F433988

General Info

Members Datasets Scaffolds Average Seq Length
398 224 796 174

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100103201|Ga0070708_1001032012
Length 171
Sequence VTVRSADDLRAKIREVPDFPKPGILFYDITTLLKDPDAFREVIDQMASAVDLVVGMESRGFIFSAPLAYQLHAGFVPVRKLGKLPAETIEVEYDLEYGTATLEVHKDAIKPGQRVLIVDDLLATGGTVQGTIELVQRLGGEIAGLSFMVELTGLHGREKLGDFQIHTLLTY

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
148 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
149 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
150 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
151 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
152 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
153 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
154 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
199 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.25
Rhizosphere 99.5
Stem 0
Stem Tuber 0
Unclassified 3.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100103201 3300005445 Bacteria 2614
2 MBSR1b_contig_5451366 2162886012 Bacteria 2060
3 JGI25406J46586_10003055 3300003203 Bacteria 7876
4 rootL2_10082742 3300003322 Bacteria 3050
5 Ga0065715_10097532 3300005293 Bacteria 3691
6 Ga0065707_10106449 3300005295 Bacteria 2596
7 Ga0070676_10079361 3300005328 Unclassified 1987
8 Ga0070676_10406081 3300005328 Bacteria 949
9 Ga0070683_100082017 3300005329 Bacteria 3020
10 Ga0070670_101503549 3300005331 Bacteria 618
11 Ga0070666_10238754 3300005335 Bacteria 1285
12 Ga0070660_100825541 3300005339 Bacteria 780
13 Ga0070689_100853430 3300005340 Unclassified 803
14 Ga0070675_101470342 3300005354 Bacteria 628
15 Ga0070674_100202222 3300005356 Bacteria 1535
16 Ga0070688_100101963 3300005365 Bacteria 1894
17 Ga0070659_100011008 3300005366 Bacteria 6680
18 Ga0070659_100032980 3300005366 Bacteria 4022
19 Ga0070714_100000988 3300005435 Bacteria 20321
20 Ga0070705_100003953 3300005440 Bacteria 7246
21 Ga0070700_100137619 3300005441 Bacteria 1656
22 Ga0070700_100155879 3300005441 Bacteria 1567
23 Ga0070694_100370065 3300005444 Bacteria 1115
24 Ga0070708_100001552 3300005445 Bacteria 17598
25 Ga0070708_100220726 3300005445 Bacteria 1778
26 Ga0070678_100034340 3300005456 Bacteria 3531
27 Ga0070662_100049334 3300005457 Unclassified 3035
28 Ga0070662_100447533 3300005457 Bacteria 1072
29 Ga0070681_10020669 3300005458 Bacteria 6595
30 Ga0070681_10032969 3300005458 Bacteria 5199
31 Ga0070681_10642307 3300005458 Bacteria 976
32 Ga0068867_100571444 3300005459 Bacteria 982
33 Ga0068867_100773788 3300005459 Bacteria 854
34 Ga0070706_100334700 3300005467 Bacteria 1412
35 Ga0070707_100014778 3300005468 Bacteria 7319
36 Ga0070707_100025247 3300005468 Bacteria 5635
37 Ga0070707_100739328 3300005468 Bacteria 947
38 Ga0070707_101410945 3300005468 Bacteria 663
39 Ga0070698_100009950 3300005471 Bacteria 10166
40 Ga0070698_100040992 3300005471 Bacteria 4756
41 Ga0070698_100160626 3300005471 Bacteria 2191
42 Ga0070698_100302577 3300005471 Bacteria 1530
43 Ga0070699_100091340 3300005518 Bacteria 2662
44 Ga0070679_100090060 3300005530 Bacteria 3055
45 Ga0070679_100248094 3300005530 Unclassified 1737
46 Ga0070684_101096420 3300005535 Bacteria 748
47 Ga0070697_100058736 3300005536 Bacteria 3130
48 Ga0068853_100025815 3300005539 Bacteria 4931
49 Ga0070695_100236519 3300005545 Bacteria 1323
50 Ga0070696_100033510 3300005546 Bacteria 3529
51 Ga0070704_100048466 3300005549 Bacteria 2974
52 Ga0070704_100131935 3300005549 Bacteria 1938
53 Ga0070704_100496968 3300005549 Bacteria 1058
54 Ga0068855_100094080 3300005563 Bacteria 3455
55 Ga0068855_100231349 3300005563 Bacteria 2069
56 Ga0068857_100091126 3300005577 Bacteria 2728
57 Ga0068857_100388508 3300005577 Bacteria 1297
58 Ga0068854_100050476 3300005578 Unclassified 2977
59 Ga0068856_100249799 3300005614 Bacteria 1789
60 Ga0068859_100109056 3300005617 Bacteria 2830
61 Ga0068859_100267405 3300005617 Bacteria 1802
