|Ga0207661_103958231
Length 239
Sequence MCSSRPWRTGVSEDQIAHVDPSYARLSNNRRSAVEVVVSSRHCEVSERFREHVEEKLARLEKHDHRIIRVDVLLEKEARPRDPDRTVRVELTAKSRGPIVRAEAAAEDKMAALDLALDKMSAQMRRAADRRKVHRGQHTPVSVAQAMARISDGAATATDEGTVAEHSVGPVAVDGDGPLVVREKTHTASPITLEQALYEMELVGHDFYLFVDKESERPSVVYRRRGYDYGVISLDLGGS

Samples

Sample ID Description Type Environment
1 2643221561 Nocardioides sp. Root151 Isolate Unclassified
2 2643221576 Nocardioides sp. Root614 Isolate Unclassified
3 2643221590 Nocardioides sp. Root682 Isolate Unclassified
4 2643221604 Nocardioides sp. Root190 Isolate Unclassified
5 2643221615 Nocardioides sp. Root224 Isolate Unclassified
6 2643221617 Nocardioides sp. Root79 Isolate Unclassified
7 2643221620 Nocardioides sp. Root240 Isolate Unclassified
8 2643221641 Nocardioides sp. Root122 Isolate Unclassified
9 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
10 2643221696 Nocardioides sp. Root140 Isolate Unclassified
11 2738541305 Nocardioides sp. CF167 Isolate Unclassified
12 2739367898 Nocardioides sp. CF479 Isolate Unclassified
13 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
14 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
15 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
16 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
17 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
18 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
86 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
146 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
147 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
148 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
149 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
152 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
223 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
231 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.75
Metatranscriptomes 3.75
Isolates 4.5

