F434283

General Info

Members Datasets Scaffolds Average Seq Length
399 210 798 325

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10214917|Ga0105242_102149172
Length 394
Sequence VIDGKGDPATQHRDREHPDGDAGEETSAKTRLDHGKPSLLPPFVLVRRSRGDRFSRWIVGPTEYSHRPMATTHRPDTLARERAHELVRSWDGRPGALGPLLGRVSSVDQVGVEERVDSLKKRSIKKASKLWALDLAIRMIDLTTLEGKDTPGKIRALAAKAIHPQPGDPSIPSVAALCVYPALVEEAKDALKGSTVKVASVATGFPSGQTFRDIKIAETRAAAEAGADEIDMVIDRGAFLRGDYLTVFEEIVDVKEACGDAHLKVILETGELETYDNVRRASVLAMAAGADFIKTSTGKVQPAATLPVTLVMFEAARDFERQTGRQVGIKPAGGIRTAKESIQYLVVLYETLGPRWMTPDYFRFGASSLLNDVLMQIEKERTGRYQGPDHFTLD

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
106 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
107 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
138 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
139 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
206 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
207 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
208 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
209 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
210 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 0
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.77
Rhizosphere 90.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10214917 3300009176 Bacteria 1715
2 JGI25406J46586_10012138 3300003203 Bacteria 3748
3 JGI26129J50193_1001839 3300003349 Bacteria 1472
4 Ga0070658_10001223 3300005327 Bacteria 22027
5 Ga0070690_100031800 3300005330 Bacteria 3291
6 Ga0070670_100097111 3300005331 Bacteria 2534
7 Ga0070680_100042300 3300005336 Bacteria 3697
8 Ga0070682_100029097 3300005337 Bacteria 3325
9 Ga0068868_100125783 3300005338 Bacteria 2094
10 Ga0070660_100090385 3300005339 Bacteria 2414
11 Ga0070660_100107798 3300005339 Bacteria 2213
12 Ga0070689_100047407 3300005340 Bacteria 3313
13 Ga0070687_100004371 3300005343 Bacteria 5628
14 Ga0070687_100021000 3300005343 Bacteria 3062
15 Ga0070687_100023570 3300005343 Bacteria 2927
16 Ga0070692_10016677 3300005345 Bacteria 3498
17 Ga0070675_100057039 3300005354 Bacteria 3219
18 Ga0070675_100150812 3300005354 Bacteria 1993
19 Ga0070674_100016183 3300005356 Bacteria 4674
20 Ga0070688_100060866 3300005365 Bacteria 2385
21 Ga0070701_10148886 3300005438 Bacteria 1346
22 Ga0070705_100006408 3300005440 Bacteria 5770
23 Ga0070705_100244627 3300005440 Bacteria 1256
24 Ga0070700_100009032 3300005441 Bacteria 5459
25 Ga0070694_100010065 3300005444 Bacteria 5815
26 Ga0070694_100010236 3300005444 Bacteria 5776
27 Ga0070708_100005873 3300005445 Bacteria 9746
28 Ga0070708_100054655 3300005445 Bacteria 3547
29 Ga0070663_100031061 3300005455 Bacteria 3667
30 Ga0070681_10006588 3300005458 Bacteria 11311
31 Ga0068867_100012037 3300005459 Bacteria 6109
32 Ga0070706_100000807 3300005467 Bacteria 34728
33 Ga0070706_100007393 3300005467 Bacteria 10303
34 Ga0070706_100028111 3300005467 Bacteria 5176
35 Ga0070707_100001258 3300005468 Bacteria 24917
36 Ga0070707_100002398 3300005468 Bacteria 17889
37 Ga0070707_100011957 3300005468 Bacteria 8099
38 Ga0070707_100060919 3300005468 Bacteria 3619
39 Ga0070707_100286170 3300005468 Bacteria 1602
40 Ga0070698_100003360 3300005471 Bacteria 17612
41 Ga0070698_100014169 3300005471 Bacteria 8428
42 Ga0070699_100003964 3300005518 Bacteria 13085
43 Ga0070699_100238158 3300005518 Bacteria 1623
44 Ga0070679_100112662 3300005530 Bacteria 2706
45 Ga0070679_100386740 3300005530 Bacteria 1345
46 Ga0070684_100012051 3300005535 Bacteria 6912
47 Ga0070697_100010422 3300005536 Bacteria 7254
48 Ga0070697_100011069 3300005536 Bacteria 7049
49 Ga0070697_100108319 3300005536 Bacteria 2313
50 Ga0068853_100181518 3300005539 Bacteria 1909
51 Ga0070686_100007645 3300005544 Bacteria 6039
52 Ga0070686_100037764 3300005544 Bacteria 2997
53 Ga0070686_100235737 3300005544 Bacteria 1330
54 Ga0070695_100006038 3300005545 Bacteria 7153
55 Ga0070695_100008709 3300005545 Bacteria 6029