62 Ga0068864_101157390 3300005618 Bacteria 771
63 Ga0068861_101503333 3300005719 Bacteria 661
64 Ga0068870_10015945 3300005840 Bacteria 3578
65 Ga0068863_100046950 3300005841 Bacteria 4099
66 Ga0068858_101186361 3300005842 Unclassified 750
67 Ga0068860_100152311 3300005843 Bacteria 2227
68 Ga0068862_100553669 3300005844 Bacteria 1098
69 Ga0068862_100659752 3300005844 Bacteria 1010
70 Ga0068862_100688736 3300005844 Bacteria 989
71 Ga0081539_10000460 3300005985 Bacteria 86291
72 Ga0081539_10011506 3300005985 Bacteria 6987
73 Ga0097621_100002014 3300006237 Bacteria 13880
74 Ga0097621_100025238 3300006237 Bacteria 4648
75 Ga0097621_100782620 3300006237 Bacteria 883
76 Ga0068871_100004055 3300006358 Bacteria 10128
77 Ga0068871_100049668 3300006358 Bacteria 3391
78 Ga0075428_100002946 3300006844 Bacteria 18556
79 Ga0075430_100001249 3300006846 Bacteria 20455
80 Ga0075430_100164891 3300006846 Bacteria 1844
81 Ga0075431_100013213 3300006847 Bacteria 8341
82 Ga0075433_10010089 3300006852 Bacteria 7571
83 Ga0075433_10252409 3300006852 Bacteria 1565
84 Ga0075434_100086644 3300006871 Bacteria 3132
85 Ga0075434_100122976 3300006871 Bacteria 2611
86 Ga0075429_100003933 3300006880 Bacteria 12706
87 Ga0075429_100027880 3300006880 Bacteria 4903
88 Ga0075429_100661742 3300006880 Bacteria 915
89 Ga0068865_100839660 3300006881 Bacteria 795
90 Ga0075436_100338342 3300006914 Bacteria 1083
91 Ga0097620_100109054 3300006931 Bacteria 2830
92 Ga0097620_100267411 3300006931 Bacteria 1802
93 Ga0075435_100020140 3300007076 Bacteria 5104
94 Ga0075435_100055686 3300007076 Bacteria 3194
95 Ga0105240_10134661 3300009093 Bacteria 2960
96 Ga0105240_10902700 3300009093 Bacteria 950
97 Ga0111539_10020114 3300009094 Bacteria 8223
98 Ga0111539_10111413 3300009094 Bacteria 3211
99 Ga0111539_10182332 3300009094 Bacteria 2452
100 Ga0111539_10210529 3300009094 Bacteria 2266
101 Ga0111539_10222170 3300009094 Bacteria 2200
102 Ga0111539_10231198 3300009094 Bacteria 2153
103 Ga0111539_10344252 3300009094 Bacteria 1735
104 Ga0111539_10388065 3300009094 Bacteria 1626
105 Ga0111539_10464957 3300009094 Unclassified 1473
106 Ga0111539_10495676 3300009094 Bacteria 1423
107 Ga0111539_10544125 3300009094 Bacteria 1353
108 Ga0105245_10064029 3300009098 Bacteria 3323
109 Ga0105245_10500732 3300009098 Bacteria 1231
110 Ga0105245_11663169 3300009098 Bacteria 690
111 Ga0105247_10031100 3300009101 Archaea 3238
112 Ga0114129_10000802 3300009147 Bacteria 40299
113 Ga0114129_10006982 3300009147 Bacteria 16070
114 Ga0114129_10289194 3300009147 Bacteria 2187
115 Ga0105241_10545769 3300009174 Bacteria 1040
116 Ga0105241_10685544 3300009174 Bacteria 934
117 Ga0105242_10097278 3300009176 Bacteria 2488
118 Ga0105242_10679978 3300009176 Bacteria 1004
119 Ga0105248_10177290 3300009177 Bacteria 2402
120 Ga0105237_10577947 3300009545 Bacteria 1130
121 Ga0105238_11481638 3300009551 Bacteria 707
122 Ga0105249_10657826 3300009553 Bacteria 1106
123 Ga0105239_10631617 3300010375 Bacteria 1223
124 Ga0105239_11542800 3300010375 Bacteria 768
125 Ga0157370_10842023 3300013104 Bacteria 834
126 Ga0157369_11750973 3300013105 Bacteria 631
127 Ga0157374_10024256 3300013296 Bacteria 5435
128 Ga0157378_10023770 3300013297 Bacteria 5392
129 Ga0163162_10356528 3300013306 Bacteria 1595
130 Ga0163162_10587243 3300013306 Bacteria 1241
131 Ga0157372_10022727 3300013307 Bacteria 6789
132 Ga0157375_10117595 3300013308 Bacteria 2764
133 Ga0157375_10117941 3300013308 Bacteria 2760
134 Ga0163163_10015526 3300014325 Bacteria 7041
135 Ga0163163_10044823 3300014325 Bacteria 4340
136 Ga0157380_10017693 3300014326 Bacteria 5278
137 Ga0157380_10047921 3300014326 Bacteria 3363
138 Ga0157380_10332132 3300014326 Unclassified 1414
139 Ga0157380_10532442 3300014326 Bacteria 1148
140 Ga0157380_10562377 3300014326 Bacteria 1121
141 Ga0157377_10364899 3300014745 Bacteria 973
142 Ga0157376_10026818 3300014969 Bacteria 4558