Biome Distribution

Category Percentage (%)
Aerial Root 0.5
Bulb 0
Endosphere 9.5
Nodule 0.25
Rhizoplane 6.25
Rhizosphere 78.25
Stem 0
Stem Tuber 0
Unclassified 5.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1015822 3300000549 Bacteria 882
2 JGI24749J21850_1018755 3300002076 Bacteria 977
3 JGI24744J21845_10004351 3300002077 Bacteria 2926
4 Ga0070658_10012160 3300005327 Bacteria 6911
5 Ga0070683_100141795 3300005329 Bacteria 2277
6 Ga0070683_100404494 3300005329 Bacteria 1302
7 Ga0070683_100430762 3300005329 Bacteria 1258
8 Ga0070683_100646161 3300005329 Bacteria 1013
9 Ga0070683_101090739 3300005329 Bacteria 767
10 Ga0070690_100386619 3300005330 Bacteria 1024
11 Ga0070680_100304928 3300005336 Bacteria 1351
12 Ga0070682_100327622 3300005337 Bacteria 1134
13 Ga0068868_100114245 3300005338 Bacteria 2197
14 Ga0068868_100372873 3300005338 Bacteria 1226
15 Ga0068868_100515716 3300005338 Bacteria 1049
16 Ga0070660_100951632 3300005339 Bacteria 725
17 Ga0070687_100155320 3300005343 Bacteria 1347
18 Ga0070692_10060679 3300005345 Bacteria 1991
19 Ga0070668_100332421 3300005347 Bacteria 1282
20 Ga0070675_100033213 3300005354 Bacteria 4182
21 Ga0070674_100034056 3300005356 Bacteria 3397
22 Ga0070674_100328644 3300005356 Bacteria 1228
23 Ga0070674_100853857 3300005356 Bacteria 790
24 Ga0070673_100203793 3300005364 Bacteria 1705
25 Ga0070688_100176996 3300005365 Bacteria 1476
26 Ga0070659_100003393 3300005366 Bacteria 11343
27 Ga0070659_100102612 3300005366 Bacteria 2303
28 Ga0070659_100266901 3300005366 Bacteria 1421
29 Ga0070659_100293693 3300005366 Bacteria 1354
30 Ga0070659_100566512 3300005366 Bacteria 974
31 Ga0070701_10036913 3300005438 Bacteria 2464
32 Ga0070701_10554212 3300005438 Bacteria 755
33 Ga0070700_100002077 3300005441 Bacteria 10175
34 Ga0070700_100130939 3300005441 Bacteria 1693
35 Ga0070700_100352905 3300005441 Bacteria 1091
36 Ga0070662_100188122 3300005457 Bacteria 1631
37 Ga0068867_100096728 3300005459 Bacteria 2248
38 Ga0070679_101206619 3300005530 Bacteria 702
39 Ga0068853_100016252 3300005539 Bacteria 6124
40 Ga0068853_100782501 3300005539 Bacteria 913
41 Ga0070672_100003744 3300005543 Bacteria 9901
42 Ga0070672_100394709 3300005543 Bacteria 1185
43 Ga0070686_100113037 3300005544 Bacteria 1853
44 Ga0070664_100066888 3300005564 Bacteria 3070
45 Ga0068854_100049195 3300005578 Bacteria 3010
46 Ga0068856_100106164 3300005614 Bacteria 2803
47 Ga0068856_100965389 3300005614 Bacteria 871
48 Ga0070702_100044333 3300005615 Bacteria 2511
49 Ga0068852_100020901 3300005616 Bacteria 5211
50 Ga0068852_100195769 3300005616 Bacteria 1910
51 Ga0068852_100490687 3300005616 Bacteria 1222
52 Ga0068852_101036109 3300005616 Bacteria 840
53 Ga0068852_101257213 3300005616 Bacteria 762
54 Ga0068859_100468874 3300005617 Bacteria 1355
55 Ga0068866_10010104 3300005718 Bacteria 4036
56 Ga0068866_10238199 3300005718 Bacteria 1107
57 Ga0068861_100003139 3300005719 Bacteria 10921
58 Ga0068861_100014242 3300005719 Bacteria 5579
59 Ga0068851_10125837 3300005834 Bacteria 1382
60 Ga0068870_10046147 3300005840 Bacteria 2284
61 Ga0068863_100194034 3300005841 Bacteria 1952
62 Ga0068860_100002101 3300005843 Bacteria 21002
63 Ga0075365_10003781 3300006038 Bacteria 7887
64 Ga0075365_10033649 3300006038 Bacteria 3305
65 Ga0075365_10100043 3300006038 Bacteria 1984
66 Ga0075365_10141731 3300006038 Bacteria 1668
67 Ga0075365_10225992 3300006038 Bacteria 1313
68 Ga0075365_10424477 3300006038 Bacteria 939
69 Ga0075368_10025380 3300006042 Bacteria 2274
70 Ga0075368_10111172 3300006042 Bacteria 1130
71 Ga0075363_100003090 3300006048 Bacteria 6986
72 Ga0075363_100068036 3300006048 Bacteria 1931
73 Ga0075363_100288556 3300006048 Bacteria 951
74 Ga0075363_100306625 3300006048 Bacteria 922
75 Ga0075364_10057113 3300006051 Bacteria 2556
76 Ga0075364_10096536 3300006051 Bacteria 1965
77 Ga0075364_10159989 3300006051 Bacteria 1520
78 Ga0075367_10042208 3300006178 Bacteria 2668
79 Ga0068871_100440100 3300006358 Bacteria 1167
80 Ga0075428_100732115 3300006844 Bacteria 1053
81 Ga0068865_100012448 3300006881 Bacteria 5355
82 Ga0068865_100734132 3300006881 Bacteria 847
83 Ga0097620_100468879 3300006931 Bacteria 1355
84 Ga0111539_10386345 3300009094 Bacteria 1630
85 Ga0105245_10336409 3300009098 Bacteria 1492
86 Ga0105245_10465569 3300009098 Bacteria 1275
87 Ga0105247_10160948 3300009101 Bacteria 1486
88 Ga0105247_10392387 3300009101 Bacteria 987
89 Ga0105243_10003624 3300009148 Bacteria 12440
90 Ga0105243_10220211 3300009148 Bacteria 1677
91 Ga0105243_10369430 3300009148 Bacteria 1323
92 Ga0105243_10391451 3300009148 Bacteria 1288
93 Ga0105242_11035100 3300009176 Bacteria 831
94 Ga0105248_10160013 3300009177 Bacteria 2540
95 Ga0105237_10089432 3300009545 Bacteria 3069
96 Ga0105238_10272102 3300009551 Bacteria 1674
97 Ga0105238_10386569 3300009551 Bacteria 1391
98 Ga0105238_10806941 3300009551 Bacteria 954
99 Ga0105239_10084152 3300010375 Bacteria 3503
100 Ga0105239_10278041 3300010375 Bacteria 1884
101 Ga0105239_10920456 3300010375 Bacteria 1004
102 Ga0105246_10369448 3300011119 Bacteria 1181
103 Ga0157371_10222821 3300013102 Bacteria 1355
104 Ga0157369_10333029 3300013105 Bacteria 1577
105 Ga0157372_10028357 3300013307 Bacteria 6108
106 Ga0157372_10855345 3300013307 Bacteria 1056
107 Ga0157372_10855512 3300013307 Bacteria 1056
108 Ga0163163_10322065 3300014325 Bacteria 1600
109 Ga0157380_10174473 3300014326 Bacteria 1882
110 Ga0157380_10301808 3300014326 Bacteria 1475
111 Ga0157380_10415484 3300014326 Bacteria 1281
112 Ga0182008_10070362 3300014497 Bacteria 1721
113 Ga0157377_10014159 3300014745 Bacteria 4053
114 Ga0157377_10065890 3300014745 Bacteria 2082
115 Ga0163161_10113485 3300017792 Bacteria 2028
116 Ga0197907_10275161 3300020069 Bacteria 1345
117 Ga0197907_11339860 3300020069 Bacteria 1520
118 Ga0206349_1361030 3300020075 Bacteria 1642
119 Ga0206355_1253144 3300020076 Bacteria 1395
120 Ga0206351_10059720 3300020077 Bacteria 1569
121 Ga0206352_10496518 3300020078 Bacteria 1770
122 Ga0206350_11548703 3300020080 Bacteria 1027
123 Ga0206354_10660505 3300020081 Bacteria 2928
124 Ga0206354_11437232 3300020081 Bacteria 1354
125 Ga0206353_10114501 3300020082 Bacteria 1844