56 Ga0070696_100002049 3300005546 Bacteria 13211
57 Ga0070696_100005819 3300005546 Bacteria 8227
58 Ga0070696_100026804 3300005546 Bacteria 3922
59 Ga0070696_100029080 3300005546 Bacteria 3773
60 Ga0070696_100063256 3300005546 Bacteria 2592
61 Ga0070704_100007699 3300005549 Bacteria 6420
62 Ga0070704_100093143 3300005549 Bacteria 2251
63 Ga0068855_100011359 3300005563 Bacteria 10751
64 Ga0068855_100272480 3300005563 Bacteria 1882
65 Ga0068854_100066094 3300005578 Bacteria 2631
66 Ga0068854_100191515 3300005578 Bacteria 1603
67 Ga0070702_100127625 3300005615 Bacteria 1602
68 Ga0068859_100093244 3300005617 Bacteria 3063
69 Ga0068864_100104597 3300005618 Bacteria 2515
70 Ga0068863_100000632 3300005841 Bacteria 35693
71 Ga0068858_100008772 3300005842 Bacteria 9698
72 Ga0068860_100364311 3300005843 Bacteria 1425
73 Ga0068862_100052221 3300005844 Bacteria 3497
74 Ga0081539_10000320 3300005985 Bacteria 106935
75 Ga0081539_10000675 3300005985 Bacteria 68421
76 Ga0081539_10012445 3300005985 Bacteria 6558
77 Ga0075428_100000323 3300006844 Bacteria 47418
78 Ga0075428_100338551 3300006844 Bacteria 1616
79 Ga0075431_100178230 3300006847 Bacteria 2182
80 Ga0075433_10007103 3300006852 Bacteria 8867
81 Ga0075433_10086832 3300006852 Bacteria 2763
82 Ga0075434_100319337 3300006871 Bacteria 1573
83 Ga0075429_100027722 3300006880 Bacteria 4916
84 Ga0075429_100047858 3300006880 Bacteria 3719
85 Ga0068865_100007632 3300006881 Bacteria 6661
86 Ga0097620_100093241 3300006931 Bacteria 3063
87 Ga0111539_10147885 3300009094 Bacteria 2750
88 Ga0111539_10159591 3300009094 Bacteria 2638
89 Ga0105245_10168904 3300009098 Bacteria 2081
90 Ga0105245_10232185 3300009098 Bacteria 1785
91 Ga0105247_10001344 3300009101 Bacteria 17865
92 Ga0114129_10000011 3300009147 Bacteria 139000
93 Ga0114129_10000680 3300009147 Bacteria 42864
94 Ga0114129_10067311 3300009147 Bacteria 4995
95 Ga0114129_10094626 3300009147 Bacteria 4137
96 Ga0114129_10145067 3300009147 Bacteria 3252
97 Ga0114129_10274801 3300009147 Bacteria 2253
98 Ga0114129_10301063 3300009147 Bacteria 2137
99 Ga0114129_10549666 3300009147 Bacteria 1502
100 Ga0105243_10003114 3300009148 Bacteria 13625
101 Ga0105243_10097621 3300009148 Bacteria 2432
102 Ga0105243_10185307 3300009148 Bacteria 1813
103 Ga0105248_10130665 3300009177 Bacteria 2833
104 Ga0105237_10033077 3300009545 Bacteria 5238
105 Ga0105238_10144003 3300009551 Bacteria 2360
106 Ga0105249_10001728 3300009553 Bacteria 19117
107 Ga0105249_10028929 3300009553 Bacteria 5002
108 Ga0105249_10082269 3300009553 Bacteria 2996
109 Ga0105249_10129444 3300009553 Bacteria 2408
110 Ga0105239_10216892 3300010375 Bacteria 2145
111 Ga0157374_10511738 3300013296 Bacteria 1206
112 Ga0157378_10097907 3300013297 Bacteria 2674
113 Ga0157378_10139616 3300013297 Bacteria 2249
114 Ga0157378_10180017 3300013297 Bacteria 1988
115 Ga0163162_10133625 3300013306 Bacteria 2591
116 Ga0163162_10366849 3300013306 Bacteria 1573
117 Ga0157375_10010205 3300013308 Bacteria 8265
118 Ga0157380_10008676 3300014326 Bacteria 7265
119 Ga0157380_10210331 3300014326 Bacteria 1733
120 Ga0157380_10254346 3300014326 Bacteria 1592
121 Ga0157379_10346573 3300014968 Bacteria 1359
122 Ga0163161_10054272 3300017792 Bacteria 2908
123 Ga0207688_10001007 3300025901 Bacteria 14347
124 Ga0207705_10016639 3300025909 Bacteria 5267
125 Ga0207684_10000862 3300025910 Bacteria 34728
126 Ga0207684_10002316 3300025910 Bacteria 19331
127 Ga0207684_10035154 3300025910 Bacteria 4255
128 Ga0207684_10196001 3300025910 Bacteria 1742
129 Ga0207660_10000001 3300025917 Bacteria 1034169
130 Ga0207660_10232774 3300025917 Bacteria 1449
131 Ga0207662_10001417 3300025918 Bacteria 11621
132 Ga0207657_10096862 3300025919 Bacteria 2454
133 Ga0207652_10233532 3300025921 Bacteria 1658
134 Ga0207652_10258902 3300025921 Bacteria 1569
135 Ga0207646_10003423 3300025922 Bacteria 17923
136 Ga0207646_10005096 3300025922 Bacteria 13942
137 Ga0207646_10013135 3300025922 Bacteria 7927
