F433758

General Info

Members Datasets Scaffolds Average Seq Length
397 266 361 424

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10116194|Ga0105239_101161942
Length 498
Sequence MHIRSGEHVFAGKSDERAVSICGGRACCGCGQKRICLLSERPIADIVHAGVCSTIAIDESGCCEGGAMKLQSYWTDTAPRFTPQAAEWPASVDVAVVGAGFTGLSAALALAARGARVAVLEAGDCVAFEASGRNGGHVNNGLAHDYGELADKVGVEQARAWYHAYDAAVDTIERLVREEAIDCGFARNGKLKLATKPAHYDALARSAERLRADEVDIDIELLDRARVRAGEIGSERFAGGLVYRRSAQMHMGRFANGLAAAVERKGGKIFLQSTVERIERGDNGKPATLHTTRGPLHAGQTLLANGAGRHGSYREFGWLRRRMVPVGSFIIATAPLGRERAQRLIAQRRTCTTVANIHHYFRLTDDDRLILGGRAHFGVSSLKSDARSAPILREGMLSIFPQLADVEIDYCWGGVVDMTRDRLPQAGERDGVWYSTGYSGHGTQMSVHMGQVMAQIMSGEAMANPWGGRAWPAIPGHFGPPWFLPLVGAYYRAKDRFS