126 Ga0213875_10040522 3300021388 Bacteria 2193
127 Ga0224712_10088453 3300022467 Bacteria 1293
128 Ga0224712_10182234 3300022467 Bacteria 947
129 Ga0207642_10489181 3300025899 Bacteria 752
130 Ga0207688_10020747 3300025901 Bacteria 3588
131 Ga0207688_10262304 3300025901 Bacteria 1049
132 Ga0207688_10285375 3300025901 Bacteria 1006
133 Ga0207647_10045296 3300025904 Bacteria 2745
134 Ga0207647_10252442 3300025904 Bacteria 1011
135 Ga0207705_10107573 3300025909 Bacteria 2057
136 Ga0207671_10268593 3300025914 Bacteria 1343
137 Ga0207662_10119454 3300025918 Bacteria 1652
138 Ga0207662_10207486 3300025918 Bacteria 1271
139 Ga0207657_10019173 3300025919 Bacteria 6505
140 Ga0207657_10028160 3300025919 Bacteria 5131
141 Ga0207657_10485227 3300025919 Bacteria 968
142 Ga0207649_10498386 3300025920 Bacteria 926
143 Ga0207652_10198199 3300025921 Bacteria 1807
144 Ga0207694_10522733 3300025924 Bacteria 994
145 Ga0207659_10053857 3300025926 Bacteria 2871
146 Ga0207687_10198835 3300025927 Bacteria 1565
147 Ga0207690_10105143 3300025932 Bacteria 2024
148 Ga0207709_10037040 3300025935 Bacteria 2896
149 Ga0207709_10121973 3300025935 Bacteria 1761
150 Ga0207709_10550895 3300025935 Bacteria 907
151 Ga0207670_10157018 3300025936 Bacteria 1694
152 Ga0207669_10141769 3300025937 Bacteria 1669
153 Ga0207704_10124397 3300025938 Bacteria 1772
154 Ga0207704_10271420 3300025938 Bacteria 1284
155 Ga0207691_10004377 3300025940 Bacteria 13694
156 Ga0207691_10181852 3300025940 Bacteria 1837
157 Ga0207711_10136268 3300025941 Bacteria 2205
158 Ga0207661_10202822 3300025944 Bacteria 1744
159 Ga0207661_10335508 3300025944 Bacteria 1362
160 Ga0207661_10364731 3300025944 Bacteria 1305
161 Ga0207661_10395823 3300025944 Bacteria 1252
162 Ga0207661_10476402 3300025944 Bacteria 1139
163 Ga0207661_11117698 3300025944 Bacteria 725
164 Ga0207679_10007442 3300025945 Bacteria 6946
165 Ga0207679_10322900 3300025945 Bacteria 1337
166 Ga0207651_10078701 3300025960 Bacteria 2366
167 Ga0207640_10051010 3300025981 Bacteria 2687
168 Ga0207640_10608480 3300025981 Bacteria 926
169 Ga0207677_10116386 3300026023 Bacteria 2001
170 Ga0207677_10210366 3300026023 Bacteria 1553
171 Ga0207678_10687415 3300026067 Bacteria 900
172 Ga0207708_10003699 3300026075 Bacteria 11291
173 Ga0207708_10145442 3300026075 Bacteria 1862
174 Ga0207702_10076983 3300026078 Bacteria 2884
175 Ga0207702_10322874 3300026078 Bacteria 1470
176 Ga0207676_10313750 3300026095 Bacteria 1437
177 Ga0207676_10425030 3300026095 Bacteria 1247
178 Ga0207674_10488210 3300026116 Bacteria 1190
179 Ga0207674_10652977 3300026116 Bacteria 1016
180 Ga0207675_100001267 3300026118 Bacteria 25253
181 Ga0207675_100112342 3300026118 Bacteria 2571
182 Ga0207683_10136191 3300026121 Bacteria 2211
183 Ga0207698_10044466 3300026142 Bacteria 3337
184 Ga0207698_10460731 3300026142 Bacteria 1229
185 Ga0209813_10001463 3300027866 Bacteria 5327
186 Ga0209813_10103449 3300027866 Bacteria 972
187 Ga0209974_10005174 3300027876 Bacteria 4604
188 Ga0207428_10076254 3300027907 Bacteria 2626
189 Ga0268264_10000552 3300028381 Bacteria 46800
190 Ga0316181_1022872 3300030744 Bacteria 1403
191 Ga0307408_100770287 3300031548 Bacteria 871
192 Ga0307405_10019066 3300031731 Bacteria 3801
193 Ga0307405_10684852 3300031731 Bacteria 847
194 Ga0307405_10793791 3300031731 Bacteria 793
195 Ga0307413_10391735 3300031824 Bacteria 1086
196 Ga0307413_10500841 3300031824 Bacteria 975
197 Ga0307410_10267806 3300031852 Bacteria 1335
198 Ga0307406_10439713 3300031901 Bacteria 1044
199 Ga0307407_10321297 3300031903 Bacteria 1086
200 Ga0307412_10092323 3300031911 Bacteria 2121
201 Ga0307412_10225317 3300031911 Bacteria 1440
202 Ga0307412_10793790 3300031911 Bacteria 821
203 Ga0307409_100054372 3300031995 Bacteria 3083
204 Ga0307409_100073787 3300031995 Bacteria 2723
205 Ga0307409_100107017 3300031995 Bacteria 2335
206 Ga0307409_100135368 3300031995 Bacteria 2113
207 Ga0307409_100181873 3300031995 Bacteria 1862
208 Ga0307409_100696401 3300031995 Bacteria 1015
209 Ga0307409_100969947 3300031995 Bacteria 867
210 Ga0307416_100121229 3300032002 Bacteria 2331
211 Ga0307416_100295281 3300032002 Bacteria 1607
212 Ga0307414_10493842 3300032004 Bacteria 1082
213 Ga0307411_10243807 3300032005 Bacteria 1409
214 Ga0307415_100009969 3300032126 Bacteria 5358
215 Ga0307415_100031257 3300032126 Bacteria 3428
216 Ga0307415_100088894 3300032126 Bacteria 2230
217 Ga0307415_100102801 3300032126 Bacteria 2100
218 Ga0307415_100331315 3300032126 Bacteria 1274
219 Ga0395900_0345514 3300037418 Bacteria 1462
220 Ga0395900_0432548 3300037418 Bacteria 1275
221 Ga0395900_0892869 3300037418 Bacteria 812
222 Ga0436364_0673987 3300037853 Bacteria 2356
223 Ga0395901_0342220 3300038443 Bacteria 1545
224 Ga0242420_013296 3300038996 Bacteria 1402
225 Ga0439461_0050621 3300041410 Bacteria 920
226 Ga0451797_0200947 3300041453 Bacteria 806
227 Ga0451849_0323873 3300041505 Bacteria 1666
228 Ga0451843_1729566 3300041509 Bacteria 2050
229 Ga0451843_1742796 3300041509 Bacteria 815
230 Ga0451853_0937045 3300041512 Bacteria 1027
231 Ga0439442_022511 3300042002 Bacteria 1308
232 Ga0439445_0094789 3300042004 Bacteria 843
233 Ga0439446_0070835 3300042156 Bacteria 1066
234 Ga0439434_0039872 3300042435 Bacteria 1441
235 Ga0466972_0016058 3300044658 Bacteria 3743
236 Ga0466972_0017368 3300044658 Bacteria 3602
237 Ga0466972_0024516 3300044658 Bacteria 2993
238 Ga0466972_0092252 3300044658 Bacteria 1436
239 Ga0466965_0012812 3300044683 Bacteria 3947
240 Ga0466965_0030832 3300044683 Bacteria 2614
241 Ga0466965_0065812 3300044683 Bacteria 1816
242 Ga0466965_0227604 3300044683 Bacteria 995
243 Ga0466961_0134674 3300044693 Bacteria 1548
244 Ga0466961_0209088 3300044693 Bacteria 1205
245 Ga0466964_0131889 3300044706 Bacteria 1139
246 Ga0466971_0034556 3300044719 Bacteria 2265
247 Ga0466970_0007068 3300044765 Bacteria 5615
248 Ga0466970_0064566 3300044765 Bacteria 1963
249 Ga0466970_0067221 3300044765 Bacteria 1924
250 Ga0466970_0068512 3300044765 Bacteria 1906
251 Ga0466957_0014562 3300044842 Bacteria 4580
252 Ga0466957_0154967 3300044842 Bacteria 1484
253 Ga0466957_0689075 3300044842 Bacteria 720
