F433400

General Info

Members Datasets Scaffolds Average Seq Length
396 237 792 257

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100052792|Ga0070683_1000527922
Length 290
Sequence MESGARFGGEPAPRPYNGRVRALRTIRVTRYVTPLREGGSLPAIVDADDDGLYVLKFRGAGQGPRALIAELISGEIARTLGLPVPEIVLAELDPDLARTEPDPEIHQLIYDSGGLNLAIDYLPGSVSFDPAVHRIGDELASRIVWLDALVSNVDRTARNTNMLMWHRKPWLIDHGATLFFHHTPEWDADDTRARAPFPLIKDHVLLRSATRLAAEDDALARLLTPDAIDDILELVPDHWLANPQGAPGTTPLERAEASAAAARLRSAYRRYLCVRLEAPRAFVEEAAHAR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
176 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
177 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
178 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
179 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
180 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
181 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
184 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
185 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
219 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
220 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
230 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
231 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
232 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
233 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
234 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
235 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.54
Nodule 0
Rhizoplane 5.05
Rhizosphere 84.34
Stem 0
Stem Tuber 0
Unclassified 3.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100052792 3300005329 Bacteria 3767
2 SwRhRL2b_contig_3721840 2162886007 Bacteria 1965
3 JGI24035J26624_1006377 3300002126 Bacteria 1137
4 JGI25154J39366_1000019 3300002738 Bacteria 234419
5 rootH1_10145152 3300003316 Bacteria 2113
6 rootH2_10024374 3300003320 Bacteria 22689
7 rootL2_10288706 3300003322 Bacteria 1296
8 rootH1_10271045 3300003323 Bacteria 1348
9 Ga0055531_10000592 3300003794 Bacteria 31640
10 Ga0065704_10084984 3300005289 Bacteria 3275
11 Ga0065712_10072680 3300005290 Bacteria 4656
12 Ga0065715_10150809 3300005293 Bacteria 1731
13 Ga0065707_10303718 3300005295 Bacteria 999
14 Ga0070658_10154634 3300005327 Bacteria 1922
15 Ga0070658_10198248 3300005327 Bacteria 1693
16 Ga0070690_100035076 3300005330 Bacteria 3146
17 Ga0070670_100009802 3300005331 Bacteria 8183
18 Ga0070670_100061572 3300005331 Bacteria 3221
19 Ga0070670_100241840 3300005331 Bacteria 1571
20 Ga0070677_10001910 3300005333 Bacteria 6591
21 Ga0070677_10006845 3300005333 Bacteria 3788
22 Ga0068869_100070672 3300005334 Bacteria 2583
23 Ga0070666_10106812 3300005335 Bacteria 1934
24 Ga0070666_10159370 3300005335 Bacteria 1577
25 Ga0070680_100005471 3300005336 Bacteria 9611
26 Ga0070680_100085283 3300005336 Bacteria 2609
27 Ga0070682_100444913 3300005337 Bacteria 991
28 Ga0068868_100192670 3300005338 Bacteria 1696
29 Ga0068868_100241253 3300005338 Bacteria 1518
30 Ga0070660_100003441 3300005339 Bacteria 10889
31 Ga0070660_100074229 3300005339 Bacteria 2661
32 Ga0070660_100344896 3300005339 Bacteria 1226
33 Ga0070660_100432267 3300005339 Bacteria 1091
34 Ga0070689_100036373 3300005340 Bacteria 3766
35 Ga0070691_10116300 3300005341 Bacteria 1342
36 Ga0070661_100002694 3300005344 Bacteria 12166
37 Ga0070661_100260466 3300005344 Bacteria 1341
38 Ga0070692_10000492 3300005345 Bacteria 12139