138 Ga0207646_10016904 3300025922 Bacteria 6836
139 Ga0207646_10161602 3300025922 Bacteria 2021
140 Ga0207646_10195986 3300025922 Bacteria 1824
141 Ga0207646_10214661 3300025922 Bacteria 1738
142 Ga0207694_10279011 3300025924 Bacteria 1372
143 Ga0207659_10085795 3300025926 Bacteria 2340
144 Ga0207659_10101126 3300025926 Bacteria 2173
145 Ga0207659_10117696 3300025926 Bacteria 2031
146 Ga0207687_10199587 3300025927 Bacteria 1562
147 Ga0207690_10150446 3300025932 Bacteria 1725
148 Ga0207669_10094311 3300025937 Bacteria 1958
149 Ga0207669_10152215 3300025937 Bacteria 1622
150 Ga0207669_10182024 3300025937 Bacteria 1508
151 Ga0207704_10142225 3300025938 Bacteria 1680
152 Ga0207711_10314852 3300025941 Bacteria 1445
153 Ga0207661_10160469 3300025944 Bacteria 1950
154 Ga0207667_10190605 3300025949 Bacteria 2104
155 Ga0207651_10253539 3300025960 Bacteria 1441
156 Ga0207640_10114161 3300025981 Bacteria 1921
157 Ga0207677_10245759 3300026023 Bacteria 1450
158 Ga0207639_10203075 3300026041 Bacteria 1701
159 Ga0207678_10000485 3300026067 Bacteria 36039
160 Ga0207678_10004099 3300026067 Bacteria 13103
161 Ga0207708_10014743 3300026075 Bacteria 5849
162 Ga0207708_10135773 3300026075 Bacteria 1926
163 Ga0207708_10401516 3300026075 Bacteria 1133
164 Ga0207702_10207585 3300026078 Bacteria 1819
165 Ga0207648_10002169 3300026089 Bacteria 21333
166 Ga0207676_10243255 3300026095 Bacteria 1615
167 Ga0207676_10295012 3300026095 Bacteria 1478
168 Ga0207676_10408451 3300026095 Bacteria 1271
169 Ga0207674_10007007 3300026116 Bacteria 13175
170 Ga0207675_100169907 3300026118 Bacteria 2084
171 Ga0209971_1012363 3300027682 Bacteria 2020
172 Ga0209998_10002999 3300027717 Bacteria 3756
173 Ga0209998_10016214 3300027717 Bacteria 1567
174 Ga0209974_10003548 3300027876 Bacteria 5611
175 Ga0209974_10005622 3300027876 Bacteria 4400
176 Ga0207428_10125252 3300027907 Bacteria 1968
177 Ga0268266_10117540 3300028379 Bacteria 2363
178 Ga0268264_10112459 3300028381 Bacteria 2387
179 Ga0268264_10339613 3300028381 Bacteria 1426
180 Ga0265337_1006161 3300028556 Bacteria 4664
181 Ga0265319_1001900 3300028563 Bacteria 11866
182 Ga0265319_1011314 3300028563 Bacteria 3660
183 Ga0265319_1028189 3300028563 Bacteria 1982
184 Ga0265334_10069287 3300028573 Bacteria 1317
185 Ga0265336_10004413 3300028666 Bacteria 5329
186 Ga0307515_10069353 3300028794 Bacteria 4821
187 Ga0265338_10023037 3300028800 Bacteria 6418
188 Ga0265338_10118256 3300028800 Bacteria 2118
189 Ga0265338_10198917 3300028800 Bacteria 1512
190 Ga0265324_10009627 3300029957 Bacteria 3763
191 Ga0265320_10003406 3300031240 Bacteria 10703
192 Ga0265325_10021224 3300031241 Bacteria 3572
193 Ga0265329_10020592 3300031242 Bacteria 2226
194 Ga0265340_10004044 3300031247 Bacteria 8239
195 Ga0265340_10005237 3300031247 Bacteria 7199
196 Ga0265340_10056520 3300031247 Bacteria 1887
197 Ga0265339_10055625 3300031249 Bacteria 2145
198 Ga0265316_10016052 3300031344 Bacteria 6515
199 Ga0265316_10084186 3300031344 Bacteria 2436
200 Ga0265313_10051546 3300031595 Bacteria 1969
201 Ga0265314_10006150 3300031711 Bacteria 10668
202 Ga0265342_10013763 3300031712 Bacteria 5404
203 Ga0307405_10189827 3300031731 Bacteria 1483
204 Ga0307410_10148336 3300031852 Bacteria 1743
205 Ga0307410_10171742 3300031852 Bacteria 1634
206 Ga0307406_10010063 3300031901 Bacteria 5323
207 Ga0307406_10052001 3300031901 Bacteria 2604
208 Ga0307407_10045920 3300031903 Bacteria 2471
209 Ga0307409_100001599 3300031995 Bacteria 11328
210 Ga0307409_100143959 3300031995 Bacteria 2058
211 Ga0307416_100015846 3300032002 Bacteria 5220
212 Ga0307416_100072556 3300032002 Bacteria 2866
213 Ga0307414_10165333 3300032004 Bacteria 1763
214 Ga0307415_100000215 3300032126 Bacteria 25330
215 Ga0307415_100049957 3300032126 Bacteria 2831
216 Ga0307415_100150766 3300032126 Bacteria 1789
217 Ga0307415_100186497 3300032126 Bacteria 1633
218 Ga0307510_10128711 3300033180 Bacteria 2212
219 Ga0373953_0020825 3300035117 Bacteria 2454