254 Ga0466960_0010669 3300044901 Bacteria 3821
255 Ga0466960_0037196 3300044901 Bacteria 2283
256 Ga0466960_0111968 3300044901 Bacteria 1419
257 Ga0466958_0037840 3300045836 Bacteria 2892
258 Ga0466958_0269628 3300045836 Bacteria 1090
259 Ga0466967_0003180 3300045976 Bacteria 10592
260 Ga0466967_1091042 3300045976 Bacteria 795
261 Ga0495653_0311917 3300046463 Bacteria 1022
262 Ga0495664_0057043 3300046477 Bacteria 2323
263 Ga0495620_0225720 3300046515 Bacteria 716
264 Ga0495588_0170009 3300046674 Bacteria 1153
265 Ga0495593_0205708 3300047673 Bacteria 989
266 Ga0496100_0362661 3300048903 Bacteria 1097
267 Ga0496101_0222789 3300048904 Bacteria 1464
268 Ga0496102_0073929 3300048905 Bacteria 3133
269 Ga0496102_0249120 3300048905 Bacteria 1675
270 Ga0496103_0603750 3300048906 Bacteria 699
271 Ga0496104_0250435 3300048907 Bacteria 1684
272 Ga0496106_0020032 3300048909 Bacteria 4961
273 Ga0496106_0200935 3300048909 Bacteria 1586
274 Ga0496107_0217119 3300048910 Bacteria 1422
275 Ga0496108_0012821 3300048911 Bacteria 6826
276 Ga0496108_0111387 3300048911 Bacteria 2341
277 Ga0496109_0014258 3300048912 Bacteria 6916
278 Ga0496110_0107737 3300048913 Bacteria 2501
279 Ga0496110_0136973 3300048913 Bacteria 2213
280 Ga0496110_0142746 3300048913 Bacteria 2165
281 Ga0496111_0015778 3300048914 Bacteria 5196
282 Ga0496111_0229238 3300048914 Bacteria 1380
283 Ga0496113_0056084 3300048916 Bacteria 2956
284 Ga0496113_0058745 3300048916 Bacteria 2895
285 Ga0496114_0005607 3300048917 Bacteria 9843
286 Ga0496114_0022657 3300048917 Bacteria 5120
287 Ga0496114_0129473 3300048917 Bacteria 2178
288 Ga0496114_0143592 3300048917 Bacteria 2068
289 Ga0496114_0145582 3300048917 Bacteria 2053
290 Ga0501031_0131771 3300049568 Bacteria 1633
291 Ga0501031_0188024 3300049568 Bacteria 1349
292 Ga0501032_0394755 3300049569 Bacteria 889
293 Ga0501032_0482734 3300049569 Bacteria 793
294 Ga0501033_0191751 3300049570 Bacteria 1462
295 Ga0501034_0018872 3300049571 Bacteria 7065
296 Ga0501034_0287848 3300049571 Bacteria 1582
297 Ga0501034_0334738 3300049571 Bacteria 1445
298 Ga0501036_0003070 3300049572 Bacteria 13314
299 Ga0501036_0049964 3300049572 Bacteria 3542
300 Ga0501037_0050280 3300049573 Bacteria 3051
301 Ga0501037_0067660 3300049573 Bacteria 2601
302 Ga0501038_0001498 3300049574 Bacteria 21504
303 Ga0501038_0055572 3300049574 Bacteria 3400
304 Ga0501039_0012119 3300049575 Bacteria 6572
305 Ga0501039_0223588 3300049575 Bacteria 1480
306 Ga0501039_0581388 3300049575 Bacteria 878
307 Ga0501041_0039193 3300049577 Bacteria 2875
308 Ga0501042_0006173 3300049578 Bacteria 7772
309 Ga0501042_0186647 3300049578 Bacteria 1496
310 Ga0501043_0088703 3300049579 Bacteria 2431
311 Ga0501043_0093407 3300049579 Bacteria 2365
312 Ga0501046_0000573 3300049580 Bacteria 36317
313 Ga0501047_0063157 3300049581 Bacteria 3572
314 Ga0501048_0017322 3300049582 Bacteria 5309
315 Ga0501048_0263912 3300049582 Bacteria 1223
316 Ga0501048_0372533 3300049582 Bacteria 1019
317 Ga0501067_0007165 3300049583 Bacteria 6195
318 Ga0501067_0040100 3300049583 Bacteria 2601
319 Ga0501067_0043424 3300049583 Bacteria 2496
320 Ga0501067_0044913 3300049583 Bacteria 2454
321 Ga0501067_0077477 3300049583 Bacteria 1842
322 Ga0501068_0317106 3300049584 Bacteria 999
323 Ga0501068_0319313 3300049584 Bacteria 995
324 Ga0501068_0442674 3300049584 Bacteria 840
325 Ga0501069_0038294 3300049585 Bacteria 2647
326 Ga0501069_0221484 3300049585 Bacteria 1100
327 Ga0501069_0280651 3300049585 Bacteria 975
328 Ga0501070_0119952 3300049586 Bacteria 2174
329 Ga0501070_0461474 3300049586 Bacteria 1023
330 Ga0501070_0503870 3300049586 Bacteria 972
331 Ga0501071_0068710 3300049587 Bacteria 2578
332 Ga0501072_0029403 3300049588 Bacteria 4292
333 Ga0501072_0051737 3300049588 Bacteria 3234
334 Ga0501073_0087972 3300049589 Bacteria 2160
335 Ga0501073_0471026 3300049589 Bacteria 868
336 Ga0501074_0082943 3300049590 Bacteria 2299
337 Ga0501075_0036289 3300049591 Bacteria 3679
338 Ga0501075_0756961 3300049591 Bacteria 739
339 Ga0501076_0005041 3300049592 Bacteria 9451
340 Ga0501076_0270079 3300049592 Bacteria 1393
341 Ga0501079_0189569 3300049741 Bacteria 1604
342 Ga0501080_0199694 3300049742 Bacteria 1836
343 Ga0501081_0022982 3300049743 Bacteria 4175
344 Ga0501083_0148840 3300049744 Bacteria 1533
345 Ga0501035_0021448 3300049822 Bacteria 5940
346 Ga0501035_0048613 3300049822 Bacteria 3804
347 Ga0501044_0022299 3300049823 Bacteria 6748
348 Ga0501044_0218956 3300049823 Bacteria 1855
349 Ga0501045_0008042 3300049824 Bacteria 7346
350 Ga0501045_0230797 3300049824 Bacteria 1378
351 nmdc:mga03683_41902_c1 3300050489 Bacteria 1881
352 nmdc:mga03n38_118421_c1 3300050490 Bacteria 1299
353 nmdc:mga03n38_22729_c1 3300050490 Bacteria 2542
354 nmdc:mga00v17_14274_c1 3300050491 Bacteria 4430
355 nmdc:mga00v17_166216_c1 3300050491 Bacteria 1421
356 nmdc:mga00v17_53928_c1 3300050491 Bacteria 2452
357 nmdc:mga0yw44_100153_c1 3300050492 Bacteria 1845
358 nmdc:mga0yw44_109217_c1 3300050492 Bacteria 1771
359 nmdc:mga0yw44_211137_c1 3300050492 Bacteria 1284
360 nmdc:mga0yw44_268070_c1 3300050492 Bacteria 1139
361 nmdc:mga0yw44_328227_c1 3300050492 Bacteria 1028
362 nmdc:mga0yw44_517_c1 3300050492 Bacteria 13812
363 nmdc:mga0yw44_80795_c1 3300050492 Bacteria 2037
364 nmdc:mga06z11_43252_c1 3300050494 Bacteria 2265
365 nmdc:mga06z11_440166_c1 3300050494 Bacteria 787
366 nmdc:mga06z11_9047_c1 3300050494 Bacteria 4184
367 nmdc:mga04h51_112436_c1 3300050495 Bacteria 1006
368 nmdc:mga04h51_19848_c1 3300050495 Bacteria 1998
369 nmdc:mga08y16_20409_c1 3300050511 Bacteria 6994
370 Ga0495601_0043950 3300053077 Bacteria 2807
371 Ga0500556_0001149 3300053104 Bacteria 12884
372 Ga0500593_001601 3300053117 Bacteria 8155
373 Ga0501084_0131047 3300054114 Bacteria 2110
374 Ga0587083_0032654 3300059505 Bacteria 1045
375 Ga0587106_045112 3300059605 Bacteria 762
376 Ga0587114_013872 3300059655 Bacteria 1043
377 Ga0501082_0024140 3300060353 Bacteria 5245
378 Ga0466962_0038838 3300061719 Bacteria 2280
379 Ga0466962_0160750 3300061719 Bacteria 1092
380 Ga0530510_0051817 3300061734 Bacteria 2966
381 Ga0530510_0086146 3300061734 Bacteria 2289