143 Ga0207653_10154154 3300025885 Bacteria 847
144 Ga0207642_10060497 3300025899 Bacteria 1757
145 Ga0207645_10032995 3300025907 Bacteria 3328
146 Ga0207645_10469770 3300025907 Bacteria 850
147 Ga0207643_10050912 3300025908 Bacteria 2350
148 Ga0207684_10105352 3300025910 Bacteria 2412
149 Ga0207707_10202570 3300025912 Bacteria 1730
150 Ga0207707_10459707 3300025912 Bacteria 1089
151 Ga0207707_10783437 3300025912 Bacteria 795
152 Ga0207695_10342633 3300025913 Bacteria 1382
153 Ga0207671_10262887 3300025914 Bacteria 1358
154 Ga0207663_10233990 3300025916 Bacteria 1344
155 Ga0207660_10090834 3300025917 Bacteria 2263
156 Ga0207657_10039926 3300025919 Bacteria 4164
157 Ga0207657_10595241 3300025919 Bacteria 863
158 Ga0207649_10610673 3300025920 Bacteria 839
159 Ga0207652_10261276 3300025921 Bacteria 1562
160 Ga0207646_10020710 3300025922 Bacteria 6090
161 Ga0207646_10025490 3300025922 Bacteria 5409
162 Ga0207646_10060359 3300025922 Bacteria 3386
163 Ga0207646_10775306 3300025922 Bacteria 855
164 Ga0207646_11187172 3300025922 Bacteria 669
165 Ga0207681_10858693 3300025923 Bacteria 759
166 Ga0207650_10290738 3300025925 Bacteria 1332
167 Ga0207659_10863306 3300025926 Bacteria 778
168 Ga0207687_10368478 3300025927 Bacteria 1174
169 Ga0207664_10000303 3300025929 Bacteria 36731
170 Ga0207690_10096647 3300025932 Bacteria 2101
171 Ga0207690_10471315 3300025932 Bacteria 1012
172 Ga0207706_10013272 3300025933 Bacteria 7494
173 Ga0207706_10338108 3300025933 Bacteria 1310
174 Ga0207686_10044976 3300025934 Bacteria 2714
175 Ga0207686_10301612 3300025934 Bacteria 1190
176 Ga0207670_10982391 3300025936 Bacteria 710
177 Ga0207704_10710799 3300025938 Bacteria 833
178 Ga0207711_10709605 3300025941 Bacteria 938
179 Ga0207689_10277434 3300025942 Unclassified 1388
180 Ga0207661_10141608 3300025944 Bacteria 2070
181 Ga0207679_11257367 3300025945 Bacteria 679
182 Ga0207667_11028210 3300025949 Bacteria 810
183 Ga0207712_11595968 3300025961 Bacteria 585
184 Ga0207677_11305677 3300026023 Bacteria 666
185 Ga0207703_10423400 3300026035 Bacteria 1239
186 Ga0207703_10616283 3300026035 Bacteria 1027
187 Ga0207639_10125965 3300026041 Bacteria 2113
188 Ga0207708_10155000 3300026075 Bacteria 1806
189 Ga0207708_11043679 3300026075 Bacteria 711
190 Ga0207702_10195744 3300026078 Bacteria 1871
191 Ga0207641_10032593 3300026088 Bacteria 4326
192 Ga0207641_10521619 3300026088 Archaea 1156
193 Ga0207641_10944095 3300026088 Bacteria 858
194 Ga0207676_10076394 3300026095 Bacteria 2706
195 Ga0207676_10454862 3300026095 Unclassified 1208
196 Ga0207676_11031661 3300026095 Bacteria 811
197 Ga0207674_10208309 3300026116 Bacteria 1904
198 Ga0207674_10824098 3300026116 Bacteria 895
199 Ga0207674_11734966 3300026116 Bacteria 592
200 Ga0207683_10056703 3300026121 Bacteria 3437
201 Ga0207683_10071856 3300026121 Bacteria 3060
202 Ga0207683_10275019 3300026121 Bacteria 1539
203 Ga0209982_1002919 3300027552 Bacteria 2415
204 Ga0210002_1002348 3300027617 Bacteria 2735
205 Ga0209983_1013246 3300027665 Bacteria 1695
206 Ga0209971_1020232 3300027682 Bacteria 1582
207 Ga0209998_10000135 3300027717 Bacteria 28811
208 Ga0209998_10011431 3300027717 Bacteria 1838
209 Ga0209974_10000318 3300027876 Bacteria 15740
210 Ga0209974_10098404 3300027876 Bacteria 1020
211 Ga0207428_10009896 3300027907 Bacteria 8539
212 Ga0207428_10029295 3300027907 Bacteria 4564
213 Ga0207428_10110954 3300027907 Bacteria 2111
214 Ga0268264_10135625 3300028381 Bacteria 2188
215 Ga0265320_10085598 3300031240 Bacteria 1467
216 Ga0307408_100020438 3300031548 Bacteria 4469
217 Ga0307408_100024518 3300031548 Bacteria 4120
218 Ga0307408_100094638 3300031548 Bacteria 2263
219 Ga0307408_100373324 3300031548 Bacteria 1217
220 Ga0265314_10019376 3300031711 Bacteria 5273
221 Ga0307413_10048555 3300031824 Bacteria 2538
222 Ga0307413_10052343 3300031824 Bacteria 2465
223 Ga0307413_10449267 3300031824 Bacteria 1023