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
7 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
8 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
9 2643221736 Bosea sp. Root483D1 Isolate Unclassified
10 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
11 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
12 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
13 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
14 2841760612 Bosea sp. Tri-49 Isolate Nodule
15 2844104063 Bosea sp. Tri-39 Isolate Nodule
16 2847085930 Erwinia persicina B64 Isolate Bulb
17 2851182111 Bosea sp. Tri-44 Isolate Nodule
18 2851246043 Bosea sp. Tri-54 Isolate Nodule
19 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
20 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
21 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
22 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
23 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
24 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
25 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
26 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
27 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
28 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
29 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
30 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
31 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
32 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
33 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
34 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
35 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
36 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
37 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
38 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
39 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
40 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
41 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
42 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
43 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
44 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
45 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
46 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
47 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
48 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
49 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
50 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
51 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
52 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
53 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
54 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
58 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
59 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
60 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
63 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
64 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
65 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
68 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
119 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
122 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
126 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
127 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
128 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
129 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
200 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
201 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
202 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
203 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
204 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
205 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
206 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
207 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
208 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
209 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
210 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
211 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
212 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
213 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
214 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
215 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
216 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
217 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
218 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
219 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
220 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
221 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
222 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
223 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
231 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
232 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
249 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
253 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
261 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
262 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 639633007 Azoarcus olearius BH72 Isolate Unclassified
265 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
266 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.18
Metatranscriptomes 0
Isolates 8.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.25
Endosphere 18.39
Nodule 1.26
Rhizoplane 0
Rhizosphere 66.75
Stem 0
Stem Tuber 0
Unclassified 13.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001602 3300001915 Bacteria 6351
2 JGI24740J21852_10000121 3300001979 Bacteria 29039
3 JGI24740J21852_10014072 3300001979 Bacteria 2963
4 JGI25155J39150_1000035 3300002704 Bacteria 99118
5 JGI25156J39149_1000012 3300002705 Bacteria 194393
6 JGI25154J39366_1000029 3300002738 Bacteria 194393
7 JGI25157J39369_1000014 3300002741 Bacteria 194393
8 JGI25152J39213_1002123 3300002773 Bacteria 7778
9 JGI25159J45721_1000054 3300002987 Bacteria 56576
10 JGI25159J45721_1004190 3300002987 Bacteria 4865
11 JGI25151J46595_10001430 3300003187 Bacteria 16253
12 JGI25151J46595_10003954 3300003187 Bacteria 7984
13 JGI25153J46596_10003502 3300003215 Bacteria 8762
14 rootH1_10003154 3300003316 Bacteria 20061
15 rootL2_10001152 3300003322 Bacteria 8628
16 JGI25160J50197_1000088 3300003354 Bacteria 93050
17 JGI25160J50197_1000119 3300003354 Bacteria 71366
18 JGI25161J50226_1000056 3300003374 Bacteria 103097
19 Ga0055538_1000231 3300003751 Bacteria 31098
20 Ga0055526_1004199 3300003771 Bacteria 8751
21 Ga0055526_1004858 3300003771 Bacteria 7923
22 Ga0055537_1000339 3300003773 Bacteria 31974
23 Ga0055524_1000299 3300003775 Bacteria 47507
24 Ga0055536_1020146 3300003781 Bacteria 2070
25 Ga0055534_1003838 3300003784 Bacteria 4586
26 Ga0055528_1002865 3300003790 Bacteria 8977
27 Ga0055530_10000854 3300003791 Bacteria 25157
28 Ga0055540_1000818 3300003792 Bacteria 20993
29 Ga0055531_10000935 3300003794 Bacteria 23574
30 Ga0055541_1000165 3300003841 Bacteria 32147
31 Ga0058692_1002319 3300003856 Bacteria 6433
32 Ga0055543_1000755 3300004625 Bacteria 16208
33 Ga0065165_1000551 3300005262 Bacteria 56364
34 Ga0065714_10067375 3300005288 Bacteria 5589
35 Ga0070676_10009475 3300005328 Bacteria 5260
36 Ga0070690_100006071 3300005330 Bacteria 6834
37 Ga0070670_100025939 3300005331 Bacteria 5043
38 Ga0070670_100085791 3300005331 Bacteria 2705
39 Ga0070666_10002707 3300005335 Bacteria 10698
40 Ga0068868_100011890 3300005338 Bacteria 6347
41 Ga0070661_100010840 3300005344 Bacteria 6346
42 Ga0070661_100141153 3300005344 Bacteria 1816
43 Ga0070661_100186668 3300005344 Bacteria 1580
44 Ga0070669_100002807 3300005353 Bacteria 12570