220 Ga0373946_0084988 3300035171 Bacteria 1393
221 Ga0373935_0178239 3300035692 Bacteria 1458
222 Ga0373937_0120574 3300036401 Bacteria 2444
223 Ga0373937_0194841 3300036401 Bacteria 1904
224 Ga0373925_0143822 3300037068 Bacteria 1868
225 Ga0395900_0023854 3300037418 Bacteria 6260
226 Ga0395905_0434888 3300037471 Bacteria 1209
227 Ga0439441_006214 3300042001 Bacteria 1886
228 Ga0439441_016882 3300042001 Bacteria 1306
229 Ga0450923_002619 3300042125 Bacteria 2606
230 Ga0450910_001338 3300042147 Bacteria 3088
231 Ga0466963_0064306 3300044694 Bacteria 2457
232 Ga0466960_0014461 3300044901 Bacteria 3379
233 Ga0451576_0099805 3300045051 Bacteria 3020
234 Ga0451576_0137701 3300045051 Bacteria 2546
235 Ga0466967_0120334 3300045976 Bacteria 2425
236 Ga0466967_0190798 3300045976 Bacteria 1936
237 Ga0495651_0029549 3300046462 Bacteria 4275
238 Ga0495599_0104472 3300046678 Bacteria 1764
239 Ga0495589_0121092 3300046794 Bacteria 1260
240 Ga0495674_0026248 3300047319 Bacteria 5332
241 Ga0495674_0343343 3300047319 Bacteria 1213
242 Ga0495684_0010914 3300047471 Bacteria 7022
243 Ga0496101_0056249 3300048904 Bacteria 2844
244 Ga0496101_0106129 3300048904 Bacteria 2109
245 Ga0496102_0004350 3300048905 Bacteria 11972
246 Ga0496103_0007788 3300048906 Bacteria 6368
247 Ga0496103_0026694 3300048906 Bacteria 3496
248 Ga0496103_0304379 3300048906 Bacteria 1025
249 Ga0496104_0113333 3300048907 Bacteria 2600
250 Ga0496104_0256958 3300048907 Bacteria 1660
251 Ga0496105_0002808 3300048908 Bacteria 12732
252 Ga0496106_0010437 3300048909 Bacteria 6860
253 Ga0496107_0033055 3300048910 Bacteria 3700
254 Ga0496107_0041085 3300048910 Bacteria 3321
255 Ga0496107_0161947 3300048910 Bacteria 1658
256 Ga0496108_0001259 3300048911 Bacteria 19811
257 Ga0496108_0002549 3300048911 Bacteria 14588
258 Ga0496108_0015984 3300048911 Bacteria 6118
259 Ga0496108_0127499 3300048911 Bacteria 2186
260 Ga0496108_0183989 3300048911 Bacteria 1810
261 Ga0496109_0004364 3300048912 Bacteria 11820
262 Ga0496109_0013945 3300048912 Bacteria 6989
263 Ga0496109_0174070 3300048912 Bacteria 2020
264 Ga0496109_0208730 3300048912 Bacteria 1837
265 Ga0496110_0020008 3300048913 Bacteria 5644
266 Ga0496110_0024735 3300048913 Bacteria 5122
267 Ga0496110_0028510 3300048913 Bacteria 4796
268 Ga0496111_0012720 3300048914 Bacteria 5705
269 Ga0496111_0083644 3300048914 Bacteria 2332
270 Ga0496111_0103302 3300048914 Bacteria 2096
271 Ga0496112_0000075 3300048915 Bacteria 65390
272 Ga0496112_0007597 3300048915 Bacteria 9634
273 Ga0496112_0038918 3300048915 Bacteria 4645
274 Ga0496114_0000182 3300048917 Bacteria 45024
275 Ga0496114_0191066 3300048917 Bacteria 1792
276 Ga0496114_0198037 3300048917 Bacteria 1759
277 Ga0496114_0386773 3300048917 Bacteria 1239
278 Ga0501031_0027827 3300049568 Bacteria 3685
279 Ga0501031_0052769 3300049568 Bacteria 2649
280 Ga0501031_0115214 3300049568 Bacteria 1756
281 Ga0501033_0195158 3300049570 Bacteria 1448
282 Ga0501036_0005554 3300049572 Bacteria 10228
283 Ga0501036_0016870 3300049572 Bacteria 6101
284 Ga0501036_0036563 3300049572 Bacteria 4155
285 Ga0501036_0196470 3300049572 Bacteria 1697
286 Ga0501038_0003742 3300049574 Bacteria 14166
287 Ga0501038_0084145 3300049574 Bacteria 2677
288 Ga0501038_0333265 3300049574 Bacteria 1185
289 Ga0501039_0001474 3300049575 Bacteria 17299
290 Ga0501039_0169426 3300049575 Bacteria 1717
291 Ga0501039_0256157 3300049575 Bacteria 1376
292 Ga0501040_0002830 3300049576 Bacteria 11199
293 Ga0501040_0018454 3300049576 Bacteria 4631
294 Ga0501040_0091293 3300049576 Bacteria 2117
295 Ga0501040_0133983 3300049576 Bacteria 1743
296 Ga0501041_0000649 3300049577 Bacteria 18259
297 Ga0501041_0044761 3300049577 Bacteria 2690
298 Ga0501041_0089822 3300049577 Bacteria 1897
299 Ga0501041_0238433 3300049577 Bacteria 1143
300 Ga0501042_0003364 3300049578 Bacteria 10028
301 Ga0501042_0003864 3300049578 Bacteria 9471
302 Ga0501042_0061164 3300049578 Bacteria 2691
303 Ga0501046_0032747 3300049580 Bacteria 4206