224 Ga0307410_10149656 3300031852 Bacteria 1736
225 Ga0307410_11083766 3300031852 Unclassified 694
226 Ga0307406_10074517 3300031901 Bacteria 2235
227 Ga0307406_10214780 3300031901 Bacteria 1425
228 Ga0307407_10014419 3300031903 Bacteria 3870
229 Ga0307407_10430530 3300031903 Bacteria 953
230 Ga0307412_10088612 3300031911 Bacteria 2159
231 Ga0307412_10829771 3300031911 Bacteria 805
232 Ga0307409_100022067 3300031995 Bacteria 4381
233 Ga0307409_100176538 3300031995 Bacteria 1886
234 Ga0307409_100379436 3300031995 Bacteria 1343
235 Ga0307416_100003583 3300032002 Bacteria 9157
236 Ga0307416_100009626 3300032002 Bacteria 6337
237 Ga0307416_101350825 3300032002 Bacteria 818
238 Ga0307414_10021683 3300032004 Bacteria 4038
239 Ga0307414_11141548 3300032004 Bacteria 720
240 Ga0307411_10125590 3300032005 Bacteria 1865
241 Ga0307411_11038684 3300032005 Bacteria 735
242 Ga0307415_100130655 3300032126 Bacteria 1901
243 Ga0373957_0200142 3300035120 Bacteria 832
244 Ga0373937_0205525 3300036401 Bacteria 1852
245 Ga0373937_0647200 3300036401 Bacteria 1002
246 Ga0373937_1020001 3300036401 Bacteria 776
247 Ga0395901_0382177 3300038443 Bacteria 1449
248 Ga0395901_0477737 3300038443 Bacteria 1272
249 Ga0439439_0010721 3300041406 Bacteria 2196
250 Ga0439432_043836 3300042006 Bacteria 1411
251 Ga0439450_072002 3300042008 Bacteria 849
252 Ga0439462_0025673 3300042015 Bacteria 1552
253 Ga0450920_056661 3300042122 Unclassified 789
254 Ga0450923_031219 3300042125 Bacteria 1087
255 Ga0450908_004946 3300042184 Unclassified 2559
256 Ga0439444_0039909 3300042437 Bacteria 918
257 Ga0439464_0038503 3300042439 Bacteria 1358
258 Ga0451576_0281804 3300045051 Bacteria 1738
259 Ga0451576_0773784 3300045051 Bacteria 1008
260 Ga0466967_0123272 3300045976 Bacteria 2398
261 Ga0495592_0223295 3300046454 Bacteria 1258
262 Ga0495639_0055706 3300046475 Bacteria 1804
263 Ga0495594_0094159 3300046499 Bacteria 1681
264 Ga0495594_0534135 3300046499 Bacteria 666
265 Ga0495642_0103820 3300046528 Bacteria 1212
266 Ga0495652_0228685 3300046529 Bacteria 1393
267 Ga0495640_0121159 3300046533 Bacteria 1701
268 Ga0495586_0123119 3300046535 Bacteria 1449
269 Ga0495645_0086819 3300046543 Bacteria 2238
270 Ga0495599_0241142 3300046678 Bacteria 1102
271 Ga0495646_0155603 3300046680 Bacteria 1269
272 Ga0495647_0038918 3300046681 Bacteria 1800
273 Ga0495658_0521991 3300046683 Bacteria 760
274 Ga0495669_0048449 3300046684 Bacteria 1901
275 Ga0495613_0119648 3300046689 Bacteria 1892
276 Ga0495581_0572373 3300047315 Bacteria 655
277 Ga0495581_0762043 3300047315 Bacteria 556
278 Ga0495674_0371634 3300047319 Bacteria 1158
279 Ga0495674_0387154 3300047319 Bacteria 1130
280 Ga0496112_1590343 3300048915 Bacteria 567
281 Ga0501031_0034496 3300049568 Bacteria 3302
282 Ga0501031_0106395 3300049568 Bacteria 1831
283 Ga0501032_0164563 3300049569 Bacteria 1456
284 Ga0501032_0637149 3300049569 Bacteria 677
285 Ga0501036_0046233 3300049572 Bacteria 3686
286 Ga0501036_0051772 3300049572 Bacteria 3477
287 Ga0501038_0056413 3300049574 Bacteria 3373
288 Ga0501038_0810819 3300049574 Bacteria 695
289 Ga0501039_0013652 3300049575 Bacteria 6211
290 Ga0501039_0085834 3300049575 Bacteria 2451
291 Ga0501039_0209397 3300049575 Bacteria 1533
292 Ga0501040_0020958 3300049576 Bacteria 4359
293 Ga0501040_0041923 3300049576 Bacteria 3117
294 Ga0501041_0030620 3300049577 Bacteria 3248
295 Ga0501041_0038604 3300049577 Bacteria 2896
296 Ga0501041_0549714 3300049577 Bacteria 736
297 Ga0501042_0050962 3300049578 Bacteria 2953
298 Ga0501042_0054022 3300049578 Bacteria 2865
299 Ga0501043_0155897 3300049579 Bacteria 1786
300 Ga0501043_0359324 3300049579 Bacteria 1105
301 Ga0501046_0117271 3300049580 Bacteria 2028
302 Ga0501047_0468146 3300049581 Bacteria 1089
303 Ga0501048_0010629 3300049582 Bacteria 6867
304 Ga0501048_0337314 3300049582 Bacteria 1074
305 Ga0501067_0051187 3300049583 Bacteria 2290
306 Ga0501068_0019361 3300049584 Bacteria 3952