45 Ga0070675_100002247 3300005354 Bacteria 14312
46 Ga0070675_100006876 3300005354 Bacteria 8732
47 Ga0070671_100025526 3300005355 Bacteria 4850
48 Ga0070671_100078145 3300005355 Bacteria 2766
49 Ga0070673_100005124 3300005364 Bacteria 8357
50 Ga0070673_100008576 3300005364 Bacteria 6803
51 Ga0070667_100058895 3300005367 Bacteria 3248
52 Ga0070667_100196697 3300005367 Bacteria 1787
53 Ga0070714_100209043 3300005435 Bacteria 1788
54 Ga0070663_100000248 3300005455 Bacteria 27309
55 Ga0070663_100131479 3300005455 Bacteria 1901
56 Ga0070678_100013133 3300005456 Bacteria 5179
57 Ga0070662_100014736 3300005457 Bacteria 5225
58 Ga0070662_100101875 3300005457 Bacteria 2174
59 Ga0068867_100000984 3300005459 Bacteria 19443
60 Ga0068867_100041949 3300005459 Bacteria 3344
61 Ga0070685_10001923 3300005466 Bacteria 10778
62 Ga0070685_10041942 3300005466 Bacteria 2609
63 Ga0068853_100035960 3300005539 Bacteria 4209
64 Ga0068853_100102275 3300005539 Bacteria 2535
65 Ga0070672_100007829 3300005543 Bacteria 7290
66 Ga0070665_100000227 3300005548 Bacteria 93439
67 Ga0070665_100060232 3300005548 Bacteria 3805
68 Ga0068855_100000609 3300005563 Bacteria 43917
69 Ga0068855_100010932 3300005563 Bacteria 10955
70 Ga0068855_100123940 3300005563 Bacteria 2956
71 Ga0068855_100214425 3300005563 Bacteria 2162
72 Ga0070664_100000612 3300005564 Bacteria 27309
73 Ga0070664_100046583 3300005564 Bacteria 3662
74 Ga0068857_100184805 3300005577 Bacteria 1897
75 Ga0068854_100009249 3300005578 Bacteria 6358
76 Ga0068854_100010398 3300005578 Bacteria 6033
77 Ga0068854_100039055 3300005578 Bacteria 3341
78 Ga0068854_100119947 3300005578 Bacteria 1995
79 Ga0068856_100001062 3300005614 Bacteria 29080
80 Ga0068852_100050942 3300005616 Bacteria 3551
81 Ga0068864_100046205 3300005618 Bacteria 3735
82 Ga0068861_100081576 3300005719 Bacteria 2532
83 Ga0068851_10001399 3300005834 Bacteria 10544
84 Ga0068851_10061318 3300005834 Bacteria 1927
85 Ga0068851_10069016 3300005834 Bacteria 1825
86 Ga0068858_100004031 3300005842 Bacteria 14495
87 Ga0075365_10003593 3300006038 Bacteria 8026
88 Ga0075365_10024460 3300006038 Bacteria 3811
89 Ga0075368_10017774 3300006042 Bacteria 2665
90 Ga0075363_100008026 3300006048 Bacteria 4892
91 Ga0075432_10010495 3300006058 Bacteria 3144
92 Ga0075362_10009640 3300006177 Bacteria 3742
93 Ga0075362_10012833 3300006177 Bacteria 3338
94 Ga0075362_10027987 3300006177 Bacteria 2418
95 Ga0075367_10003071 3300006178 Bacteria 7833
96 Ga0075369_10026505 3300006186 Bacteria 2416
97 Ga0075366_10000282 3300006195 Bacteria 22748
98 Ga0075366_10010046 3300006195 Bacteria 5305
99 Ga0075366_10013027 3300006195 Bacteria 4728
100 Ga0075370_10015918 3300006353 Bacteria 4037
101 Ga0075370_10026369 3300006353 Bacteria 3219
102 Ga0068871_100094660 3300006358 Bacteria 2493
103 Ga0075430_100010626 3300006846 Bacteria 7800
104 Ga0075430_100019371 3300006846 Bacteria 5787
105 Ga0075429_100000391 3300006880 Bacteria 32193
106 Ga0068865_100123403 3300006881 Bacteria 1930
107 Ga0105240_10001044 3300009093 Bacteria 49217
108 Ga0105240_10005295 3300009093 Bacteria 19258
109 Ga0105240_10006221 3300009093 Bacteria 17557
110 Ga0105240_10040595 3300009093 Bacteria 5949
111 Ga0105240_10043932 3300009093 Bacteria 5682
112 Ga0105245_10084626 3300009098 Bacteria 2906
113 Ga0105245_10108441 3300009098 Bacteria 2579
114 Ga0105243_10102091 3300009148 Bacteria 2383
115 Ga0105241_10146119 3300009174 Bacteria 1930
116 Ga0105241_10186182 3300009174 Bacteria 1726
117 Ga0105237_10001808 3300009545 Bacteria 27606
118 Ga0105237_10013705 3300009545 Bacteria 8490
119 Ga0105237_10015986 3300009545 Bacteria 7803
120 Ga0105238_10000102 3300009551 Bacteria 94910
121 Ga0105238_10000111 3300009551 Bacteria 89931
122 Ga0105238_10006969 3300009551 Bacteria 11292
123 Ga0105249_10007119 3300009553 Bacteria 9765
124 Ga0105239_10001763 3300010375 Bacteria 28493
125 Ga0105239_10008101 3300010375 Bacteria 11995
126 Ga0105239_10008675 3300010375 Bacteria 11512
127 Ga0105239_10116194 3300010375 Bacteria 2969
128 Ga0105246_10049156 3300011119 Bacteria 2887
129 Ga0157371_10001222 3300013102 Bacteria 27315
130 Ga0157374_10231376 3300013296 Bacteria 1815
131 Ga0157372_10001268 3300013307 Bacteria 27315
132 Ga0157375_10248491 3300013308 Bacteria 1939
133 Ga0157376_10034886 3300014969 Bacteria 4065
134 Ga0182006_1001634 3300015261 Bacteria 13236
135 Ga0182006_1005633 3300015261 Bacteria 5943
136 Ga0183362_10002 3300015683 Bacteria 1432711
137 Ga0163161_10000165 3300017792 Bacteria 60584
138 Ga0163161_10051349 3300017792 Bacteria 2986
139 Ga0209435_100002 3300025206 Bacteria 794178
140 Ga0209784_100066 3300025224 Bacteria 154427
141 Ga0209566_100125 3300025225 Bacteria 95628
142 Ga0209674_100344 3300025226 Bacteria 27195
143 Ga0209646_1000001 3300025246 Bacteria 3092932
144 Ga0209026_1000040 3300025250 Bacteria 277470
145 Ga0209759_1000001 3300025256 Bacteria 2799452
146 Ga0209129_1002422 3300025258 Bacteria 9168
147 Ga0209565_1000016 3300025263 Bacteria 477707
148 Ga0209673_1000995 3300025273 Bacteria 34587
149 Ga0209130_1000040 3300025284 Bacteria 262926
150 Ga0209130_1000190 3300025284 Bacteria 86573
151 Ga0209130_1002302 3300025284 Bacteria 9790
152 Ga0209675_1000401 3300025291 Bacteria 35752
153 Ga0209676_1000023 3300025292 Bacteria 589732
154 Ga0209025_1000174 3300025294 Bacteria 158915
155 Ga0209025_1000783 3300025294 Bacteria 52275
156 Ga0209025_1001126 3300025294 Bacteria 38269
157 Ga0209025_1016362 3300025294 Bacteria 4385
158 Ga0209025_1030704 3300025294 Bacteria 2564
159 Ga0209564_1001307 3300025295 Bacteria 26815
160 Ga0209564_1004644 3300025295 Bacteria 8263
161 Ga0209758_1000057 3300025297 Bacteria 333111
162 Ga0209050_1000022 3300025298 Bacteria 565239
163 Ga0209050_1010297 3300025298 Bacteria 4626
164 Ga0209256_1000001 3300025299 Bacteria 2166974
165 Ga0207426_1000188 3300025302 Bacteria 153510
166 Ga0207426_1002218 3300025302 Bacteria 13027
167 Ga0209051_1000013 3300025303 Bacteria 565239
168 Ga0209257_1001435 3300025304 Bacteria 28217
169 Ga0207697_10004886 3300025315 Bacteria 6320
170 Ga0207656_10011573 3300025321 Bacteria 3337
171 Ga0207682_10035993 3300025893 Bacteria 2002
172 Ga0207680_10001300 3300025903 Bacteria 11819
173 Ga0207647_10000500 3300025904 Bacteria 31386
174 Ga0207645_10042805 3300025907 Bacteria 2897
175 Ga0207643_10008486 3300025908 Bacteria 5513
176 Ga0207707_10009426 3300025912 Bacteria 8470
177 Ga0207695_10000007 3300025913 Bacteria 1092551
178 Ga0207695_10001698 3300025913 Bacteria 35307
179 Ga0207695_10009263 3300025913 Bacteria 12199
180 Ga0207695_10014078 3300025913 Bacteria 9499
181 Ga0207695_10014701 3300025913 Bacteria 9255
182 Ga0207695_10022351 3300025913 Bacteria 7182
183 Ga0207695_10037817 3300025913 Bacteria 5204
184 Ga0207695_10217555 3300025913 Bacteria 1819
185 Ga0207671_10003510 3300025914 Bacteria 15568
186 Ga0207671_10003884 3300025914 Bacteria 14588
187 Ga0207649_10006487 3300025920 Bacteria 6353
188 Ga0207649_10094680 3300025920 Bacteria 1963
189 Ga0207694_10000176 3300025924 Bacteria 66165
190 Ga0207694_10000199 3300025924 Bacteria 60220
191 Ga0207694_10003986 3300025924 Bacteria 11641
192 Ga0207694_10005080 3300025924 Bacteria 10170
193 Ga0207650_10008863 3300025925 Bacteria 6875
194 Ga0207650_10010601 3300025925 Bacteria 6329
195 Ga0207650_10048832 3300025925 Bacteria 3122
196 Ga0207650_10129691 3300025925 Bacteria 1972
197 Ga0207659_10010293 3300025926 Bacteria 5871
198 Ga0207644_10017245 3300025931 Bacteria 4873
199 Ga0207644_10018746 3300025931 Bacteria 4685
200 Ga0207706_10020155 3300025933 Bacteria 5992
201 Ga0207706_10229159 3300025933 Bacteria 1626
202 Ga0207709_10038900 3300025935 Bacteria 2837
203 Ga0207669_10071463 3300025937 Bacteria 2180
204 Ga0207704_10023016 3300025938 Bacteria 3350