304 Ga0501046_0205531 3300049580 Bacteria 1464
305 Ga0501047_0138739 3300049581 Bacteria 2310
306 Ga0501048_0001937 3300049582 Bacteria 15713
307 Ga0501048_0011878 3300049582 Bacteria 6493
308 Ga0501067_0012599 3300049583 Bacteria 4692
309 Ga0501067_0076947 3300049583 Bacteria 1849
310 Ga0501068_0027060 3300049584 Bacteria 3384
311 Ga0501068_0031411 3300049584 Bacteria 3154
312 Ga0501069_0018905 3300049585 Bacteria 3720
313 Ga0501069_0042946 3300049585 Bacteria 2502
314 Ga0501070_0073560 3300049586 Bacteria 2828
315 Ga0501071_0003811 3300049587 Bacteria 9482
316 Ga0501071_0004837 3300049587 Bacteria 8583
317 Ga0501071_0043016 3300049587 Bacteria 3238
318 Ga0501071_0070635 3300049587 Bacteria 2544
319 Ga0501071_0094816 3300049587 Bacteria 2196
320 Ga0501072_0001114 3300049588 Bacteria 20008
321 Ga0501072_0009312 3300049588 Bacteria 7465
322 Ga0501072_0011373 3300049588 Bacteria 6802
323 Ga0501072_0132019 3300049588 Bacteria 1991
324 Ga0501072_0408547 3300049588 Bacteria 1077
325 Ga0501073_0152617 3300049589 Bacteria 1601
326 Ga0501074_0002176 3300049590 Bacteria 13584
327 Ga0501074_0265858 3300049590 Bacteria 1219
328 Ga0501075_0020313 3300049591 Bacteria 4829
329 Ga0501075_0180319 3300049591 Bacteria 1611
330 Ga0501075_0246460 3300049591 Bacteria 1362
331 Ga0501076_0000792 3300049592 Bacteria 20438
332 Ga0501076_0001173 3300049592 Bacteria 17361
333 Ga0501076_0004540 3300049592 Bacteria 9888
334 Ga0501076_0032514 3300049592 Bacteria 4072
335 Ga0501076_0098902 3300049592 Bacteria 2350
336 Ga0501076_0108730 3300049592 Bacteria 2240
337 Ga0501076_0129960 3300049592 Bacteria 2042
338 Ga0501077_0047169 3300049593 Bacteria 2737
339 Ga0501077_0051255 3300049593 Bacteria 2623
340 Ga0501077_0158720 3300049593 Bacteria 1436
341 Ga0501077_0165340 3300049593 Bacteria 1405
342 Ga0501079_0007920 3300049741 Bacteria 8055
343 Ga0501079_0014192 3300049741 Bacteria 6074
344 Ga0501079_0068087 3300049741 Bacteria 2748
345 Ga0501079_0299722 3300049741 Bacteria 1258
346 Ga0501080_0001349 3300049742 Bacteria 20509
347 Ga0501080_0004379 3300049742 Bacteria 12538
348 Ga0501080_0102973 3300049742 Bacteria 2648
349 Ga0501081_0007423 3300049743 Bacteria 7113
350 Ga0501081_0013221 3300049743 Bacteria 5428
351 Ga0501081_0014983 3300049743 Bacteria 5116
352 Ga0501081_0154700 3300049743 Bacteria 1649
353 Ga0501083_0132862 3300049744 Bacteria 1632
354 Ga0501035_0015329 3300049822 Bacteria 7074
355 Ga0501044_0089637 3300049823 Bacteria 3104
356 Ga0501045_0029685 3300049824 Bacteria 3953
357 Ga0501045_0030375 3300049824 Bacteria 3911
358 Ga0501045_0045285 3300049824 Bacteria 3203
359 Ga0501045_0238623 3300049824 Bacteria 1353
360 nmdc:mga05p37_306016_c1 3300050507 Bacteria 1886
361 nmdc:mga05p37_455850_c1 3300050507 Bacteria 1479
362 nmdc:mga05p37_600_c1 3300050507 Bacteria 39739
363 nmdc:mga09592_19357_c1 3300050508 Bacteria 5589
364 nmdc:mga06r32_139588_c1 3300050510 Bacteria 2399
365 nmdc:mga06r32_159809_c1 3300050510 Bacteria 2235
366 nmdc:mga06r32_315020_c1 3300050510 Bacteria 1550
367 nmdc:mga08y16_235220_c1 3300050511 Bacteria 1895
368 nmdc:mga0n895_131774_c1 3300050512 Bacteria 2525
369 nmdc:mga0n895_69169_c1 3300050512 Bacteria 3497
370 nmdc:mga0rr50_128304_c1 3300050513 Bacteria 2027
371 nmdc:mga0rr50_94177_c1 3300050513 Bacteria 2338
372 nmdc:mga0a205_55486_c1 3300050515 Bacteria 3827
373 Ga0495601_0024161 3300053077 Bacteria 3741
374 Ga0495595_0050650 3300053084 Bacteria 1924
375 Ga0495619_0019123 3300053085 Bacteria 4353
376 Ga0501084_0014619 3300054114 Bacteria 6506
377 Ga0501084_0026817 3300054114 Bacteria 4812
378 Ga0501084_0048054 3300054114 Bacteria 3573
379 Ga0501084_0130828 3300054114 Bacteria 2112
380 Ga0501084_0143460 3300054114 Bacteria 2011
381 Ga0501084_0194272 3300054114 Bacteria 1712
382 Ga0501084_0343748 3300054114 Bacteria 1260
383 Ga0590075_001471 3300059424 Bacteria 5884
384 Ga0501082_0010763 3300060353 Bacteria 7876
385 Ga0501082_0012199 3300060353 Bacteria 7384