307 Ga0501068_0076166 3300049584 Bacteria 2053
308 Ga0501069_0020835 3300049585 Bacteria 3555
309 Ga0501069_0099726 3300049585 Bacteria 1648
310 Ga0501069_0182771 3300049585 Unclassified 1212
311 Ga0501070_0010207 3300049586 Bacteria 7946
312 Ga0501070_0196678 3300049586 Bacteria 1656
313 Ga0501070_0234168 3300049586 Bacteria 1504
314 Ga0501071_0007808 3300049587 Bacteria 7054
315 Ga0501071_0008984 3300049587 Bacteria 6631
316 Ga0501071_0011730 3300049587 Bacteria 5913
317 Ga0501072_0044321 3300049588 Bacteria 3498
318 Ga0501072_0164880 3300049588 Bacteria 1768
319 Ga0501072_0197831 3300049588 Bacteria 1602
320 Ga0501073_0017565 3300049589 Bacteria 5180
321 Ga0501074_0009754 3300049590 Bacteria 6972
322 Ga0501074_0027168 3300049590 Bacteria 4149
323 Ga0501074_0112573 3300049590 Bacteria 1947
324 Ga0501074_0219890 3300049590 Bacteria 1352
325 Ga0501075_0033353 3300049591 Bacteria 3831
326 Ga0501075_0043824 3300049591 Bacteria 3355
327 Ga0501076_0025305 3300049592 Bacteria 4592
328 Ga0501076_0030621 3300049592 Bacteria 4193
329 Ga0501076_0080652 3300049592 Bacteria 2612
330 Ga0501076_0122626 3300049592 Bacteria 2105
331 Ga0501077_0023859 3300049593 Bacteria 3879
332 Ga0501077_0043537 3300049593 Bacteria 2853
333 Ga0501077_0098004 3300049593 Bacteria 1858
334 Ga0501077_0389339 3300049593 Bacteria 891
335 Ga0501217_033874 3300049661 Bacteria 1271
336 Ga0501235_024268 3300049669 Bacteria 1354
337 Ga0501079_0003627 3300049741 Bacteria 11363
338 Ga0501079_0007112 3300049741 Bacteria 8445
339 Ga0501079_0015166 3300049741 Bacteria 5876
340 Ga0501079_0101959 3300049741 Bacteria 2226
341 Ga0501079_0301900 3300049741 Bacteria 1253
342 Ga0501080_0038127 3300049742 Bacteria 4488
343 Ga0501080_0045723 3300049742 Bacteria 4075
344 Ga0501080_0117844 3300049742 Bacteria 2461
345 Ga0501080_0126230 3300049742 Bacteria 2370
346 Ga0501080_0183127 3300049742 Bacteria 1927
347 Ga0501081_0006509 3300049743 Bacteria 7586
348 Ga0501081_0108393 3300049743 Bacteria 1970
349 Ga0501081_0112679 3300049743 Bacteria 1931
350 Ga0501081_0210054 3300049743 Bacteria 1413
351 Ga0501083_0007282 3300049744 Bacteria 7847
352 Ga0501083_0043262 3300049744 Bacteria 3052
353 Ga0501083_0140210 3300049744 Bacteria 1583
354 Ga0501035_0085099 3300049822 Bacteria 2788
355 Ga0501045_0189353 3300049824 Bacteria 1533
356 Ga0501045_0222431 3300049824 Bacteria 1405
357 Ga0501212_024476 3300049851 Bacteria 950
358 nmdc:mga05p37_23526_c1 3300050507 Bacteria 7476
359 nmdc:mga05p37_65117_c1 3300050507 Bacteria 4485
360 nmdc:mga09592_47304_c1 3300050508 Bacteria 3626
361 nmdc:mga09592_47638_c1 3300050508 Bacteria 3613
362 nmdc:mga09592_510664_c1 3300050508 Bacteria 1034
363 nmdc:mga0qj67_107081_c1 3300050509 Bacteria 2255
364 nmdc:mga0qj67_241072_c1 3300050509 Bacteria 1467
365 nmdc:mga0qj67_794_c1 3300050509 Bacteria 21497
366 nmdc:mga06r32_171759_c1 3300050510 Bacteria 2152
367 nmdc:mga08y16_10051_c1 3300050511 Bacteria 9931
368 nmdc:mga08y16_119026_c1 3300050511 Unclassified 2749
369 nmdc:mga08y16_1654718_c1 3300050511 Bacteria 596
370 nmdc:mga08y16_190971_c1 3300050511 Bacteria 2124
371 nmdc:mga08y16_681949_c1 3300050511 Bacteria 1029
372 nmdc:mga08y16_684650_c1 3300050511 Bacteria 1027
373 nmdc:mga08y16_79506_c1 3300050511 Bacteria 3418
374 nmdc:mga08y16_97159_c1 3300050511 Bacteria 3067
375 nmdc:mga0n895_149628_c1 3300050512 Bacteria 2364
376 nmdc:mga0n895_48379_c1 3300050512 Bacteria 4162
377 nmdc:mga0n895_82931_c1 3300050512 Bacteria 3196
378 nmdc:mga0rr50_47130_c1 3300050513 Bacteria 3177
379 nmdc:mga0rr50_577460_c1 3300050513 Bacteria 958
380 nmdc:mga08x19_496935_c1 3300050514 Bacteria 861
381 nmdc:mga0a205_344214_c1 3300050515 Bacteria 1359
382 nmdc:mga0a205_565450_c1 3300050515 Bacteria 992
383 nmdc:mga0a205_993482_c1 3300050515 Bacteria 686
384 Ga0495595_0237825 3300053084 Bacteria 911
385 Ga0495619_0165694 3300053085 Bacteria 1527
386 Ga0501084_0028608 3300054114 Bacteria 4659