205 Ga0207689_10065209 3300025942 Bacteria 2996
206 Ga0207679_10000490 3300025945 Bacteria 27325
207 Ga0207667_10000146 3300025949 Bacteria 106926
208 Ga0207667_10002981 3300025949 Bacteria 21034
209 Ga0207712_10000169 3300025961 Bacteria 67461
210 Ga0207668_10041697 3300025972 Bacteria 3105
211 Ga0207640_10001595 3300025981 Bacteria 12185
212 Ga0207640_10019836 3300025981 Bacteria 3980
213 Ga0207640_10030091 3300025981 Bacteria 3341
214 Ga0207658_10049576 3300025986 Bacteria 3086
215 Ga0207658_10197313 3300025986 Bacteria 1677
216 Ga0207703_10001066 3300026035 Bacteria 26163
217 Ga0207639_10001687 3300026041 Bacteria 14904
218 Ga0207639_10261766 3300026041 Bacteria 1513
219 Ga0207678_10000901 3300026067 Bacteria 27267
220 Ga0207678_10152761 3300026067 Bacteria 1972
221 Ga0207702_10001124 3300026078 Bacteria 27325
222 Ga0207648_10011610 3300026089 Bacteria 8294
223 Ga0207648_10011635 3300026089 Bacteria 8282
224 Ga0207648_10023140 3300026089 Bacteria 5572
225 Ga0207676_10016021 3300026095 Bacteria 5424
226 Ga0207674_10153419 3300026116 Bacteria 2259
227 Ga0207675_100161366 3300026118 Bacteria 2138
228 Ga0207683_10031899 3300026121 Bacteria 4575
229 Ga0207683_10218613 3300026121 Bacteria 1736
230 Ga0207698_10046129 3300026142 Bacteria 3288
231 Ga0207698_10158013 3300026142 Bacteria 1978
232 Ga0268266_10000006 3300028379 Bacteria 1410021
233 Ga0307515_10000047 3300028794 Bacteria 291475
234 Ga0307515_10001293 3300028794 Bacteria 56861
235 Ga0307515_10001625 3300028794 Bacteria 50019
236 Ga0307515_10017866 3300028794 Bacteria 12888
237 Ga0307515_10021154 3300028794 Bacteria 11550
238 Ga0307515_10029411 3300028794 Bacteria 9285
239 Ga0307515_10079855 3300028794 Bacteria 4277
240 Ga0307512_10050142 3300030522 Bacteria 3356
241 Ga0265332_10005816 3300031238 Bacteria 5655
242 Ga0307513_10001531 3300031456 Bacteria 33094
243 Ga0307513_10019211 3300031456 Bacteria 8141
244 Ga0307408_100000114 3300031548 Bacteria 89451
245 Ga0307408_100000939 3300031548 Bacteria 22685
246 Ga0307408_100001459 3300031548 Bacteria 17556
247 Ga0307408_100031255 3300031548 Bacteria 3707
248 Ga0307408_100098210 3300031548 Bacteria 2225
249 Ga0307514_10000560 3300031649 Bacteria 71030
250 Ga0307514_10000850 3300031649 Bacteria 49169
251 Ga0307514_10006070 3300031649 Bacteria 10616
252 Ga0307514_10017249 3300031649 Bacteria 5945
253 Ga0265314_10099800 3300031711 Bacteria 1869
254 Ga0307516_10002036 3300031730 Bacteria 27557
255 Ga0307406_10000738 3300031901 Bacteria 18317
256 Ga0307412_10042310 3300031911 Bacteria 2960
257 Ga0307412_10058649 3300031911 Bacteria 2576
258 Ga0307416_100169581 3300032002 Bacteria 2030
259 Ga0307414_10073698 3300032004 Bacteria 2471
260 Ga0307411_10000452 3300032005 Bacteria 14127
261 Ga0307411_10008681 3300032005 Bacteria 5283
262 Ga0307411_10138370 3300032005 Bacteria 1791
263 Ga0373946_0060159 3300035171 Bacteria 1614
264 Ga0373931_0001826 3300035691 Bacteria 9251
265 Ga0373925_0009219 3300037068 Bacteria 7183
266 Ga0395905_0020378 3300037471 Bacteria 6282
267 Ga0395905_0030906 3300037471 Bacteria 5044
268 Ga0395905_0031317 3300037471 Bacteria 5007
269 Ga0395905_0052431 3300037471 Bacteria 3818
270 Ga0395905_0197298 3300037471 Bacteria 1887
271 Ga0395901_0063480 3300038443 Bacteria 3844
272 Ga0395901_0125458 3300038443 Bacteria 2698
273 Ga0436365_0289460 3300039437 Bacteria 3173
274 Ga0436365_1044326 3300039437 Bacteria 1481
275 Ga0436361_0019740 3300039447 Bacteria 4403
276 Ga0436361_0539947 3300039447 Bacteria 2723
277 Ga0439438_009647 3300041405 Bacteria 3111
278 Ga0439439_0003184 3300041406 Bacteria 3593
279 Ga0439439_0017445 3300041406 Bacteria 1765
280 Ga0439447_012380 3300041407 Bacteria 2452
281 Ga0439466_0013518 3300041411 Bacteria 2987
282 Ga0439466_0017979 3300041411 Bacteria 2540
283 Ga0439465_0003011 3300041413 Bacteria 5506
284 Ga0439431_0001148 3300041997 Bacteria 5775
285 Ga0439431_0021207 3300041997 Bacteria 1558
286 Ga0439433_0000838 3300041999 Bacteria 6088
287 Ga0439442_005221 3300042002 Bacteria 2605
288 Ga0439442_010517 3300042002 Bacteria 1877
289 Ga0439445_0000111 3300042004 Bacteria 13692
290 Ga0439432_000115 3300042006 Bacteria 26036
291 Ga0439432_002292 3300042006 Bacteria 7215
292 Ga0439449_0000592 3300042007 Bacteria 13593
293 Ga0439449_0003187 3300042007 Bacteria 6391
294 Ga0439449_0004988 3300042007 Bacteria 5105
295 Ga0439452_000809 3300042010 Bacteria 14716
296 Ga0439457_001132 3300042014 Bacteria 8018
297 Ga0450919_000104 3300042121 Bacteria 8491
298 Ga0450921_000604 3300042123 Bacteria 1791
299 Ga0450890_000470 3300042127 Bacteria 5905
300 Ga0450891_000012 3300042129 Bacteria 13677
301 Ga0450892_000656 3300042130 Bacteria 3910
302 Ga0450896_001335 3300042133 Bacteria 2999
303 Ga0450908_004232 3300042184 Bacteria 2773
304 Ga0450909_005098 3300042185 Bacteria 1887
305 Ga0439434_0000605 3300042435 Bacteria 10328
306 Ga0439434_0018311 3300042435 Bacteria 2096
307 Ga0439434_0020681 3300042435 Bacteria 1977
308 Ga0450918_000256 3300042531 Bacteria 12019
309 Ga0450893_0001708 3300042532 Bacteria 3377
310 Ga0466965_0046237 3300044683 Bacteria 2154
311 Ga0466965_0081906 3300044683 Bacteria 1632
312 Ga0466965_0089925 3300044683 Bacteria 1561
313 Ga0466966_0022355 3300044684 Bacteria 4151
314 Ga0466961_0000867 3300044693 Bacteria 18878
315 Ga0453684_0000789 3300044712 Bacteria 108459
316 Ga0466960_0008368 3300044901 Bacteria 4235
317 Ga0466959_0062817 3300045049 Bacteria 2698
318 Ga0451576_0050768 3300045051 Bacteria 4349
319 Ga0495627_009112 3300046453 Bacteria 3665
320 Ga0495591_000650 3300046458 Bacteria 25660
321 Ga0495605_0045490 3300046474 Bacteria 2163
322 Ga0495605_0074605 3300046474 Bacteria 1596
323 Ga0495610_0031668 3300046512 Bacteria 2756
324 Ga0495610_0037445 3300046512 Bacteria 2469
325 Ga0495620_0003900 3300046515 Bacteria 8508
326 Ga0495632_0020148 3300046519 Bacteria 3618
327 Ga0495637_0005176 3300046520 Bacteria 6680
328 Ga0495643_0013487 3300046522 Bacteria 4887
329 Ga0495654_0000009 3300046530 Bacteria 381872
330 Ga0495609_0049521 3300046538 Bacteria 1875
331 Ga0495597_0037610 3300046542 Bacteria 2173
332 Ga0495625_0000052 3300046660 Bacteria 190656
333 Ga0495625_0002800 3300046660 Bacteria 18376
334 Ga0495670_0104856 3300046691 Bacteria 1459
335 Ga0495660_0068628 3300046810 Bacteria 1886
336 Ga0495687_000242 3300047443 Bacteria 75081
337 Ga0496116_0000143 3300048919 Bacteria 149129
338 Ga0496117_0122560 3300048920 Bacteria 1594
339 Ga0496118_0010901 3300048921 Bacteria 8940
340 Ga0496118_0031447 3300048921 Bacteria 4400
341 Ga0496119_0000012 3300048922 Bacteria 411917
342 Ga0496119_0001268 3300048922 Bacteria 31385
343 Ga0496120_0000263 3300048923 Bacteria 87504
344 Ga0496125_0024965 3300048928 Bacteria 5484
345 Ga0501034_0000178 3300049571 Bacteria 118886
346 Ga0501034_0012784 3300049571 Bacteria 8658
347 Ga0501265_001574 3300049762 Bacteria 2571
348 Ga0501266_000060 3300049763 Bacteria 16482
349 Ga0501035_0154820 3300049822 Bacteria 1987
350 nmdc:mga0k408_23517_c1 3300050493 Bacteria 3477
351 nmdc:mga06z11_22550_c1 3300050494 Bacteria 2943
352 nmdc:mga07m45_17755_c1 3300050496 Bacteria 3828
353 nmdc:mga07m45_19295_c1 3300050496 Bacteria 3694
354 nmdc:mga07m45_2965_c1 3300050496 Bacteria 8070
355 nmdc:mga07m45_74589_c1 3300050496 Bacteria 1933
356 nmdc:mga09592_728_c1 3300050508 Bacteria 25328
357 nmdc:mga0qj67_5599_c1 3300050509 Bacteria 9178
358 Ga0500610_0001411 3300053079 Bacteria 8165
359 Ga0500607_000211 3300053121 Bacteria 53358
360 Ga0500618_014256 3300053125 Bacteria 2034
361 Ga0500622_0020197 3300053156 Bacteria 3537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2775506901 2776264265 352
2 3300046522 Ga0495643_0013487 Ga0495643_0013487_1422_2714 382
3 3300044683 Ga0466965_0089925 Ga0466965_0089925_378_1544 387
4 3300046538 Ga0495609_0049521 Ga0495609_0049521_328_1620 396