382 Ga0530510_0273662 3300061734 Bacteria 1260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038996 Ga0242420_013296 Ga0242420_013296_890_1387 159
2 3300009094 Ga0111539_10386345 Ga0111539_103863452 160
3 3300050492 nmdc:mga0yw44_100153_c1 nmdc:mga0yw44_100153_c1_525_1031 160
4 3300050511 nmdc:mga08y16_20409_c1 nmdc:mga08y16_20409_c1_4797_5303 160
5 3300027876 Ga0209974_10005174 Ga0209974_100051741 163
6 3300006038 Ga0075365_10003781 Ga0075365_100037814 165
7 3300049590 Ga0501074_0082943 Ga0501074_0082943_1720_2283 175
8 3300009148 Ga0105243_10220211 Ga0105243_102202112 178
9 3300049584 Ga0501068_0319313 Ga0501068_0319313_147_764 182
10 3300048912 Ga0496109_0014258 Ga0496109_0014258_5473_6081 183
11 3300048916 Ga0496113_0058745 Ga0496113_0058745_778_1386 183
12 3300025944 Ga0207661_10476402 Ga0207661_104764021 185
13 3300049568 Ga0501031_0188024 Ga0501031_0188024_78_728 186
14 3300049578 Ga0501042_0186647 Ga0501042_0186647_465_1052 186
15 3300005356 Ga0070674_100853857 Ga0070674_1008538571 187
16 3300025981 Ga0207640_10608480 Ga0207640_106084801 187
17 3300041509 Ga0451843_1729566 Ga0451843_1729566_1447_2028 187
18 3300005843 Ga0068860_100002101 Ga0068860_10000210118 188
19 3300006038 Ga0075365_10100043 Ga0075365_101000432 188
20 3300006051 Ga0075364_10096536 Ga0075364_100965362 188
21 3300028381 Ga0268264_10000552 Ga0268264_1000055219 188
22 3300031911 Ga0307412_10793790 Ga0307412_107937901 188
23 3300049568 Ga0501031_0131771 Ga0501031_0131771_28_621 188
24 3300050491 nmdc:mga00v17_14274_c1 nmdc:mga00v17_14274_c1_2386_2994 188
25 3300050492 nmdc:mga0yw44_80795_c1 nmdc:mga0yw44_80795_c1_597_1205 188
26 3300027907 Ga0207428_10076254 Ga0207428_100762543 189
27 3300049584 Ga0501068_0442674 Ga0501068_0442674_35_664 189
28 3300006048 Ga0075363_100288556 Ga0075363_1002885562 190
29 3300014326 Ga0157380_10174473 Ga0157380_101744732 190
30 3300021388 Ga0213875_10040522 Ga0213875_100405223 190
31 3300037853 Ga0436364_0673987 Ga0436364_0673987_417_1094 190
32 3300044658 Ga0466972_0092252 Ga0466972_0092252_623_1240 190
33 3300020080 Ga0206350_11548703 Ga0206350_115487031 191
34 3300041410 Ga0439461_0050621 Ga0439461_0050621_202_876 191
35 3300042002 Ga0439442_022511 Ga0439442_022511_378_1052 191
36 3300042156 Ga0439446_0070835 Ga0439446_0070835_40_714 191
37 3300042435 Ga0439434_0039872 Ga0439434_0039872_535_1209 191
38 3300031995 Ga0307409_100696401 Ga0307409_1006964012 192
39 3300049586 Ga0501070_0119952 Ga0501070_0119952_1034_1678 192
40 3300005329 Ga0070683_100141795 Ga0070683_1001417951 193
41 3300005337 Ga0070682_100327622 Ga0070682_1003276222 193
42 3300005338 Ga0068868_100372873 Ga0068868_1003728731 193
43 3300005347 Ga0070668_100332421 Ga0070668_1003324211 193
44 3300005614 Ga0068856_100965389 Ga0068856_1009653891 193
45 3300005616 Ga0068852_101036109 Ga0068852_1010361091 193
46 3300005834 Ga0068851_10125837 Ga0068851_101258372 193
47 3300006038 Ga0075365_10033649 Ga0075365_100336493 193
48 3300006048 Ga0075363_100306625 Ga0075363_1003066251 193
49 3300006844 Ga0075428_100732115 Ga0075428_1007321152 193
50 3300009098 Ga0105245_10336409 Ga0105245_103364091 193
51 3300009101 Ga0105247_10392387 Ga0105247_103923872 193
52 3300009551 Ga0105238_10386569 Ga0105238_103865692 193
53 3300013307 Ga0157372_10855345 Ga0157372_108553451 193
54 3300013307 Ga0157372_10855512 Ga0157372_108555121 193
55 3300025944 Ga0207661_10202822 Ga0207661_102028221 193
56 3300025944 Ga0207661_11117698 Ga0207661_111176981 193
57 3300026023 Ga0207677_10210366 Ga0207677_102103662 193
58 3300026078 Ga0207702_10322874 Ga0207702_103228742 193
59 3300026116 Ga0207674_10488210 Ga0207674_104882101 193
60 3300041512 Ga0451853_0937045 Ga0451853_0937045_309_941 193
61 3300048904 Ga0496101_0222789 Ga0496101_0222789_609_1217 193
62 3300048905 Ga0496102_0073929 Ga0496102_0073929_1627_2232 193
63 3300048907 Ga0496104_0250435 Ga0496104_0250435_225_845 193
64 3300048909 Ga0496106_0020032 Ga0496106_0020032_2277_2897 193
65 3300048910 Ga0496107_0217119 Ga0496107_0217119_756_1376 193
66 3300048911 Ga0496108_0012821 Ga0496108_0012821_185_805 193
67 3300048913 Ga0496110_0107737 Ga0496110_0107737_742_1362 193
68 3300048914 Ga0496111_0015778 Ga0496111_0015778_3145_3765 193
69 3300048916 Ga0496113_0056084 Ga0496113_0056084_127_747 193
70 3300048917 Ga0496114_0005607 Ga0496114_0005607_5302_5910 193
71 3300048917 Ga0496114_0145582 Ga0496114_0145582_975_1580 193
72 3300049583 Ga0501067_0007165 Ga0501067_0007165_1468_2073 193
73 3300049583 Ga0501067_0043424 Ga0501067_0043424_65_685 193
74 3300049583 Ga0501067_0044913 Ga0501067_0044913_1454_2074 193
75 3300049585 Ga0501069_0038294 Ga0501069_0038294_831_1451 193
76 3300061734 Ga0530510_0086146 Ga0530510_0086146_11_631 193
77 3300061734 Ga0530510_0273662 Ga0530510_0273662_608_1213 193
78 iso_pu_bacteria 2643221641 2644231495 193
79 3300002076 JGI24749J21850_1018755 JGI24749J21850_10187552 194
80 3300002077 JGI24744J21845_10004351 JGI24744J21845_100043512 194
81 3300005329 Ga0070683_100430762 Ga0070683_1004307621 194
82 3300005330 Ga0070690_100386619 Ga0070690_1003866192 194
83 3300005338 Ga0068868_100114245 Ga0068868_1001142453 194
84 3300005343 Ga0070687_100155320 Ga0070687_1001553201 194
85 3300005345 Ga0070692_10060679 Ga0070692_100606792 194
86 3300005354 Ga0070675_100033213 Ga0070675_1000332133 194
87 3300005356 Ga0070674_100034056 Ga0070674_1000340562 194
88 3300005364 Ga0070673_100203793 Ga0070673_1002037932 194
89 3300005365 Ga0070688_100176996 Ga0070688_1001769962 194
90 3300005366 Ga0070659_100102612 Ga0070659_1001026122 194
91 3300005366 Ga0070659_100566512 Ga0070659_1005665122 194
92 3300005438 Ga0070701_10036913 Ga0070701_100369132 194
93 3300005441 Ga0070700_100002077 Ga0070700_1000020776 194
94 3300005457 Ga0070662_100188122 Ga0070662_1001881222 194
95 3300005459 Ga0068867_100096728 Ga0068867_1000967282 194
96 3300005539 Ga0068853_100016252 Ga0068853_1000162524 194
97 3300005543 Ga0070672_100003744 Ga0070672_10000374410 194
98 3300005544 Ga0070686_100113037 Ga0070686_1001130371 194
99 3300005564 Ga0070664_100066888 Ga0070664_1000668882 194
100 3300005578 Ga0068854_100049195 Ga0068854_1000491953 194
101 3300005615 Ga0070702_100044333 Ga0070702_1000443332 194