386 Ga0501082_0027742 3300060353 Bacteria 4875
387 Ga0501082_0087531 3300060353 Bacteria 2687
388 Ga0501082_0182752 3300060353 Bacteria 1824
389 Ga0501082_0261964 3300060353 Bacteria 1504
390 Ga0466962_0139745 3300061719 Bacteria 1173
391 Ga0530510_0004255 3300061734 Bacteria 9900
392 Ga0530510_0013450 3300061734 Bacteria 5754
393 Ga0530510_0048559 3300061734 Bacteria 3068
394 Ga0530510_0077901 3300061734 Bacteria 2409
395 2623502241 2622736605 Bacteria 4992138
396 2644461961 2643221682 Bacteria 6743283
397 2819695038 2818991463 Bacteria 7948711
398 8003323266 8003314358 Bacteria 10575343
399 8053945869 8053945823 Bacteria 8962862
400 Ga0105242_10214917
401 JGI25406J46586_10012138
402 JGI26129J50193_1001839
403 Ga0070658_10001223
404 Ga0070690_100031800
405 Ga0070670_100097111
406 Ga0070680_100042300
407 Ga0070682_100029097
408 Ga0068868_100125783
409 Ga0070660_100090385
410 Ga0070660_100107798
411 Ga0070689_100047407
412 Ga0070687_100004371
413 Ga0070687_100021000
414 Ga0070687_100023570
415 Ga0070692_10016677
416 Ga0070675_100057039
417 Ga0070675_100150812
418 Ga0070674_100016183
419 Ga0070688_100060866
420 Ga0070701_10148886
421 Ga0070705_100006408
422 Ga0070705_100244627
423 Ga0070700_100009032
424 Ga0070694_100010065
425 Ga0070694_100010236
426 Ga0070708_100005873
427 Ga0070708_100054655
428 Ga0070663_100031061
429 Ga0070681_10006588
430 Ga0068867_100012037
431 Ga0070706_100000807
432 Ga0070706_100007393
433 Ga0070706_100028111
434 Ga0070707_100001258
435 Ga0070707_100002398
436 Ga0070707_100011957
437 Ga0070707_100060919
438 Ga0070707_100286170
439 Ga0070698_100003360
440 Ga0070698_100014169
441 Ga0070699_100003964
442 Ga0070699_100238158
443 Ga0070679_100112662
444 Ga0070679_100386740
445 Ga0070684_100012051
446 Ga0070697_100010422
447 Ga0070697_100011069
448 Ga0070697_100108319
449 Ga0068853_100181518
450 Ga0070686_100007645
451 Ga0070686_100037764
452 Ga0070686_100235737
453 Ga0070695_100006038
454 Ga0070695_100008709
455 Ga0070696_100002049
456 Ga0070696_100005819
457 Ga0070696_100026804
458 Ga0070696_100029080
459 Ga0070696_100063256
460 Ga0070704_100007699
461 Ga0070704_100093143
462 Ga0068855_100011359
463 Ga0068855_100272480
464 Ga0068854_100066094
465 Ga0068854_100191515
466 Ga0070702_100127625
467 Ga0068859_100093244
468 Ga0068864_100104597
469 Ga0068863_100000632
470 Ga0068858_100008772
471 Ga0068860_100364311
472 Ga0068862_100052221
473 Ga0081539_10000320
474 Ga0081539_10000675
475 Ga0081539_10012445
476 Ga0075428_100000323
477 Ga0075428_100338551
478 Ga0075431_100178230
479 Ga0075433_10007103
480 Ga0075433_10086832
481 Ga0075434_100319337
482 Ga0075429_100027722
483 Ga0075429_100047858
484 Ga0068865_100007632
485 Ga0097620_100093241
486 Ga0111539_10147885
487 Ga0111539_10159591
488 Ga0105245_10168904
489 Ga0105245_10232185
490 Ga0105247_10001344
491 Ga0114129_10000011
492 Ga0114129_10000680
493 Ga0114129_10067311
494 Ga0114129_10094626
495 Ga0114129_10145067
496 Ga0114129_10274801
497 Ga0114129_10301063
498 Ga0114129_10549666
499 Ga0105243_10003114
500 Ga0105243_10097621
501 Ga0105243_10185307
502 Ga0105248_10130665
503 Ga0105237_10033077
504 Ga0105238_10144003
505 Ga0105249_10001728
506 Ga0105249_10028929
507 Ga0105249_10082269
508 Ga0105249_10129444
509 Ga0105239_10216892
510 Ga0157374_10511738
511 Ga0157378_10097907
512 Ga0157378_10139616
513 Ga0157378_10180017
514 Ga0163162_10133625
515 Ga0163162_10366849
516 Ga0157375_10010205
517 Ga0157380_10008676
518 Ga0157380_10210331
519 Ga0157380_10254346
520 Ga0157379_10346573
521 Ga0163161_10054272
522 Ga0207688_10001007
523 Ga0207705_10016639
524 Ga0207684_10000862
525 Ga0207684_10002316
526 Ga0207684_10035154
527 Ga0207684_10196001
528 Ga0207660_10000001
529 Ga0207660_10232774
530 Ga0207662_10001417
531 Ga0207657_10096862
532 Ga0207652_10233532
533 Ga0207652_10258902
534 Ga0207646_10003423
535 Ga0207646_10005096
536 Ga0207646_10013135
537 Ga0207646_10016904
538 Ga0207646_10161602