5 3300025942 Ga0207689_10065209 Ga0207689_100652092 398
6 3300006038 Ga0075365_10003593 Ga0075365_100035933 400
7 3300006177 Ga0075362_10012833 Ga0075362_100128332 400
8 3300046453 Ga0495627_009112 Ga0495627_009112_1941_3233 400
9 3300046515 Ga0495620_0003900 Ga0495620_0003900_1401_2693 400
10 3300046660 Ga0495625_0000052 Ga0495625_0000052_102454_103746 400
11 3300053121 Ga0500607_000211 Ga0500607_000211_46531_47823 400
12 3300005548 Ga0070665_100060232 Ga0070665_1000602322 401
13 3300005578 Ga0068854_100039055 Ga0068854_1000390552 401
14 3300006353 Ga0075370_10015918 Ga0075370_100159182 401
15 3300017792 Ga0163161_10000165 Ga0163161_1000016543 401
16 3300025935 Ga0207709_10038900 Ga0207709_100389002 401
17 3300037471 Ga0395905_0052431 Ga0395905_0052431_1272_2588 401
18 3300003187 JGI25151J46595_10001430 JGI25151J46595_1000143011 402
19 3300005288 Ga0065714_10067375 Ga0065714_100673756 402
20 3300006042 Ga0075368_10017774 Ga0075368_100177742 402
21 3300006048 Ga0075363_100008026 Ga0075363_1000080263 402
22 3300006177 Ga0075362_10009640 Ga0075362_100096402 402
23 3300006186 Ga0075369_10026505 Ga0075369_100265052 402
24 3300009098 Ga0105245_10108441 Ga0105245_101084412 402
25 3300025258 Ga0209129_1002422 Ga0209129_10024226 402
26 3300025294 Ga0209025_1000174 Ga0209025_100017431 402
27 3300031548 Ga0307408_100098210 Ga0307408_1000982102 402
28 3300032005 Ga0307411_10008681 Ga0307411_100086814 402
29 3300032005 Ga0307411_10138370 Ga0307411_101383701 402
30 3300041405 Ga0439438_009647 Ga0439438_009647_206_1501 402
31 3300041411 Ga0439466_0017979 Ga0439466_0017979_394_1686 402
32 3300042002 Ga0439442_005221 Ga0439442_005221_1266_2558 402
33 3300042006 Ga0439432_002292 Ga0439432_002292_1524_2819 402
34 3300042123 Ga0450921_000604 Ga0450921_000604_241_1533 402
35 3300042133 Ga0450896_001335 Ga0450896_001335_57_1349 402
36 3300042184 Ga0450908_004232 Ga0450908_004232_288_1583 402
37 3300046520 Ga0495637_0005176 Ga0495637_0005176_2327_3619 402
38 3300046691 Ga0495670_0104856 Ga0495670_0104856_38_1330 402
39 3300050496 nmdc:mga07m45_17755_c1 nmdc:mga07m45_17755_c1_130_1422 402
40 3300050496 nmdc:mga07m45_74589_c1 nmdc:mga07m45_74589_c1_512_1804 402
41 3300053079 Ga0500610_0001411 Ga0500610_0001411_5302_6594 402
42 3300005564 Ga0070664_100046583 Ga0070664_1000465834 403
43 3300009545 Ga0105237_10013705 Ga0105237_100137053 404
44 3300015261 Ga0182006_1005633 Ga0182006_10056332 404
45 3300035171 Ga0373946_0060159 Ga0373946_0060159_41_1330 404
46 3300037068 Ga0373925_0009219 Ga0373925_0009219_5443_6732 404
47 3300005563 Ga0068855_100123940 Ga0068855_1001239402 405
48 3300009551 Ga0105238_10000111 Ga0105238_1000011136 405
49 3300010375 Ga0105239_10008101 Ga0105239_100081016 405
50 3300025913 Ga0207695_10009263 Ga0207695_100092633 405
51 3300025914 Ga0207671_10003510 Ga0207671_1000351010 405
52 3300025920 Ga0207649_10094680 Ga0207649_100946801 405
53 3300025924 Ga0207694_10000199 Ga0207694_100001996 405
54 3300025981 Ga0207640_10019836 Ga0207640_100198362 405
55 3300050496 nmdc:mga07m45_2965_c1 nmdc:mga07m45_2965_c1_4809_6101 405
56 3300031649 Ga0307514_10006070 Ga0307514_1000607010 407
57 3300001979 JGI24740J21852_10014072 JGI24740J21852_100140723 409
58 3300006195 Ga0075366_10010046 Ga0075366_100100463 411
59 3300050493 nmdc:mga0k408_23517_c1 nmdc:mga0k408_23517_c1_1458_2750 411
60 3300005563 Ga0068855_100000609 Ga0068855_10000060910 413
61 3300005577 Ga0068857_100184805 Ga0068857_1001848051 413
62 3300005834 Ga0068851_10069016 Ga0068851_100690162 413
63 3300025949 Ga0207667_10000146 Ga0207667_1000014628 413
64 3300028794 Ga0307515_10017866 Ga0307515_1001786612 413
65 3300028794 Ga0307515_10079855 Ga0307515_100798552 414
66 3300042127 Ga0450890_000470 Ga0450890_000470_4359_5648 414
67 3300042129 Ga0450891_000012 Ga0450891_000012_6719_8008 414
68 3300042130 Ga0450892_000656 Ga0450892_000656_1947_3236 414
69 3300042532 Ga0450893_0001708 Ga0450893_0001708_1966_3255 414
70 3300003316 rootH1_10003154 rootH1_100031547 416
71 3300003322 rootL2_10001152 rootL2_100011522 416
72 3300031548 Ga0307408_100000114 Ga0307408_1000001143 416
73 3300039437 Ga0436365_1044326 Ga0436365_1044326_168_1424 416
74 3300042007 Ga0439449_0004988 Ga0439449_0004988_964_2241 416
75 3300045051 Ga0451576_0050768 Ga0451576_0050768_390_1679 416
76 3300046474 Ga0495605_0074605 Ga0495605_0074605_126_1418 416
77 3300046519 Ga0495632_0020148 Ga0495632_0020148_1762_3054 416
78 3300046810 Ga0495660_0068628 Ga0495660_0068628_410_1702 416
79 3300026089 Ga0207648_10023140 Ga0207648_100231403 417
80 3300026121 Ga0207683_10218613 Ga0207683_102186131 417
81 3300048928 Ga0496125_0024965 Ga0496125_0024965_816_2111 417
82 3300005367 Ga0070667_100058895 Ga0070667_1000588952 418
83 3300025986 Ga0207658_10049576 Ga0207658_100495763 418
84 3300026118 Ga0207675_100161366 Ga0207675_1001613661 418
85 3300031548 Ga0307408_100031255 Ga0307408_1000312552 418
86 3300003215 JGI25153J46596_10003502 JGI25153J46596_100035022 419
87 3300006058 Ga0075432_10010495 Ga0075432_100104952 419
88 3300009093 Ga0105240_10043932 Ga0105240_100439322 419
89 3300025297 Ga0209758_1000057 Ga0209758_100005791 419
90 3300025913 Ga0207695_10014078 Ga0207695_100140786 419
91 3300031911 Ga0307412_10058649 Ga0307412_100586492 419
92 iso_pu_bacteria 2521172590 2521560974 419
93 iso_pu_bacteria 2551306416 2553006130 419
94 iso_pu_bacteria 2643221736 2644747059 419
95 iso_pu_bacteria 2775506901 2776265203 419
96 iso_pu_bacteria 2775506902 2776267574 419
97 iso_pu_bacteria 2808606414 2809125499 419
98 iso_pu_bacteria 2818991449 2819617358 419
99 iso_pu_bacteria 2841760612 2841764104 419
100 iso_pu_bacteria 2844104063 2844108441 419
101 iso_pu_bacteria 2847085930 2847086930 419
102 iso_pu_bacteria 2851182111 2851185430 419
103 iso_pu_bacteria 2851246043 2851250539 419
104 iso_pu_bacteria 2894772417 2894777077 419
105 iso_pu_bacteria 2904439833 2904442400 419
106 iso_pu_bacteria 2904530477 2904533672 419
107 iso_pu_bacteria 2904584206 2904586626 419
108 iso_pu_bacteria 2904589729 2904591560 419
109 iso_pu_bacteria 2904601388 2904602302 419
110 iso_pu_bacteria 2919079590 2919083374 419
111 iso_pu_bacteria 8057529695 8057532092 419
112 iso_pu_bacteria 2923510766 2923514827 420
113 iso_pu_bacteria 2928130867 2928133678 420
114 3300042121 Ga0450919_000104 Ga0450919_000104_114_1406 421
115 3300042435 Ga0439434_0020681 Ga0439434_0020681_604_1896 421
116 3300042531 Ga0450918_000256 Ga0450918_000256_10586_11878 421
117 3300005355 Ga0070671_100025526 Ga0070671_1000255262 422
118 3300025931 Ga0207644_10017245 Ga0207644_100172452 422
119 3300046660 Ga0495625_0002800 Ga0495625_0002800_12605_13897 422
120 iso_pu_bacteria 2857357740 2857364729 422
121 3300002987 JGI25159J45721_1004190 JGI25159J45721_10041901 423
122 3300003856 Ga0058692_1002319 Ga0058692_10023195 423
123 3300005262 Ga0065165_1000551 Ga0065165_100055139 423
124 3300005457 Ga0070662_100101875 Ga0070662_1001018752 423
125 3300005563 Ga0068855_100010932 Ga0068855_1000109329 423
126 3300005578 Ga0068854_100009249 Ga0068854_1000092492 423
127 3300025284 Ga0209130_1000190 Ga0209130_100019016 423
128 3300025294 Ga0209025_1000783 Ga0209025_100078311 423
129 3300025912 Ga0207707_10009426 Ga0207707_100094263 423
130 3300025913 Ga0207695_10001698 Ga0207695_1000169811 423
131 3300025914 Ga0207671_10003884 Ga0207671_100038843 423
132 3300025924 Ga0207694_10000176 Ga0207694_1000017612 423
133 3300025949 Ga0207667_10002981 Ga0207667_1000298110 423
134 3300025981 Ga0207640_10030091 Ga0207640_100300913 423
135 3300032002 Ga0307416_100169581 Ga0307416_1001695811 423
136 3300039437 Ga0436365_0289460 Ga0436365_0289460_106_1383 423
137 3300039447 Ga0436361_0539947 Ga0436361_0539947_418_1695 423
138 3300041406 Ga0439439_0003184 Ga0439439_0003184_1803_3080 423