102 3300005616 Ga0068852_100020901 Ga0068852_1000209014 194
103 3300005617 Ga0068859_100468874 Ga0068859_1004688742 194
104 3300005718 Ga0068866_10010104 Ga0068866_100101042 194
105 3300005719 Ga0068861_100003139 Ga0068861_1000031396 194
106 3300005840 Ga0068870_10046147 Ga0068870_100461472 194
107 3300005841 Ga0068863_100194034 Ga0068863_1001940343 194
108 3300006358 Ga0068871_100440100 Ga0068871_1004401002 194
109 3300006881 Ga0068865_100012448 Ga0068865_1000124484 194
110 3300006931 Ga0097620_100468879 Ga0097620_1004688792 194
111 3300009098 Ga0105245_10465569 Ga0105245_104655691 194
112 3300009101 Ga0105247_10160948 Ga0105247_101609482 194
113 3300009148 Ga0105243_10003624 Ga0105243_100036246 194
114 3300009177 Ga0105248_10160013 Ga0105248_101600133 194
115 3300009551 Ga0105238_10272102 Ga0105238_102721022 194
116 3300013102 Ga0157371_10222821 Ga0157371_102228212 194
117 3300013105 Ga0157369_10333029 Ga0157369_103330292 194
118 3300013307 Ga0157372_10028357 Ga0157372_100283573 194
119 3300014326 Ga0157380_10301808 Ga0157380_103018082 194
120 3300014745 Ga0157377_10014159 Ga0157377_100141594 194
121 3300017792 Ga0163161_10113485 Ga0163161_101134853 194
122 3300025901 Ga0207688_10020747 Ga0207688_100207473 194
123 3300025918 Ga0207662_10119454 Ga0207662_101194542 194
124 3300025924 Ga0207694_10522733 Ga0207694_105227332 194
125 3300025926 Ga0207659_10053857 Ga0207659_100538573 194
126 3300025927 Ga0207687_10198835 Ga0207687_101988352 194
127 3300025932 Ga0207690_10105143 Ga0207690_101051433 194
128 3300025935 Ga0207709_10037040 Ga0207709_100370401 194
129 3300025936 Ga0207670_10157018 Ga0207670_101570182 194
130 3300025937 Ga0207669_10141769 Ga0207669_101417692 194
131 3300025938 Ga0207704_10124397 Ga0207704_101243972 194
132 3300025940 Ga0207691_10004377 Ga0207691_1000437711 194
133 3300025941 Ga0207711_10136268 Ga0207711_101362682 194
134 3300025945 Ga0207679_10007442 Ga0207679_100074423 194
135 3300025945 Ga0207679_10322900 Ga0207679_103229002 194
136 3300025960 Ga0207651_10078701 Ga0207651_100787012 194
137 3300025981 Ga0207640_10051010 Ga0207640_100510103 194
138 3300026023 Ga0207677_10116386 Ga0207677_101163862 194
139 3300026075 Ga0207708_10003699 Ga0207708_100036996 194
140 3300026095 Ga0207676_10425030 Ga0207676_104250302 194
141 3300026118 Ga0207675_100001267 Ga0207675_1000012676 194
142 3300026121 Ga0207683_10136191 Ga0207683_101361913 194
143 3300026142 Ga0207698_10044466 Ga0207698_100444662 194
144 3300044901 Ga0466960_0111968 Ga0466960_0111968_25_645 194
145 3300045976 Ga0466967_0003180 Ga0466967_0003180_1118_1738 194
146 3300048903 Ga0496100_0362661 Ga0496100_0362661_137_745 194
147 3300048909 Ga0496106_0200935 Ga0496106_0200935_688_1296 194
148 3300048911 Ga0496108_0111387 Ga0496108_0111387_1511_2119 194
149 3300048913 Ga0496110_0142746 Ga0496110_0142746_163_771 194
150 3300048914 Ga0496111_0229238 Ga0496111_0229238_333_941 194
151 3300048917 Ga0496114_0129473 Ga0496114_0129473_618_1241 194
152 3300059605 Ga0587106_045112 Ga0587106_045112_60_668 194
153 iso_pu_bacteria 2643221561 2643823850 194
154 iso_pu_bacteria 2643221696 2644533126 194
155 iso_pu_bacteria 2739367898 2740167422 194
156 3300014745 Ga0157377_10065890 Ga0157377_100658902 195
157 3300025920 Ga0207649_10498386 Ga0207649_104983861 195
158 3300059505 Ga0587083_0032654 Ga0587083_0032654_76_687 195
159 iso_pu_bacteria 2855386786 2855389191 195
160 3300005329 Ga0070683_101090739 Ga0070683_1010907391 196
161 3300005338 Ga0068868_100515716 Ga0068868_1005157162 196
162 3300005339 Ga0070660_100951632 Ga0070660_1009516321 196
163 3300005441 Ga0070700_100352905 Ga0070700_1003529051 196
164 3300005543 Ga0070672_100394709 Ga0070672_1003947091 196
165 3300005616 Ga0068852_100195769 Ga0068852_1001957692 196
166 3300005616 Ga0068852_100490687 Ga0068852_1004906872 196
167 3300005718 Ga0068866_10238199 Ga0068866_102381992 196
168 3300006051 Ga0075364_10159989 Ga0075364_101599892 196
169 3300009148 Ga0105243_10369430 Ga0105243_103694302 196
170 3300009176 Ga0105242_11035100 Ga0105242_110351001 196
171 3300014325 Ga0163163_10322065 Ga0163163_103220652 196
172 3300014326 Ga0157380_10415484 Ga0157380_104154842 196
173 3300022467 Ga0224712_10182234 Ga0224712_101822341 196
174 3300025899 Ga0207642_10489181 Ga0207642_104891811 196
175 3300025901 Ga0207688_10262304 Ga0207688_102623041 196
176 3300025919 Ga0207657_10485227 Ga0207657_104852271 196
177 3300025940 Ga0207691_10181852 Ga0207691_101818521 196
178 3300026095 Ga0207676_10313750 Ga0207676_103137502 196
179 3300026142 Ga0207698_10460731 Ga0207698_104607312 196
180 3300046463 Ga0495653_0311917 Ga0495653_0311917_391_1005 196
181 3300046674 Ga0495588_0170009 Ga0495588_0170009_458_1078 196
182 3300048913 Ga0496110_0136973 Ga0496110_0136973_780_1397 196
183 3300048917 Ga0496114_0143592 Ga0496114_0143592_446_1063 196
184 3300049571 Ga0501034_0287848 Ga0501034_0287848_213_827 196
185 3300050489 nmdc:mga03683_41902_c1 nmdc:mga03683_41902_c1_694_1311 196
186 3300050490 nmdc:mga03n38_22729_c1 nmdc:mga03n38_22729_c1_837_1454 196
187 3300050491 nmdc:mga00v17_166216_c1 nmdc:mga00v17_166216_c1_223_840 196
188 3300050492 nmdc:mga0yw44_109217_c1 nmdc:mga0yw44_109217_c1_917_1534 196
189 3300050494 nmdc:mga06z11_440166_c1 nmdc:mga06z11_440166_c1_67_684 196
190 iso_pu_bacteria 2643221576 2643889748 196
191 iso_pu_bacteria 2643221590 2643958804 196
192 iso_pu_bacteria 2811994874 2812334031 196
193 iso_pu_bacteria 2857481737 2857482831 196
194 iso_pu_bacteria 2984576629 2984580674 196
195 iso_pu_bacteria 2990256926 2990258366 196
196 3300005329 Ga0070683_100404494 Ga0070683_1004044941 197
197 3300005356 Ga0070674_100328644 Ga0070674_1003286442 197
198 3300005366 Ga0070659_100266901 Ga0070659_1002669013 197
199 3300005539 Ga0068853_100782501 Ga0068853_1007825011 197
200 3300005614 Ga0068856_100106164 Ga0068856_1001061643 197
201 3300005616 Ga0068852_101257213 Ga0068852_1012572131 197
202 3300009551 Ga0105238_10806941 Ga0105238_108069411 197
203 3300010375 Ga0105239_10278041 Ga0105239_102780413 197
204 3300020069 Ga0197907_11339860 Ga0197907_113398602 197
205 3300020075 Ga0206349_1361030 Ga0206349_13610302 197