39 Ga0070692_10102273 3300005345 Bacteria 1573
40 Ga0070668_100291473 3300005347 Bacteria 1366
41 Ga0070675_100000001 3300005354 Bacteria 448137
42 Ga0070675_100026341 3300005354 Bacteria 4666
43 Ga0070671_100064453 3300005355 Bacteria 3052
44 Ga0070673_100041891 3300005364 Bacteria 3525
45 Ga0070673_100272503 3300005364 Bacteria 1482
46 Ga0070688_100053093 3300005365 Bacteria 2534
47 Ga0070659_100276481 3300005366 Bacteria 1396
48 Ga0070667_100000065 3300005367 Bacteria 135172
49 Ga0070667_100019631 3300005367 Bacteria 5606
50 Ga0070667_100229003 3300005367 Bacteria 1657
51 Ga0070667_100273831 3300005367 Bacteria 1514
52 Ga0070667_100375019 3300005367 Bacteria 1291
53 Ga0070713_100245642 3300005436 Bacteria 1631
54 Ga0070700_100035582 3300005441 Bacteria 3014
55 Ga0070694_100245260 3300005444 Bacteria 1353
56 Ga0070708_100069042 3300005445 Unclassified 3177
57 Ga0070663_100000317 3300005455 Bacteria 24999
58 Ga0070663_100273095 3300005455 Bacteria 1345
59 Ga0070678_100139703 3300005456 Bacteria 1937
60 Ga0070678_100307902 3300005456 Bacteria 1348
61 Ga0070681_10002016 3300005458 Bacteria 18381
62 Ga0070681_10040508 3300005458 Bacteria 4667
63 Ga0070681_10264717 3300005458 Bacteria 1631
64 Ga0070706_100076886 3300005467 Unclassified 3089
65 Ga0070707_100078194 3300005468 Unclassified 3191
66 Ga0070679_100000386 3300005530 Bacteria 37602
67 Ga0070679_100004692 3300005530 Bacteria 12607
68 Ga0070679_100021938 3300005530 Bacteria 6237
69 Ga0070679_100088140 3300005530 Bacteria 3090
70 Ga0070697_100024757 3300005536 Unclassified 4780
71 Ga0068853_100003887 3300005539 Bacteria 11450
72 Ga0068853_100010502 3300005539 Bacteria 7487
73 Ga0068853_100269723 3300005539 Bacteria 1567
74 Ga0068853_100787268 3300005539 Bacteria 910
75 Ga0070686_100104190 3300005544 Bacteria 1921
76 Ga0070695_100206573 3300005545 Bacteria 1407
77 Ga0070695_100400800 3300005545 Bacteria 1040
78 Ga0070696_100086486 3300005546 Unclassified 2226
79 Ga0070665_100000126 3300005548 Bacteria 146495
80 Ga0070665_100016242 3300005548 Bacteria 7468
81 Ga0068855_100007506 3300005563 Bacteria 13203
82 Ga0068855_100008584 3300005563 Bacteria 12354
83 Ga0068855_100026287 3300005563 Bacteria 6964
84 Ga0068857_100011139 3300005577 Bacteria 7820
85 Ga0068857_100114859 3300005577 Bacteria 2422
86 Ga0068857_100185150 3300005577 Bacteria 1895
87 Ga0068854_100067098 3300005578 Bacteria 2613
88 Ga0068854_100113978 3300005578 Bacteria 2043
89 Ga0070702_100109162 3300005615 Bacteria 1712
90 Ga0068852_100171519 3300005616 Bacteria 2034
91 Ga0068852_100236407 3300005616 Bacteria 1744
92 Ga0068859_100000180 3300005617 Bacteria 61976
93 Ga0068859_100005511 3300005617 Bacteria 12889
94 Ga0068859_100782258 3300005617 Bacteria 1042
95 Ga0068864_100020649 3300005618 Bacteria 5511
96 Ga0068864_100358849 3300005618 Bacteria 1377
97 Ga0068861_100418780 3300005719 Bacteria 1193
98 Ga0068870_10331620 3300005840 Bacteria 970
99 Ga0068863_100057486 3300005841 Bacteria 3681
100 Ga0068863_100070639 3300005841 Bacteria 3302
101 Ga0068863_100086164 3300005841 Bacteria 2976
102 Ga0068863_100324679 3300005841 Bacteria 1495
103 Ga0068858_100040190 3300005842 Bacteria 4336
104 Ga0068858_100104986 3300005842 Bacteria 2636
105 Ga0068862_100001242 3300005844 Bacteria 24005
106 Ga0068862_100272467 3300005844 Bacteria 1548
107 Ga0081455_10011714 3300005937 Bacteria 8791
108 Ga0070717_10102371 3300006028 Unclassified 2433