139 3300041407 Ga0439447_012380 Ga0439447_012380_858_2135 423
140 3300041411 Ga0439466_0013518 Ga0439466_0013518_237_1514 423
141 3300041413 Ga0439465_0003011 Ga0439465_0003011_2429_3706 423
142 3300041997 Ga0439431_0001148 Ga0439431_0001148_3483_4760 423
143 3300041997 Ga0439431_0021207 Ga0439431_0021207_34_1311 423
144 3300041999 Ga0439433_0000838 Ga0439433_0000838_4448_5725 423
145 3300042002 Ga0439442_010517 Ga0439442_010517_334_1611 423
146 3300042004 Ga0439445_0000111 Ga0439445_0000111_10915_12192 423
147 3300042006 Ga0439432_000115 Ga0439432_000115_7121_8398 423
148 3300042007 Ga0439449_0003187 Ga0439449_0003187_365_1642 423
149 3300042010 Ga0439452_000809 Ga0439452_000809_12643_13920 423
150 3300042014 Ga0439457_001132 Ga0439457_001132_5094_6371 423
151 3300042185 Ga0450909_005098 Ga0450909_005098_137_1414 423
152 3300042435 Ga0439434_0000605 Ga0439434_0000605_1954_3231 423
153 3300044683 Ga0466965_0046237 Ga0466965_0046237_818_2095 423
154 3300044683 Ga0466965_0081906 Ga0466965_0081906_64_1338 423
155 3300044684 Ga0466966_0022355 Ga0466966_0022355_382_1659 423
156 3300044693 Ga0466961_0000867 Ga0466961_0000867_1330_2607 423
157 3300044901 Ga0466960_0008368 Ga0466960_0008368_1059_2333 423
158 3300045049 Ga0466959_0062817 Ga0466959_0062817_1232_2509 423
159 3300046458 Ga0495591_000650 Ga0495591_000650_5415_6692 423
160 3300046474 Ga0495605_0045490 Ga0495605_0045490_541_1818 423
161 3300046512 Ga0495610_0031668 Ga0495610_0031668_559_1836 423
162 3300046530 Ga0495654_0000009 Ga0495654_0000009_33961_35238 423
163 3300048919 Ga0496116_0000143 Ga0496116_0000143_11582_12859 423
164 3300048922 Ga0496119_0000012 Ga0496119_0000012_17797_19074 423
165 3300048922 Ga0496119_0001268 Ga0496119_0001268_6338_7615 423
166 3300048923 Ga0496120_0000263 Ga0496120_0000263_21783_23060 423
167 3300049571 Ga0501034_0012784 Ga0501034_0012784_3065_4339 423
168 3300049822 Ga0501035_0154820 Ga0501035_0154820_101_1375 423
169 iso_pu_bacteria 639633007 639785327 423
170 3300006195 Ga0075366_10013027 Ga0075366_100130272 425
171 3300006353 Ga0075370_10026369 Ga0075370_100263693 425
172 3300009148 Ga0105243_10102091 Ga0105243_101020912 425
173 3300025933 Ga0207706_10229159 Ga0207706_102291592 425
174 3300046512 Ga0495610_0037445 Ga0495610_0037445_81_1364 425
175 3300047443 Ga0495687_000242 Ga0495687_000242_26766_28046 425
176 3300050496 nmdc:mga07m45_19295_c1 nmdc:mga07m45_19295_c1_954_2234 425
177 3300053156 Ga0500622_0020197 Ga0500622_0020197_1538_2821 425
178 iso_pu_bacteria 2511231003 2511251062 425
179 iso_pu_bacteria 2585428062 2587758712 425
180 iso_pu_bacteria 2643221544 2643746305 425
181 iso_pu_bacteria 2643221628 2644158810 425
182 iso_pu_bacteria 2643221639 2644223083 425
183 iso_pu_bacteria 2643221646 2644258014 425
184 iso_pu_bacteria 2904434214 2904437823 425
185 iso_pu_bacteria 2945972063 2945972660 425
186 3300002704 JGI25155J39150_1000035 JGI25155J39150_100003517 426
187 3300002705 JGI25156J39149_1000012 JGI25156J39149_100001268 426
188 3300002738 JGI25154J39366_1000029 JGI25154J39366_1000029103 426
189 3300002741 JGI25157J39369_1000014 JGI25157J39369_100001468 426
190 3300002987 JGI25159J45721_1000054 JGI25159J45721_100005454 426
191 3300003187 JGI25151J46595_10003954 JGI25151J46595_100039542 426
192 3300003354 JGI25160J50197_1000088 JGI25160J50197_100008843 426
193 3300003354 JGI25160J50197_1000119 JGI25160J50197_100011954 426
194 3300003374 JGI25161J50226_1000056 JGI25161J50226_100005654 426
195 3300003771 Ga0055526_1004199 Ga0055526_10041997 426
196 3300003773 Ga0055537_1000339 Ga0055537_100033926 426
197 3300003775 Ga0055524_1000299 Ga0055524_100029926 426
198 3300003781 Ga0055536_1020146 Ga0055536_10201461 426
199 3300003784 Ga0055534_1003838 Ga0055534_10038383 426
200 3300003790 Ga0055528_1002865 Ga0055528_10028657 426
201 3300003791 Ga0055530_10000854 Ga0055530_100008545 426
202 3300003792 Ga0055540_1000818 Ga0055540_10008185 426
203 3300003794 Ga0055531_10000935 Ga0055531_100009355 426
204 3300004625 Ga0055543_1000755 Ga0055543_100075511 426
205 3300005578 Ga0068854_100119947 Ga0068854_1001199472 426
206 3300006038 Ga0075365_10024460 Ga0075365_100244602 426
207 3300006177 Ga0075362_10027987 Ga0075362_100279872 426
208 3300006178 Ga0075367_10003071 Ga0075367_100030713 426
209 3300009093 Ga0105240_10006221 Ga0105240_1000622112 426
210 3300009174 Ga0105241_10146119 Ga0105241_101461193 426
211 3300009545 Ga0105237_10015986 Ga0105237_100159867 426
212 3300009551 Ga0105238_10000102 Ga0105238_1000010218 426
213 3300010375 Ga0105239_10001763 Ga0105239_1000176318 426
214 3300014969 Ga0157376_10034886 Ga0157376_100348863 426
215 3300015261 Ga0182006_1001634 Ga0182006_100163410 426
216 3300015683 Ga0183362_10002 Ga0183362_100021135 426
217 3300025206 Ga0209435_100002 Ga0209435_100002471 426
218 3300025246 Ga0209646_1000001 Ga0209646_10000012614 426
219 3300025250 Ga0209026_1000040 Ga0209026_1000040161 426
220 3300025256 Ga0209759_1000001 Ga0209759_10000012245 426
221 3300025263 Ga0209565_1000016 Ga0209565_1000016301 426
222 3300025273 Ga0209673_1000995 Ga0209673_100099521 426
223 3300025284 Ga0209130_1000040 Ga0209130_100004043 426
224 3300025284 Ga0209130_1002302 Ga0209130_10023026 426
225 3300025291 Ga0209675_1000401 Ga0209675_10004017 426
226 3300025292 Ga0209676_1000023 Ga0209676_1000023524 426
227 3300025294 Ga0209025_1001126 Ga0209025_100112632 426
228 3300025294 Ga0209025_1030704 Ga0209025_10307042 426
229 3300025295 Ga0209564_1001307 Ga0209564_10013077 426
230 3300025298 Ga0209050_1000022 Ga0209050_1000022506 426
231 3300025298 Ga0209050_1010297 Ga0209050_10102974 426
232 3300025299 Ga0209256_1000001 Ga0209256_10000011995 426
233 3300025302 Ga0207426_1000188 Ga0207426_100018843 426
234 3300025302 Ga0207426_1002218 Ga0207426_100221810 426
235 3300025303 Ga0209051_1000013 Ga0209051_1000013506 426
236 3300025304 Ga0209257_1001435 Ga0209257_10014355 426
237 3300031238 Ga0265332_10005816 Ga0265332_100058162 426
238 3300031548 Ga0307408_100001459 Ga0307408_10000145914 426
239 3300031649 Ga0307514_10000560 Ga0307514_1000056060 426
240 3300031711 Ga0265314_10099800 Ga0265314_100998002 426
241 3300031911 Ga0307412_10042310 Ga0307412_100423102 426
242 3300037471 Ga0395905_0031317 Ga0395905_0031317_3455_4738 426
243 3300038443 Ga0395901_0063480 Ga0395901_0063480_1678_2961 426
244 3300041406 Ga0439439_0017445 Ga0439439_0017445_13_1296 426
245 3300042007 Ga0439449_0000592 Ga0439449_0000592_7511_8794 426
246 3300050494 nmdc:mga06z11_22550_c1 nmdc:mga06z11_22550_c1_1338_2621 426
247 3300009093 Ga0105240_10040595 Ga0105240_100405956 427
248 3300025913 Ga0207695_10217555 Ga0207695_102175551 427
249 3300026041 Ga0207639_10261766 Ga0207639_102617661 427
250 3300031649 Ga0307514_10017249 Ga0307514_100172494 428
251 3300038443 Ga0395901_0125458 Ga0395901_0125458_254_1561 428
252 3300044712 Ga0453684_0000789 Ga0453684_0000789_81221_82510 428
253 3300002773 JGI25152J39213_1002123 JGI25152J39213_10021232 429
254 3300003771 Ga0055526_1004858 Ga0055526_10048587 429
255 3300005328 Ga0070676_10009475 Ga0070676_100094754 429
256 3300005331 Ga0070670_100025939 Ga0070670_1000259393 429
257 3300005331 Ga0070670_100085791 Ga0070670_1000857911 429
258 3300005335 Ga0070666_10002707 Ga0070666_100027079 429
259 3300005338 Ga0068868_100011890 Ga0068868_1000118905 429
260 3300005344 Ga0070661_100141153 Ga0070661_1001411531 429
261 3300005344 Ga0070661_100186668 Ga0070661_1001866682 429
262 3300005353 Ga0070669_100002807 Ga0070669_1000028078 429
263 3300005354 Ga0070675_100002247 Ga0070675_1000022474 429
264 3300005354 Ga0070675_100006876 Ga0070675_1000068767 429
265 3300005355 Ga0070671_100078145 Ga0070671_1000781452 429
266 3300005364 Ga0070673_100005124 Ga0070673_1000051246 429
267 3300005364 Ga0070673_100008576 Ga0070673_1000085764 429