387 Ga0501084_0042324 3300054114 Bacteria 3810
388 Ga0590071_000161 3300059421 Bacteria 19295
389 Ga0590074_001344 3300059423 Bacteria 3933
390 Ga0590074_008252 3300059423 Bacteria 1735
391 Ga0590075_000212 3300059424 Bacteria 16232
392 Ga0590075_000343 3300059424 Bacteria 12990
393 Ga0590077_000134 3300059426 Bacteria 20027
394 Ga0590077_000160 3300059426 Bacteria 19049
395 Ga0501082_0072724 3300060353 Bacteria 2961
396 Ga0501082_0126065 3300060353 Bacteria 2220
397 Ga0530510_0048924 3300061734 Bacteria 3055
398 Ga0530510_0238496 3300061734 Bacteria 1353
399 Ga0070708_100103201
400 MBSR1b_contig_5451366
401 JGI25406J46586_10003055
402 rootL2_10082742
403 Ga0065715_10097532
404 Ga0065707_10106449
405 Ga0070676_10079361
406 Ga0070676_10406081
407 Ga0070683_100082017
408 Ga0070670_101503549
409 Ga0070666_10238754
410 Ga0070660_100825541
411 Ga0070689_100853430
412 Ga0070675_101470342
413 Ga0070674_100202222
414 Ga0070688_100101963
415 Ga0070659_100011008
416 Ga0070659_100032980
417 Ga0070714_100000988
418 Ga0070705_100003953
419 Ga0070700_100137619
420 Ga0070700_100155879
421 Ga0070694_100370065
422 Ga0070708_100001552
423 Ga0070708_100220726
424 Ga0070678_100034340
425 Ga0070662_100049334
426 Ga0070662_100447533
427 Ga0070681_10020669
428 Ga0070681_10032969
429 Ga0070681_10642307
430 Ga0068867_100571444
431 Ga0068867_100773788
432 Ga0070706_100334700
433 Ga0070707_100014778
434 Ga0070707_100025247
435 Ga0070707_100739328
436 Ga0070707_101410945
437 Ga0070698_100009950
438 Ga0070698_100040992
439 Ga0070698_100160626
440 Ga0070698_100302577
441 Ga0070699_100091340
442 Ga0070679_100090060
443 Ga0070679_100248094
444 Ga0070684_101096420
445 Ga0070697_100058736
446 Ga0068853_100025815
447 Ga0070695_100236519
448 Ga0070696_100033510
449 Ga0070704_100048466
450 Ga0070704_100131935
451 Ga0070704_100496968
452 Ga0068855_100094080
453 Ga0068855_100231349
454 Ga0068857_100091126
455 Ga0068857_100388508
456 Ga0068854_100050476
457 Ga0068856_100249799
458 Ga0068859_100109056
459 Ga0068859_100267405
460 Ga0068864_101157390
461 Ga0068861_101503333
462 Ga0068870_10015945
463 Ga0068863_100046950
464 Ga0068858_101186361
465 Ga0068860_100152311
466 Ga0068862_100553669
467 Ga0068862_100659752
468 Ga0068862_100688736
469 Ga0081539_10000460
470 Ga0081539_10011506
471 Ga0097621_100002014
472 Ga0097621_100025238
473 Ga0097621_100782620
474 Ga0068871_100004055
475 Ga0068871_100049668
476 Ga0075428_100002946
477 Ga0075430_100001249
478 Ga0075430_100164891
479 Ga0075431_100013213
480 Ga0075433_10010089
481 Ga0075433_10252409
482 Ga0075434_100086644
483 Ga0075434_100122976
484 Ga0075429_100003933
485 Ga0075429_100027880
486 Ga0075429_100661742
487 Ga0068865_100839660
488 Ga0075436_100338342
489 Ga0097620_100109054
490 Ga0097620_100267411
491 Ga0075435_100020140
492 Ga0075435_100055686
493 Ga0105240_10134661
494 Ga0105240_10902700
495 Ga0111539_10020114
496 Ga0111539_10111413
497 Ga0111539_10182332
498 Ga0111539_10210529
499 Ga0111539_10222170
500 Ga0111539_10231198
501 Ga0111539_10344252
502 Ga0111539_10388065
503 Ga0111539_10464957
504 Ga0111539_10495676
505 Ga0111539_10544125
506 Ga0105245_10064029
507 Ga0105245_10500732
508 Ga0105245_11663169
509 Ga0105247_10031100
510 Ga0114129_10000802
511 Ga0114129_10006982
512 Ga0114129_10289194
513 Ga0105241_10545769
514 Ga0105241_10685544
515 Ga0105242_10097278
516 Ga0105242_10679978
517 Ga0105248_10177290
518 Ga0105237_10577947
519 Ga0105238_11481638
520 Ga0105249_10657826
521 Ga0105239_10631617
522 Ga0105239_11542800
523 Ga0157370_10842023
524 Ga0157369_11750973
525 Ga0157374_10024256
526 Ga0157378_10023770
527 Ga0163162_10356528
528 Ga0163162_10587243
529 Ga0157372_10022727
530 Ga0157375_10117595
531 Ga0157375_10117941
532 Ga0163163_10015526
533 Ga0163163_10044823
534 Ga0157380_10017693
535 Ga0157380_10047921
536 Ga0157380_10332132
537 Ga0157380_10532442
538 Ga0157380_10562377