206 3300020076 Ga0206355_1253144 Ga0206355_12531441 197
207 3300020077 Ga0206351_10059720 Ga0206351_100597201 197
208 3300020078 Ga0206352_10496518 Ga0206352_104965183 197
209 3300020081 Ga0206354_10660505 Ga0206354_106605053 197
210 3300020082 Ga0206353_10114501 Ga0206353_101145012 197
211 3300022467 Ga0224712_10088453 Ga0224712_100884531 197
212 3300025944 Ga0207661_10364731 Ga0207661_103647311 197
213 3300026078 Ga0207702_10076983 Ga0207702_100769833 197
214 3300030744 Ga0316181_1022872 Ga0316181_10228721 197
215 3300031731 Ga0307405_10793791 Ga0307405_107937911 197
216 3300031911 Ga0307412_10225317 Ga0307412_102253172 197
217 3300031995 Ga0307409_100054372 Ga0307409_1000543722 197
218 3300031995 Ga0307409_100181873 Ga0307409_1001818732 197
219 3300032002 Ga0307416_100295281 Ga0307416_1002952812 197
220 3300032126 Ga0307415_100031257 Ga0307415_1000312572 197
221 3300032126 Ga0307415_100088894 Ga0307415_1000888942 197
222 3300032126 Ga0307415_100331315 Ga0307415_1003313152 197
223 3300042004 Ga0439445_0094789 Ga0439445_0094789_188_799 197
224 3300044658 Ga0466972_0024516 Ga0466972_0024516_480_1097 197
225 3300044683 Ga0466965_0012812 Ga0466965_0012812_873_1490 197
226 3300044693 Ga0466961_0134674 Ga0466961_0134674_353_970 197
227 3300044719 Ga0466971_0034556 Ga0466971_0034556_915_1532 197
228 3300044765 Ga0466970_0064566 Ga0466970_0064566_285_902 197
229 3300044842 Ga0466957_0014562 Ga0466957_0014562_2598_3215 197
230 3300044842 Ga0466957_0154967 Ga0466957_0154967_697_1317 197
231 3300044901 Ga0466960_0010669 Ga0466960_0010669_474_1100 197
232 3300044901 Ga0466960_0037196 Ga0466960_0037196_495_1112 197
233 3300045836 Ga0466958_0037840 Ga0466958_0037840_1800_2417 197
234 3300045836 Ga0466958_0269628 Ga0466958_0269628_176_796 197
235 3300046477 Ga0495664_0057043 Ga0495664_0057043_1083_1703 197
236 3300047673 Ga0495593_0205708 Ga0495593_0205708_351_971 197
237 3300049584 Ga0501068_0317106 Ga0501068_0317106_304_918 197
238 3300049586 Ga0501070_0461474 Ga0501070_0461474_75_689 197
239 3300053077 Ga0495601_0043950 Ga0495601_0043950_29_649 197
240 3300061719 Ga0466962_0038838 Ga0466962_0038838_935_1552 197
241 3300061719 Ga0466962_0160750 Ga0466962_0160750_450_1076 197
242 iso_pu_bacteria 2643221604 2644032541 197
243 iso_pu_bacteria 2643221615 2644090783 197
244 iso_pu_bacteria 2643221617 2644102755 197
245 iso_pu_bacteria 2643221620 2644118417 197
246 iso_pu_bacteria 2643221657 2644320587 197
247 iso_pu_bacteria 2738541305 2738870676 197
248 iso_pu_bacteria 8054609563 8054614399 197
249 3300005327 Ga0070658_10012160 Ga0070658_100121605 198
250 3300005329 Ga0070683_100646161 Ga0070683_1006461611 198
251 3300005336 Ga0070680_100304928 Ga0070680_1003049281 198
252 3300005366 Ga0070659_100003393 Ga0070659_1000033934 198
253 3300005366 Ga0070659_100293693 Ga0070659_1002936931 198
254 3300006038 Ga0075365_10225992 Ga0075365_102259921 198
255 3300006038 Ga0075365_10424477 Ga0075365_104244772 198
256 3300006042 Ga0075368_10025380 Ga0075368_100253802 198
257 3300006048 Ga0075363_100003090 Ga0075363_1000030901 198
258 3300006051 Ga0075364_10057113 Ga0075364_100571133 198
259 3300009148 Ga0105243_10391451 Ga0105243_103914511 198
260 3300009545 Ga0105237_10089432 Ga0105237_100894322 198
261 3300010375 Ga0105239_10084152 Ga0105239_100841522 198
262 3300010375 Ga0105239_10920456 Ga0105239_109204562 198
263 3300011119 Ga0105246_10369448 Ga0105246_103694481 198
264 3300014497 Ga0182008_10070362 Ga0182008_100703622 198
265 3300020069 Ga0197907_10275161 Ga0197907_102751612 198
266 3300020081 Ga0206354_11437232 Ga0206354_114372321 198
267 3300025901 Ga0207688_10285375 Ga0207688_102853751 198
268 3300025904 Ga0207647_10045296 Ga0207647_100452963 198
269 3300025909 Ga0207705_10107573 Ga0207705_101075731 198
270 3300025914 Ga0207671_10268593 Ga0207671_102685932 198
271 3300025919 Ga0207657_10019173 Ga0207657_100191733 198
272 3300025919 Ga0207657_10028160 Ga0207657_100281606 198
273 3300025921 Ga0207652_10198199 Ga0207652_101981991 198
274 3300025935 Ga0207709_10550895 Ga0207709_105508951 198
275 3300025944 Ga0207661_10335508 Ga0207661_103355081 198
276 3300025944 Ga0207661_10395823 Ga0207661_103958231 198
277 3300026067 Ga0207678_10687415 Ga0207678_106874152 198
278 3300027866 Ga0209813_10001463 Ga0209813_100014634 198
279 3300031901 Ga0307406_10439713 Ga0307406_104397132 198
280 3300032004 Ga0307414_10493842 Ga0307414_104938421 198
281 3300032005 Ga0307411_10243807 Ga0307411_102438072 198
282 3300038443 Ga0395901_0342220 Ga0395901_0342220_145_759 198
283 3300041453 Ga0451797_0200947 Ga0451797_0200947_173_787 198
284 3300041505 Ga0451849_0323873 Ga0451849_0323873_822_1436 198
285 3300041509 Ga0451843_1742796 Ga0451843_1742796_137_751 198
286 3300044658 Ga0466972_0017368 Ga0466972_0017368_1767_2387 198
287 3300044706 Ga0466964_0131889 Ga0466964_0131889_270_890 198
288 3300048917 Ga0496114_0022657 Ga0496114_0022657_4332_4946 198
289 3300049569 Ga0501032_0394755 Ga0501032_0394755_71_721 198
290 3300049569 Ga0501032_0482734 Ga0501032_0482734_22_654 198
291 3300049575 Ga0501039_0223588 Ga0501039_0223588_359_991 198
292 3300049575 Ga0501039_0581388 Ga0501039_0581388_66_716 198
293 3300049582 Ga0501048_0372533 Ga0501048_0372533_50_664 198
294 3300049583 Ga0501067_0077477 Ga0501067_0077477_861_1475 198
295 3300049585 Ga0501069_0280651 Ga0501069_0280651_134_748 198
296 3300049588 Ga0501072_0051737 Ga0501072_0051737_1864_2514 198
297 3300049592 Ga0501076_0270079 Ga0501076_0270079_256_888 198
298 3300049824 Ga0501045_0230797 Ga0501045_0230797_683_1303 198
299 3300050490 nmdc:mga03n38_118421_c1 nmdc:mga03n38_118421_c1_517_1131 198
300 3300050491 nmdc:mga00v17_53928_c1 nmdc:mga00v17_53928_c1_555_1169 198
301 3300050492 nmdc:mga0yw44_328227_c1 nmdc:mga0yw44_328227_c1_86_700 198
302 3300050492 nmdc:mga0yw44_517_c1 nmdc:mga0yw44_517_c1_3341_3955 198
303 3300050494 nmdc:mga06z11_9047_c1 nmdc:mga06z11_9047_c1_3359_3973 198
304 3300050495 nmdc:mga04h51_112436_c1 nmdc:mga04h51_112436_c1_181_795 198
305 3300059655 Ga0587114_013872 Ga0587114_013872_66_686 198
306 3300005530 Ga0070679_101206619 Ga0070679_1012066191 199
307 3300026116 Ga0207674_10652977 Ga0207674_106529771 199