268 3300005367 Ga0070667_100196697 Ga0070667_1001966972 429
269 3300005435 Ga0070714_100209043 Ga0070714_1002090432 429
270 3300005455 Ga0070663_100131479 Ga0070663_1001314792 429
271 3300005456 Ga0070678_100013133 Ga0070678_1000131332 429
272 3300005457 Ga0070662_100014736 Ga0070662_1000147363 429
273 3300005459 Ga0068867_100000984 Ga0068867_10000098418 429
274 3300005459 Ga0068867_100041949 Ga0068867_1000419493 429
275 3300005466 Ga0070685_10001923 Ga0070685_100019232 429
276 3300005466 Ga0070685_10041942 Ga0070685_100419422 429
277 3300005539 Ga0068853_100035960 Ga0068853_1000359602 429
278 3300005539 Ga0068853_100102275 Ga0068853_1001022751 429
279 3300005543 Ga0070672_100007829 Ga0070672_1000078297 429
280 3300005548 Ga0070665_100000227 Ga0070665_10000022768 429
281 3300005563 Ga0068855_100214425 Ga0068855_1002144252 429
282 3300005578 Ga0068854_100010398 Ga0068854_1000103982 429
283 3300005616 Ga0068852_100050942 Ga0068852_1000509422 429
284 3300005618 Ga0068864_100046205 Ga0068864_1000462052 429
285 3300005834 Ga0068851_10001399 Ga0068851_100013991 429
286 3300005834 Ga0068851_10061318 Ga0068851_100613182 429
287 3300005842 Ga0068858_100004031 Ga0068858_1000040319 429
288 3300006195 Ga0075366_10000282 Ga0075366_100002829 429
289 3300006358 Ga0068871_100094660 Ga0068871_1000946602 429
290 3300006846 Ga0075430_100010626 Ga0075430_1000106267 429
291 3300006846 Ga0075430_100019371 Ga0075430_1000193714 429
292 3300006880 Ga0075429_100000391 Ga0075429_10000039125 429
293 3300006881 Ga0068865_100123403 Ga0068865_1001234032 429
294 3300009093 Ga0105240_10001044 Ga0105240_1000104437 429
295 3300009093 Ga0105240_10005295 Ga0105240_1000529514 429
296 3300009098 Ga0105245_10084626 Ga0105245_100846262 429
297 3300009174 Ga0105241_10186182 Ga0105241_101861822 429
298 3300009545 Ga0105237_10001808 Ga0105237_1000180825 429
299 3300009551 Ga0105238_10006969 Ga0105238_1000696910 429
300 3300009553 Ga0105249_10007119 Ga0105249_100071195 429
301 3300010375 Ga0105239_10008675 Ga0105239_100086754 429
302 3300011119 Ga0105246_10049156 Ga0105246_100491562 429
303 3300013296 Ga0157374_10231376 Ga0157374_102313762 429
304 3300013308 Ga0157375_10248491 Ga0157375_102484912 429
305 3300017792 Ga0163161_10051349 Ga0163161_100513492 429
306 3300025294 Ga0209025_1016362 Ga0209025_10163624 429
307 3300025295 Ga0209564_1004644 Ga0209564_10046447 429
308 3300025315 Ga0207697_10004886 Ga0207697_100048865 429
309 3300025321 Ga0207656_10011573 Ga0207656_100115731 429
310 3300025893 Ga0207682_10035993 Ga0207682_100359932 429
311 3300025903 Ga0207680_10001300 Ga0207680_100013004 429
312 3300025904 Ga0207647_10000500 Ga0207647_1000050010 429
313 3300025907 Ga0207645_10042805 Ga0207645_100428052 429
314 3300025908 Ga0207643_10008486 Ga0207643_100084864 429
315 3300025913 Ga0207695_10000007 Ga0207695_10000007193 429
316 3300025913 Ga0207695_10014701 Ga0207695_100147016 429
317 3300025913 Ga0207695_10022351 Ga0207695_100223512 429
318 3300025924 Ga0207694_10003986 Ga0207694_100039862 429
319 3300025924 Ga0207694_10005080 Ga0207694_100050804 429
320 3300025925 Ga0207650_10008863 Ga0207650_100088636 429
321 3300025925 Ga0207650_10010601 Ga0207650_100106013 429
322 3300025925 Ga0207650_10048832 Ga0207650_100488322 429
323 3300025925 Ga0207650_10129691 Ga0207650_101296912 429
324 3300025926 Ga0207659_10010293 Ga0207659_100102932 429
325 3300025931 Ga0207644_10018746 Ga0207644_100187463 429
326 3300025933 Ga0207706_10020155 Ga0207706_100201555 429
327 3300025937 Ga0207669_10071463 Ga0207669_100714632 429
328 3300025938 Ga0207704_10023016 Ga0207704_100230163 429
329 3300025961 Ga0207712_10000169 Ga0207712_1000016913 429
330 3300025972 Ga0207668_10041697 Ga0207668_100416972 429
331 3300025981 Ga0207640_10001595 Ga0207640_100015955 429
332 3300025986 Ga0207658_10197313 Ga0207658_101973132 429
333 3300026035 Ga0207703_10001066 Ga0207703_1000106615 429
334 3300026041 Ga0207639_10001687 Ga0207639_1000168713 429
335 3300026067 Ga0207678_10152761 Ga0207678_101527612 429
336 3300026089 Ga0207648_10011610 Ga0207648_100116105 429
337 3300026089 Ga0207648_10011635 Ga0207648_100116355 429
338 3300026095 Ga0207676_10016021 Ga0207676_100160213 429
339 3300026121 Ga0207683_10031899 Ga0207683_100318992 429
340 3300026142 Ga0207698_10046129 Ga0207698_100461291 429
341 3300026142 Ga0207698_10158013 Ga0207698_101580132 429
342 3300028379 Ga0268266_10000006 Ga0268266_10000006634 429
343 3300028794 Ga0307515_10000047 Ga0307515_10000047205 429
344 3300028794 Ga0307515_10001293 Ga0307515_1000129342 429
345 3300028794 Ga0307515_10001625 Ga0307515_1000162540 429
346 3300028794 Ga0307515_10021154 Ga0307515_100211547 429
347 3300028794 Ga0307515_10029411 Ga0307515_100294115 429
348 3300030522 Ga0307512_10050142 Ga0307512_100501422 429
349 3300031456 Ga0307513_10001531 Ga0307513_100015318 429
350 3300031456 Ga0307513_10019211 Ga0307513_100192112 429
351 3300031548 Ga0307408_100000939 Ga0307408_10000093915 429
352 3300031649 Ga0307514_10000850 Ga0307514_1000085040 429
353 3300031730 Ga0307516_10002036 Ga0307516_1000203619 429
354 3300031901 Ga0307406_10000738 Ga0307406_100007387 429
355 3300032004 Ga0307414_10073698 Ga0307414_100736982 429
356 3300032005 Ga0307411_10000452 Ga0307411_100004528 429
357 3300035691 Ga0373931_0001826 Ga0373931_0001826_5176_6468 429
358 3300037471 Ga0395905_0020378 Ga0395905_0020378_3515_4807 429
359 3300037471 Ga0395905_0030906 Ga0395905_0030906_3737_5029 429
360 3300037471 Ga0395905_0197298 Ga0395905_0197298_451_1743 429
361 3300042435 Ga0439434_0018311 Ga0439434_0018311_499_1800 429
362 3300046542 Ga0495597_0037610 Ga0495597_0037610_345_1694 429
363 3300047443 Ga0495687_000242 Ga0495687_000242_8559_9908 429
364 3300048920 Ga0496117_0122560 Ga0496117_0122560_175_1470 429
365 3300048921 Ga0496118_0010901 Ga0496118_0010901_3743_5035 429
366 3300048921 Ga0496118_0031447 Ga0496118_0031447_1006_2301 429
367 3300049571 Ga0501034_0000178 Ga0501034_0000178_21888_23177 429
368 3300049762 Ga0501265_001574 Ga0501265_001574_1126_2418 429
369 3300049763 Ga0501266_000060 Ga0501266_000060_7817_9109 429
370 3300050508 nmdc:mga09592_728_c1 nmdc:mga09592_728_c1_6857_8149 429
371 3300050509 nmdc:mga0qj67_5599_c1 nmdc:mga0qj67_5599_c1_4813_6105 429
372 3300053125 Ga0500618_014256 Ga0500618_014256_84_1424 429
373 3300005330 Ga0070690_100006071 Ga0070690_1000060712 430
374 3300005719 Ga0068861_100081576 Ga0068861_1000815762 430
375 3300039447 Ga0436361_0019740 Ga0436361_0019740_212_1543 431
376 iso_pu_bacteria 8002869464 8002869580 431
377 3300001915 JGI24741J21665_1001602 JGI24741J21665_10016026 432
378 3300001979 JGI24740J21852_10000121 JGI24740J21852_100001217 432
379 3300003751 Ga0055538_1000231 Ga0055538_100023122 432
380 3300003841 Ga0055541_1000165 Ga0055541_10001658 432
381 3300005344 Ga0070661_100010840 Ga0070661_1000108402 432
382 3300005455 Ga0070663_100000248 Ga0070663_10000024823 432
383 3300005564 Ga0070664_100000612 Ga0070664_1000006125 432
384 3300005614 Ga0068856_100001062 Ga0068856_10000106224 432
385 3300010375 Ga0105239_10116194 Ga0105239_101161942 432
386 3300013102 Ga0157371_10001222 Ga0157371_100012225 432
387 3300013307 Ga0157372_10001268 Ga0157372_100012685 432
388 3300025224 Ga0209784_100066 Ga0209784_10006663 432
389 3300025225 Ga0209566_100125 Ga0209566_10012534 432
390 3300025226 Ga0209674_100344 Ga0209674_10034419 432
391 3300025913 Ga0207695_10037817 Ga0207695_100378173 432
392 3300025920 Ga0207649_10006487 Ga0207649_100064875 432
393 3300025945 Ga0207679_10000490 Ga0207679_1000049023 432
394 3300026067 Ga0207678_10000901 Ga0207678_1000090122 432
395 3300026078 Ga0207702_10001124 Ga0207702_1000112423 432
396 3300026116 Ga0207674_10153419 Ga0207674_101534192 432
397 iso_pu_bacteria 2919046199 2919049822 432