109 Ga0075364_10085099 3300006051 Bacteria 2094
110 Ga0075366_10244061 3300006195 Bacteria 1095
111 Ga0068871_100098689 3300006358 Bacteria 2444
112 Ga0075428_100000169 3300006844 Bacteria 60729
113 Ga0075428_100003108 3300006844 Bacteria 18124
114 Ga0075428_100045412 3300006844 Bacteria 4826
115 Ga0075428_100092237 3300006844 Bacteria 3302
116 Ga0075430_100013013 3300006846 Bacteria 7091
117 Ga0075430_100064882 3300006846 Bacteria 3068
118 Ga0075431_100001534 3300006847 Bacteria 21414
119 Ga0075431_100149533 3300006847 Bacteria 2405
120 Ga0075434_100207506 3300006871 Bacteria 1980
121 Ga0075429_100131126 3300006880 Bacteria 2192
122 Ga0068865_100145528 3300006881 Bacteria 1792
123 Ga0068865_100149086 3300006881 Bacteria 1772
124 Ga0068865_100367353 3300006881 Bacteria 1170
125 Ga0097620_100000180 3300006931 Bacteria 61976
126 Ga0097620_100005511 3300006931 Bacteria 12889
127 Ga0097620_100782307 3300006931 Bacteria 1042
128 Ga0075435_100017236 3300007076 Bacteria 5462
129 Ga0099795_10053272 3300007788 Bacteria 1480
130 Ga0105251_10000108 3300009011 Bacteria 81679
131 Ga0105240_10003430 3300009093 Bacteria 24640
132 Ga0105240_10124986 3300009093 Bacteria 3093
133 Ga0105240_10164409 3300009093 Bacteria 2633
134 Ga0105240_10452586 3300009093 Bacteria 1436
135 Ga0111539_10038326 3300009094 Bacteria 5781
136 Ga0111539_10091018 3300009094 Bacteria 3585
137 Ga0105245_10000043 3300009098 Bacteria 136604
138 Ga0105245_10024491 3300009098 Bacteria 5300
139 Ga0105245_10412651 3300009098 Bacteria 1352
140 Ga0105247_10305138 3300009101 Bacteria 1106
141 Ga0114129_10001590 3300009147 Bacteria 30832
142 Ga0105243_10255956 3300009148 Bacteria 1565
143 Ga0105243_10354837 3300009148 Bacteria 1348
144 Ga0105242_10008373 3300009176 Bacteria 7946
145 Ga0105242_10088886 3300009176 Bacteria 2596
146 Ga0105248_10006986 3300009177 Bacteria 12369
147 Ga0105248_10088597 3300009177 Bacteria 3483
148 Ga0105248_10318970 3300009177 Bacteria 1750
149 Ga0105237_10004639 3300009545 Bacteria 15836
150 Ga0105237_10062196 3300009545 Bacteria 3733
151 Ga0105237_10336927 3300009545 Bacteria 1513
152 Ga0105238_10021514 3300009551 Bacteria 6569
153 Ga0105249_10000367 3300009553 Bacteria 44838
154 Ga0105249_10090975 3300009553 Bacteria 2854
155 Ga0105239_10016337 3300010375 Bacteria 8208
156 Ga0105239_10019611 3300010375 Bacteria 7463
157 Ga0105239_10250665 3300010375 Bacteria 1988
158 Ga0105246_10193811 3300011119 Bacteria 1575
159 Ga0157373_10052841 3300013100 Bacteria 2889
160 Ga0157371_10000618 3300013102 Bacteria 42299
161 Ga0157371_10004645 3300013102 Bacteria 11898
162 Ga0157371_10032961 3300013102 Bacteria 3725
163 Ga0157371_10241932 3300013102 Bacteria 1298
164 Ga0157370_10000242 3300013104 Bacteria 69678
165 Ga0157370_10000457 3300013104 Bacteria 51070
166 Ga0157370_10001541 3300013104 Bacteria 28510
167 Ga0157369_10019989 3300013105 Bacteria 7488
168 Ga0157374_10033084 3300013296 Bacteria 4715
169 Ga0157374_10033550 3300013296 Bacteria 4684
170 Ga0157374_10130307 3300013296 Bacteria 2434
171 Ga0163162_10514346 3300013306 Bacteria 1327
172 Ga0157375_10105965 3300013308 Bacteria 2902
173 Ga0157375_10138680 3300013308 Bacteria 2557
174 Ga0157375_10229089 3300013308 Bacteria 2017
175 Ga0163163_10001605 3300014325 Bacteria 19004
176 Ga0157380_10216080 3300014326 Bacteria 1712
177 Ga0157380_10424579 3300014326 Unclassified 1269
178 Ga0157376_10188372 3300014969 Bacteria 1890