308 3300031731 Ga0307405_10684852 Ga0307405_106848521 199
309 3300031824 Ga0307413_10391735 Ga0307413_103917351 199
310 3300037418 Ga0395900_0432548 Ga0395900_0432548_52_669 199
311 3300044683 Ga0466965_0065812 Ga0466965_0065812_489_1106 199
312 3300044765 Ga0466970_0067221 Ga0466970_0067221_492_1109 199
313 3300045976 Ga0466967_1091042 Ga0466967_1091042_92_709 199
314 3300048906 Ga0496103_0603750 Ga0496103_0603750_23_649 199
315 3300049570 Ga0501033_0191751 Ga0501033_0191751_774_1394 199
316 3300049572 Ga0501036_0003070 Ga0501036_0003070_7568_8188 199
317 3300049573 Ga0501037_0050280 Ga0501037_0050280_623_1243 199
318 3300049574 Ga0501038_0055572 Ga0501038_0055572_1957_2577 199
319 3300049575 Ga0501039_0012119 Ga0501039_0012119_3164_3784 199
320 3300049577 Ga0501041_0039193 Ga0501041_0039193_1262_1882 199
321 3300049578 Ga0501042_0006173 Ga0501042_0006173_6644_7264 199
322 3300049579 Ga0501043_0088703 Ga0501043_0088703_25_645 199
323 3300049582 Ga0501048_0017322 Ga0501048_0017322_3533_4153 199
324 3300049585 Ga0501069_0221484 Ga0501069_0221484_51_671 199
325 3300049587 Ga0501071_0068710 Ga0501071_0068710_1262_1882 199
326 3300049588 Ga0501072_0029403 Ga0501072_0029403_2911_3531 199
327 3300049589 Ga0501073_0471026 Ga0501073_0471026_210_830 199
328 3300049591 Ga0501075_0036289 Ga0501075_0036289_357_977 199
329 3300049592 Ga0501076_0005041 Ga0501076_0005041_5965_6585 199
330 3300049741 Ga0501079_0189569 Ga0501079_0189569_755_1375 199
331 3300049742 Ga0501080_0199694 Ga0501080_0199694_984_1604 199
332 3300049743 Ga0501081_0022982 Ga0501081_0022982_792_1412 199
333 3300049744 Ga0501083_0148840 Ga0501083_0148840_528_1148 199
334 3300049822 Ga0501035_0021448 Ga0501035_0021448_3460_4080 199
335 3300049823 Ga0501044_0218956 Ga0501044_0218956_543_1163 199
336 3300049824 Ga0501045_0008042 Ga0501045_0008042_578_1198 199
337 3300054114 Ga0501084_0131047 Ga0501084_0131047_690_1310 199
338 3300060353 Ga0501082_0024140 Ga0501082_0024140_2638_3258 199
339 3300061734 Ga0530510_0051817 Ga0530510_0051817_1804_2424 199
340 3300037418 Ga0395900_0345514 Ga0395900_0345514_253_876 200
341 3300044658 Ga0466972_0016058 Ga0466972_0016058_3054_3686 200
342 3300044683 Ga0466965_0227604 Ga0466965_0227604_54_686 200
343 3300044765 Ga0466970_0007068 Ga0466970_0007068_3136_3768 200
344 3300044765 Ga0466970_0068512 Ga0466970_0068512_1185_1817 200
345 3300044842 Ga0466957_0689075 Ga0466957_0689075_17_667 200
346 3300049586 Ga0501070_0503870 Ga0501070_0503870_75_698 200
347 3300050492 nmdc:mga0yw44_211137_c1 nmdc:mga0yw44_211137_c1_67_693 200
348 3300050492 nmdc:mga0yw44_268070_c1 nmdc:mga0yw44_268070_c1_153_773 200
349 3300000549 LJQas_1015822 LJQas_10158221 201
350 3300005438 Ga0070701_10554212 Ga0070701_105542121 201
351 3300005441 Ga0070700_100130939 Ga0070700_1001309393 201
352 3300005719 Ga0068861_100014242 Ga0068861_1000142425 201
353 3300006038 Ga0075365_10141731 Ga0075365_101417312 201
354 3300006042 Ga0075368_10111172 Ga0075368_101111721 201
355 3300006048 Ga0075363_100068036 Ga0075363_1000680362 201
356 3300006178 Ga0075367_10042208 Ga0075367_100422081 201
357 3300006881 Ga0068865_100734132 Ga0068865_1007341322 201
358 3300025904 Ga0207647_10252442 Ga0207647_102524421 201
359 3300025918 Ga0207662_10207486 Ga0207662_102074862 201
360 3300025935 Ga0207709_10121973 Ga0207709_101219732 201
361 3300025938 Ga0207704_10271420 Ga0207704_102714201 201
362 3300026075 Ga0207708_10145442 Ga0207708_101454423 201
363 3300026118 Ga0207675_100112342 Ga0207675_1001123422 201
364 3300027866 Ga0209813_10103449 Ga0209813_101034492 201
365 3300031548 Ga0307408_100770287 Ga0307408_1007702872 201
366 3300031731 Ga0307405_10019066 Ga0307405_100190663 201
367 3300031824 Ga0307413_10500841 Ga0307413_105008411 201
368 3300031852 Ga0307410_10267806 Ga0307410_102678061 201
369 3300031903 Ga0307407_10321297 Ga0307407_103212972 201
370 3300031911 Ga0307412_10092323 Ga0307412_100923233 201
371 3300031995 Ga0307409_100073787 Ga0307409_1000737871 201
372 3300031995 Ga0307409_100107017 Ga0307409_1001070172 201
373 3300031995 Ga0307409_100135368 Ga0307409_1001353683 201
374 3300031995 Ga0307409_100969947 Ga0307409_1009699471 201
375 3300032002 Ga0307416_100121229 Ga0307416_1001212292 201
376 3300032126 Ga0307415_100009969 Ga0307415_1000099692 201
377 3300032126 Ga0307415_100102801 Ga0307415_1001028012 201
378 3300037418 Ga0395900_0892869 Ga0395900_0892869_93_722 201
379 3300044683 Ga0466965_0030832 Ga0466965_0030832_697_1323 201
380 3300044693 Ga0466961_0209088 Ga0466961_0209088_90_713 201
381 3300046515 Ga0495620_0225720 Ga0495620_0225720_64_696 201
382 3300048905 Ga0496102_0249120 Ga0496102_0249120_164_787 201
383 3300049571 Ga0501034_0018872 Ga0501034_0018872_771_1394 201
384 3300049571 Ga0501034_0334738 Ga0501034_0334738_184_810 201
385 3300049572 Ga0501036_0049964 Ga0501036_0049964_2908_3531 201
386 3300049573 Ga0501037_0067660 Ga0501037_0067660_177_800 201
387 3300049574 Ga0501038_0001498 Ga0501038_0001498_5296_5919 201
388 3300049579 Ga0501043_0093407 Ga0501043_0093407_375_995 201
389 3300049580 Ga0501046_0000573 Ga0501046_0000573_19859_20479 201
390 3300049581 Ga0501047_0063157 Ga0501047_0063157_1986_2609 201
391 3300049582 Ga0501048_0263912 Ga0501048_0263912_12_635 201
392 3300049583 Ga0501067_0040100 Ga0501067_0040100_417_1040 201
393 3300049589 Ga0501073_0087972 Ga0501073_0087972_789_1412 201
394 3300049591 Ga0501075_0756961 Ga0501075_0756961_40_666 201
395 3300049822 Ga0501035_0048613 Ga0501035_0048613_2977_3600 201
396 3300049823 Ga0501044_0022299 Ga0501044_0022299_3051_3674 201
397 3300050494 nmdc:mga06z11_43252_c1 nmdc:mga06z11_43252_c1_733_1362 201
398 3300050495 nmdc:mga04h51_19848_c1 nmdc:mga04h51_19848_c1_1142_1771 201
399 3300053104 Ga0500556_0001149 Ga0500556_0001149_7090_7713 201
400 3300053117 Ga0500593_001601 Ga0500593_001601_737_1360 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16321

Ribosom_S30AE_C

Sigma 54 modulation/S30EA ribosomal protein C terminus

176

231

0.97

PF02482

Ribosomal_S30AE

Sigma 54 modulation protein / S30EA ribosomal protein

36

132

0.88

Feature Viewer

pLDDT pTM Quality
71.58 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map