539 Ga0207646_10195986
540 Ga0207646_10214661
541 Ga0207694_10279011
542 Ga0207659_10085795
543 Ga0207659_10101126
544 Ga0207659_10117696
545 Ga0207687_10199587
546 Ga0207690_10150446
547 Ga0207669_10094311
548 Ga0207669_10152215
549 Ga0207669_10182024
550 Ga0207704_10142225
551 Ga0207711_10314852
552 Ga0207661_10160469
553 Ga0207667_10190605
554 Ga0207651_10253539
555 Ga0207640_10114161
556 Ga0207677_10245759
557 Ga0207639_10203075
558 Ga0207678_10000485
559 Ga0207678_10004099
560 Ga0207708_10014743
561 Ga0207708_10135773
562 Ga0207708_10401516
563 Ga0207702_10207585
564 Ga0207648_10002169
565 Ga0207676_10243255
566 Ga0207676_10295012
567 Ga0207676_10408451
568 Ga0207674_10007007
569 Ga0207675_100169907
570 Ga0209971_1012363
571 Ga0209998_10002999
572 Ga0209998_10016214
573 Ga0209974_10003548
574 Ga0209974_10005622
575 Ga0207428_10125252
576 Ga0268266_10117540
577 Ga0268264_10112459
578 Ga0268264_10339613
579 Ga0265337_1006161
580 Ga0265319_1001900
581 Ga0265319_1011314
582 Ga0265319_1028189
583 Ga0265334_10069287
584 Ga0265336_10004413
585 Ga0307515_10069353
586 Ga0265338_10023037
587 Ga0265338_10118256
588 Ga0265338_10198917
589 Ga0265324_10009627
590 Ga0265320_10003406
591 Ga0265325_10021224
592 Ga0265329_10020592
593 Ga0265340_10004044
594 Ga0265340_10005237
595 Ga0265340_10056520
596 Ga0265339_10055625
597 Ga0265316_10016052
598 Ga0265316_10084186
599 Ga0265313_10051546
600 Ga0265314_10006150
601 Ga0265342_10013763
602 Ga0307405_10189827
603 Ga0307410_10148336
604 Ga0307410_10171742
605 Ga0307406_10010063
606 Ga0307406_10052001
607 Ga0307407_10045920
608 Ga0307409_100001599
609 Ga0307409_100143959
610 Ga0307416_100015846
611 Ga0307416_100072556
612 Ga0307414_10165333
613 Ga0307415_100000215
614 Ga0307415_100049957
615 Ga0307415_100150766
616 Ga0307415_100186497
617 Ga0307510_10128711
618 Ga0373953_0020825
619 Ga0373946_0084988
620 Ga0373935_0178239
621 Ga0373937_0120574
622 Ga0373937_0194841
623 Ga0373925_0143822
624 Ga0395900_0023854
625 Ga0395905_0434888
626 Ga0439441_006214
627 Ga0439441_016882
628 Ga0450923_002619
629 Ga0450910_001338
630 Ga0466963_0064306
631 Ga0466960_0014461
632 Ga0451576_0099805
633 Ga0451576_0137701
634 Ga0466967_0120334
635 Ga0466967_0190798
636 Ga0495651_0029549
637 Ga0495599_0104472
638 Ga0495589_0121092
639 Ga0495674_0026248
640 Ga0495674_0343343
641 Ga0495684_0010914
642 Ga0496101_0056249
643 Ga0496101_0106129
644 Ga0496102_0004350
645 Ga0496103_0007788
646 Ga0496103_0026694
647 Ga0496103_0304379
648 Ga0496104_0113333
649 Ga0496104_0256958
650 Ga0496105_0002808
651 Ga0496106_0010437
652 Ga0496107_0033055
653 Ga0496107_0041085
654 Ga0496107_0161947
655 Ga0496108_0001259
656 Ga0496108_0002549
657 Ga0496108_0015984
658 Ga0496108_0127499
659 Ga0496108_0183989
660 Ga0496109_0004364
661 Ga0496109_0013945
662 Ga0496109_0174070
663 Ga0496109_0208730
664 Ga0496110_0020008
665 Ga0496110_0024735
666 Ga0496110_0028510
667 Ga0496111_0012720
668 Ga0496111_0083644
669 Ga0496111_0103302
670 Ga0496112_0000075
671 Ga0496112_0007597
672 Ga0496112_0038918
673 Ga0496114_0000182
674 Ga0496114_0191066
675 Ga0496114_0198037
676 Ga0496114_0386773
677 Ga0501031_0027827
678 Ga0501031_0052769
679 Ga0501031_0115214
680 Ga0501033_0195158
681 Ga0501036_0005554
682 Ga0501036_0016870
683 Ga0501036_0036563
684 Ga0501036_0196470
685 Ga0501038_0003742
686 Ga0501038_0084145
687 Ga0501038_0333265
688 Ga0501039_0001474
689 Ga0501039_0169426
690 Ga0501039_0256157
691 Ga0501040_0002830
692 Ga0501040_0018454
693 Ga0501040_0091293
694 Ga0501040_0133983
695 Ga0501041_0000649
696 Ga0501041_0044761
697 Ga0501041_0089822
698 Ga0501041_0238433
699 Ga0501042_0003364
700 Ga0501042_0003864
701 Ga0501042_0061164
702 Ga0501046_0032747
703 Ga0501046_0205531
704 Ga0501047_0138739
705 Ga0501048_0001937
706 Ga0501048_0011878
707 Ga0501067_0012599
708 Ga0501067_0076947
709 Ga0501068_0027060
710 Ga0501068_0031411
711 Ga0501069_0018905
712 Ga0501069_0042946
713 Ga0501070_0073560
714 Ga0501071_0003811