539 Ga0157377_10364899
540 Ga0157376_10026818
541 Ga0207653_10154154
542 Ga0207642_10060497
543 Ga0207645_10032995
544 Ga0207645_10469770
545 Ga0207643_10050912
546 Ga0207684_10105352
547 Ga0207707_10202570
548 Ga0207707_10459707
549 Ga0207707_10783437
550 Ga0207695_10342633
551 Ga0207671_10262887
552 Ga0207663_10233990
553 Ga0207660_10090834
554 Ga0207657_10039926
555 Ga0207657_10595241
556 Ga0207649_10610673
557 Ga0207652_10261276
558 Ga0207646_10020710
559 Ga0207646_10025490
560 Ga0207646_10060359
561 Ga0207646_10775306
562 Ga0207646_11187172
563 Ga0207681_10858693
564 Ga0207650_10290738
565 Ga0207659_10863306
566 Ga0207687_10368478
567 Ga0207664_10000303
568 Ga0207690_10096647
569 Ga0207690_10471315
570 Ga0207706_10013272
571 Ga0207706_10338108
572 Ga0207686_10044976
573 Ga0207686_10301612
574 Ga0207670_10982391
575 Ga0207704_10710799
576 Ga0207711_10709605
577 Ga0207689_10277434
578 Ga0207661_10141608
579 Ga0207679_11257367
580 Ga0207667_11028210
581 Ga0207712_11595968
582 Ga0207677_11305677
583 Ga0207703_10423400
584 Ga0207703_10616283
585 Ga0207639_10125965
586 Ga0207708_10155000
587 Ga0207708_11043679
588 Ga0207702_10195744
589 Ga0207641_10032593
590 Ga0207641_10521619
591 Ga0207641_10944095
592 Ga0207676_10076394
593 Ga0207676_10454862
594 Ga0207676_11031661
595 Ga0207674_10208309
596 Ga0207674_10824098
597 Ga0207674_11734966
598 Ga0207683_10056703
599 Ga0207683_10071856
600 Ga0207683_10275019
601 Ga0209982_1002919
602 Ga0210002_1002348
603 Ga0209983_1013246
604 Ga0209971_1020232
605 Ga0209998_10000135
606 Ga0209998_10011431
607 Ga0209974_10000318
608 Ga0209974_10098404
609 Ga0207428_10009896
610 Ga0207428_10029295
611 Ga0207428_10110954
612 Ga0268264_10135625
613 Ga0265320_10085598
614 Ga0307408_100020438
615 Ga0307408_100024518
616 Ga0307408_100094638
617 Ga0307408_100373324
618 Ga0265314_10019376
619 Ga0307413_10048555
620 Ga0307413_10052343
621 Ga0307413_10449267
622 Ga0307410_10149656
623 Ga0307410_11083766
624 Ga0307406_10074517
625 Ga0307406_10214780
626 Ga0307407_10014419
627 Ga0307407_10430530
628 Ga0307412_10088612
629 Ga0307412_10829771
630 Ga0307409_100022067
631 Ga0307409_100176538
632 Ga0307409_100379436
633 Ga0307416_100003583
634 Ga0307416_100009626
635 Ga0307416_101350825
636 Ga0307414_10021683
637 Ga0307414_11141548
638 Ga0307411_10125590
639 Ga0307411_11038684
640 Ga0307415_100130655
641 Ga0373957_0200142
642 Ga0373937_0205525
643 Ga0373937_0647200
644 Ga0373937_1020001
645 Ga0395901_0382177
646 Ga0395901_0477737
647 Ga0439439_0010721
648 Ga0439432_043836
649 Ga0439450_072002
650 Ga0439462_0025673
651 Ga0450920_056661
652 Ga0450923_031219
653 Ga0450908_004946
654 Ga0439444_0039909
655 Ga0439464_0038503
656 Ga0451576_0281804
657 Ga0451576_0773784
658 Ga0466967_0123272
659 Ga0495592_0223295
660 Ga0495639_0055706
661 Ga0495594_0094159
662 Ga0495594_0534135
663 Ga0495642_0103820
664 Ga0495652_0228685
665 Ga0495640_0121159
666 Ga0495586_0123119
667 Ga0495645_0086819
668 Ga0495599_0241142
669 Ga0495646_0155603
670 Ga0495647_0038918
671 Ga0495658_0521991
672 Ga0495669_0048449
673 Ga0495613_0119648
674 Ga0495581_0572373
675 Ga0495581_0762043
676 Ga0495674_0371634
677 Ga0495674_0387154
678 Ga0496112_1590343
679 Ga0501031_0034496
680 Ga0501031_0106395
681 Ga0501032_0164563
682 Ga0501032_0637149
683 Ga0501036_0046233
684 Ga0501036_0051772
685 Ga0501038_0056413
686 Ga0501038_0810819
687 Ga0501039_0013652
688 Ga0501039_0085834
689 Ga0501039_0209397
690 Ga0501040_0020958
691 Ga0501040_0041923
692 Ga0501041_0030620
693 Ga0501041_0038604
694 Ga0501041_0549714
695 Ga0501042_0050962
696 Ga0501042_0054022
697 Ga0501043_0155897
698 Ga0501043_0359324
699 Ga0501046_0117271
700 Ga0501047_0468146
701 Ga0501048_0010629
702 Ga0501048_0337314
703 Ga0501067_0051187
704 Ga0501068_0019361
705 Ga0501068_0076166
706 Ga0501069_0020835
707 Ga0501069_0099726
708 Ga0501069_0182771
709 Ga0501070_0010207
710 Ga0501070_0196678
711 Ga0501070_0234168