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

93

174

0.93

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

96

165

0.91

PF01266

DAO

FAD dependent oxidoreductase

93

456

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hdh-assembly1.cif.gz_B pig heart short chain l-3-hydroxyacyl coa dehydrogenase revisited: sequence analysis and crystal structure determination 0.9173 30 60
2y0d-assembly1.cif.gz_D bcec mutation y10k 0.9136 28 58
6eod-assembly1.cif.gz_H structure of reductive aminase from aspergillus terreus in complex with nadph 0.9136 28 56
6fqz-assembly1.cif.gz_B plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate 0.9131 28 58
2y0d-assembly1.cif.gz_C bcec mutation y10k 0.9131 28 58
ID Description Score Start End Superfamily
af_Q46811_547_618_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 1.002 31 62 3.40.50.720
af_K8F7V7_1826_1944_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9867 30 62 3.50.50.60
3fg2P02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9866 30 64 3.50.50.60
2ivdA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9855 30 62 3.50.50.60
5l1nB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9853 30 62 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A1N7NG36-F1-model_v4 Glycine/D-amino acid oxidase 0.9805 4 431 GO:0005737
AF-A0A529P2Y1-F1-model_v4 FAD-binding oxidoreductase 0.9755 50 432 GO:0005737
AF-A0A1N7NG36-F1-model_v4 Glycine/D-amino acid oxidase 0.9737 4 431 GO:0005737
AF-A0A0Q4W600-F1-model_v4 deleted 0.9705 4 432
AF-A0A3M5YXT7-F1-model_v4 deleted 0.9694 203 432

Feature Viewer

pLDDT pTM Quality
91.59 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map