715 Ga0501071_0004837
716 Ga0501071_0043016
717 Ga0501071_0070635
718 Ga0501071_0094816
719 Ga0501072_0001114
720 Ga0501072_0009312
721 Ga0501072_0011373
722 Ga0501072_0132019
723 Ga0501072_0408547
724 Ga0501073_0152617
725 Ga0501074_0002176
726 Ga0501074_0265858
727 Ga0501075_0020313
728 Ga0501075_0180319
729 Ga0501075_0246460
730 Ga0501076_0000792
731 Ga0501076_0001173
732 Ga0501076_0004540
733 Ga0501076_0032514
734 Ga0501076_0098902
735 Ga0501076_0108730
736 Ga0501076_0129960
737 Ga0501077_0047169
738 Ga0501077_0051255
739 Ga0501077_0158720
740 Ga0501077_0165340
741 Ga0501079_0007920
742 Ga0501079_0014192
743 Ga0501079_0068087
744 Ga0501079_0299722
745 Ga0501080_0001349
746 Ga0501080_0004379
747 Ga0501080_0102973
748 Ga0501081_0007423
749 Ga0501081_0013221
750 Ga0501081_0014983
751 Ga0501081_0154700
752 Ga0501083_0132862
753 Ga0501035_0015329
754 Ga0501044_0089637
755 Ga0501045_0029685
756 Ga0501045_0030375
757 Ga0501045_0045285
758 Ga0501045_0238623
759 nmdc:mga05p37_306016_c1
760 nmdc:mga05p37_455850_c1
761 nmdc:mga05p37_600_c1
762 nmdc:mga09592_19357_c1
763 nmdc:mga06r32_139588_c1
764 nmdc:mga06r32_159809_c1
765 nmdc:mga06r32_315020_c1
766 nmdc:mga08y16_235220_c1
767 nmdc:mga0n895_131774_c1
768 nmdc:mga0n895_69169_c1
769 nmdc:mga0rr50_128304_c1
770 nmdc:mga0rr50_94177_c1
771 nmdc:mga0a205_55486_c1
772 Ga0495601_0024161
773 Ga0495595_0050650
774 Ga0495619_0019123
775 Ga0501084_0014619
776 Ga0501084_0026817
777 Ga0501084_0048054
778 Ga0501084_0130828
779 Ga0501084_0143460
780 Ga0501084_0194272
781 Ga0501084_0343748
782 Ga0590075_001471
783 Ga0501082_0010763
784 Ga0501082_0012199
785 Ga0501082_0027742
786 Ga0501082_0087531
787 Ga0501082_0182752
788 Ga0501082_0261964
789 Ga0466962_0139745
790 Ga0530510_0004255
791 Ga0530510_0013450
792 Ga0530510_0048559
793 Ga0530510_0077901
794 2623502241
795 2644461961
796 2819695038
797 8003323266
798 8053945869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01791

DeoC

DeoC/LacD family aldolase

135

373

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ub3-assembly1.cif.gz_D crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8 0.9554 68 306
5c6m-assembly2.cif.gz_C crystal structure of deoxyribose-phosphate aldolase from shewanella halifaxensis 0.9473 60 310
5c5y-assembly2.cif.gz_C crystal structure of deoxyribose-phosphate aldolase from colwellia psychrerythraea (hexagonal form) 0.9466 61 309
1ub3-assembly1.cif.gz_D crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8 0.9423 68 306
3npw-assembly2.cif.gz_B in silico designed of an improved kemp eliminase ke70 mutant by computational design and directed evolution 0.9388 61 306
ID Description Score Start End Superfamily
af_B0UYS4_42_315_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9744 61 320 3.20.20.70
1j2wC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9511 66 300 3.20.20.70
af_Q4DZ14_56_274_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9455 66 305 3.20.20.70
1jcjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9357 55 309 3.20.20.70
1mzhB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9289 68 313 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3D4ACB7-F1-model_v4 deoxyribose-phosphate aldolase (EC 4.1.2.4) (2-deoxy-D-ribose 5-phosphate aldolase) (Phosphodeoxyriboaldolase) 1.003 193 301 GO:0004139
GO:0005737
GO:0009264
GO:0016052
AF-A0A1B6DGS3-F1-model_v4 deoxyribose-phosphate aldolase (EC 4.1.2.4) (2-deoxy-D-ribose 5-phosphate aldolase) (Phosphodeoxyriboaldolase) 0.9988 180 285 GO:0004139
GO:0005737
GO:0009264
GO:0016052
GO:0046386
AF-A0A0R2XFJ5-F1-model_v4 Deoxyribose-phosphate aldolase (EC 4.1.2.4) 0.9943 35 307 GO:0004139
GO:0005737
GO:0009264
GO:0016052
AF-A0A2V7WH41-F1-model_v4 Deoxyribose-phosphate aldolase (EC 4.1.2.4) 0.9941 33 278 GO:0004139
GO:0005737
GO:0009264
GO:0016052
AF-A0A536KLT6-F1-model_v4 Deoxyribose-phosphate aldolase (EC 4.1.2.4) 0.9934 29 306 GO:0004139
GO:0005737
GO:0009264
GO:0016620

Map