712 Ga0501071_0007808
713 Ga0501071_0008984
714 Ga0501071_0011730
715 Ga0501072_0044321
716 Ga0501072_0164880
717 Ga0501072_0197831
718 Ga0501073_0017565
719 Ga0501074_0009754
720 Ga0501074_0027168
721 Ga0501074_0112573
722 Ga0501074_0219890
723 Ga0501075_0033353
724 Ga0501075_0043824
725 Ga0501076_0025305
726 Ga0501076_0030621
727 Ga0501076_0080652
728 Ga0501076_0122626
729 Ga0501077_0023859
730 Ga0501077_0043537
731 Ga0501077_0098004
732 Ga0501077_0389339
733 Ga0501217_033874
734 Ga0501235_024268
735 Ga0501079_0003627
736 Ga0501079_0007112
737 Ga0501079_0015166
738 Ga0501079_0101959
739 Ga0501079_0301900
740 Ga0501080_0038127
741 Ga0501080_0045723
742 Ga0501080_0117844
743 Ga0501080_0126230
744 Ga0501080_0183127
745 Ga0501081_0006509
746 Ga0501081_0108393
747 Ga0501081_0112679
748 Ga0501081_0210054
749 Ga0501083_0007282
750 Ga0501083_0043262
751 Ga0501083_0140210
752 Ga0501035_0085099
753 Ga0501045_0189353
754 Ga0501045_0222431
755 Ga0501212_024476
756 nmdc:mga05p37_23526_c1
757 nmdc:mga05p37_65117_c1
758 nmdc:mga09592_47304_c1
759 nmdc:mga09592_47638_c1
760 nmdc:mga09592_510664_c1
761 nmdc:mga0qj67_107081_c1
762 nmdc:mga0qj67_241072_c1
763 nmdc:mga0qj67_794_c1
764 nmdc:mga06r32_171759_c1
765 nmdc:mga08y16_10051_c1
766 nmdc:mga08y16_119026_c1
767 nmdc:mga08y16_1654718_c1
768 nmdc:mga08y16_190971_c1
769 nmdc:mga08y16_681949_c1
770 nmdc:mga08y16_684650_c1
771 nmdc:mga08y16_79506_c1
772 nmdc:mga08y16_97159_c1
773 nmdc:mga0n895_149628_c1
774 nmdc:mga0n895_48379_c1
775 nmdc:mga0n895_82931_c1
776 nmdc:mga0rr50_47130_c1
777 nmdc:mga0rr50_577460_c1
778 nmdc:mga08x19_496935_c1
779 nmdc:mga0a205_344214_c1
780 nmdc:mga0a205_565450_c1
781 nmdc:mga0a205_993482_c1
782 Ga0495595_0237825
783 Ga0495619_0165694
784 Ga0501084_0028608
785 Ga0501084_0042324
786 Ga0590071_000161
787 Ga0590074_001344
788 Ga0590074_008252
789 Ga0590075_000212
790 Ga0590075_000343
791 Ga0590077_000134
792 Ga0590077_000160
793 Ga0501082_0072724
794 Ga0501082_0126065
795 Ga0530510_0048924
796 Ga0530510_0238496

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

32

160

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9793 1 172
4m0k-assembly2.cif.gz_D crystal structure of adenine phosphoribosyltransferase from rhodothermus marinus dsm 4252, nysgrc target 029775. 0.9715 2 172
4mb6-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from yersinia pseudotuberculosis. 0.9673 2 172
7xi2-assembly1.cif.gz_B crystal structure of escherichia coli adenine phosphoribosyltransferase (aprt) in complex with phosphate 0.9672 2 172
6fd6-assembly1.cif.gz_B crystal structure of human aprt-tyr105phe variant in complex with adenine, prpp and mg2+, 30 days post crystallization (with amp and ppi products fully generated) 0.9654 2 172
ID Description Score Start End Superfamily
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9809 2 172 3.40.50.2020
af_A0A0P0WCD3_31_176_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.977 3 135 3.40.50.2020
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9697 2 172 3.40.50.2020
4m0kC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9624 2 172 3.40.50.2020
af_P12426_6_182_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9597 2 172 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A1F2VH06-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9985 5 172 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A7J4CZX2-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9951 55 172 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A535E6K3-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9946 5 172 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A645FSY4-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9942 105 172 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A7C6XFA1-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.994 1 172 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209

Map