179 Ga0163161_10099157 3300017792 Bacteria 2166
180 Ga0163161_10201991 3300017792 Bacteria 1532
181 Ga0209758_1004347 3300025297 Bacteria 11868
182 Ga0209257_1000006 3300025304 Bacteria 1570111
183 Ga0207697_10002047 3300025315 Bacteria 10635
184 Ga0207713_1000595 3300025735 Bacteria 35708
185 Ga0207710_10168739 3300025900 Bacteria 1069
186 Ga0207688_10102161 3300025901 Bacteria 1657
187 Ga0207680_10030984 3300025903 Bacteria 3025
188 Ga0207680_10144211 3300025903 Bacteria 1582
189 Ga0207643_10213516 3300025908 Bacteria 1178
190 Ga0207705_10037591 3300025909 Bacteria 3464
191 Ga0207684_10006362 3300025910 Bacteria 10764
192 Ga0207707_10000659 3300025912 Bacteria 34203
193 Ga0207707_10005489 3300025912 Bacteria 11084
194 Ga0207695_10008285 3300025913 Bacteria 13036
195 Ga0207695_10153884 3300025913 Bacteria 2236
196 Ga0207695_10266287 3300025913 Bacteria 1610
197 Ga0207671_10190096 3300025914 Unclassified 1601
198 Ga0207660_10001881 3300025917 Bacteria 13992
199 Ga0207660_10060502 3300025917 Bacteria 2723
200 Ga0207662_10061895 3300025918 Bacteria 2248
201 Ga0207657_10015707 3300025919 Bacteria 7322
202 Ga0207657_10040504 3300025919 Bacteria 4127
203 Ga0207649_10003722 3300025920 Bacteria 8313
204 Ga0207652_10000074 3300025921 Bacteria 108397
205 Ga0207652_10000276 3300025921 Bacteria 53325
206 Ga0207652_10002553 3300025921 Bacteria 15275
207 Ga0207652_10384387 3300025921 Bacteria 1267
208 Ga0207646_10076310 3300025922 Unclassified 2994
209 Ga0207694_10003748 3300025924 Bacteria 12049
210 Ga0207650_10027871 3300025925 Bacteria 4045
211 Ga0207659_10000004 3300025926 Bacteria 476977
212 Ga0207659_10015160 3300025926 Bacteria 4986
213 Ga0207659_10139149 3300025926 Bacteria 1883
214 Ga0207687_10000024 3300025927 Bacteria 187490
215 Ga0207687_10019256 3300025927 Bacteria 4520
216 Ga0207687_10132726 3300025927 Bacteria 1879
217 Ga0207644_10097528 3300025931 Bacteria 2202
218 Ga0207690_10021548 3300025932 Bacteria 3998
219 Ga0207690_10085807 3300025932 Bacteria 2211
220 Ga0207706_10294932 3300025933 Bacteria 1413
221 Ga0207670_10047009 3300025936 Bacteria 2871
222 Ga0207670_10225592 3300025936 Unclassified 1436
223 Ga0207704_10031243 3300025938 Bacteria 2998
224 Ga0207691_10028366 3300025940 Bacteria 5243
225 Ga0207711_10004799 3300025941 Bacteria 11475
226 Ga0207711_10057377 3300025941 Bacteria 3347
227 Ga0207711_10206826 3300025941 Bacteria 1792
228 Ga0207689_10004650 3300025942 Bacteria 12415
229 Ga0207661_10593821 3300025944 Bacteria 1016
230 Ga0207679_10003468 3300025945 Bacteria 9747
231 Ga0207667_10022490 3300025949 Bacteria 6963
232 Ga0207667_10037691 3300025949 Bacteria 5166
233 Ga0207667_10081518 3300025949 Bacteria 3351
234 Ga0207651_10012402 3300025960 Bacteria 4823
235 Ga0207712_10000107 3300025961 Bacteria 94254
236 Ga0207668_10128150 3300025972 Bacteria 1934
237 Ga0207640_10109081 3300025981 Bacteria 1958
238 Ga0207658_10000420 3300025986 Bacteria 40191
239 Ga0207658_10009192 3300025986 Bacteria 6703
240 Ga0207658_10009197 3300025986 Bacteria 6699
241 Ga0207658_10051791 3300025986 Bacteria 3027
242 Ga0207677_10118476 3300026023 Bacteria 1986
243 Ga0207703_10046948 3300026035 Bacteria 3481
244 Ga0207639_10004612 3300026041 Bacteria 9271
245 Ga0207639_10128466 3300026041 Bacteria 2094
246 Ga0207639_10173576 3300026041 Bacteria 1828
247 Ga0207639_10553833 3300026041 Bacteria 1056
248 Ga0207678_10000509 3300026067 Bacteria 35261
249 Ga0207678_10053511 3300026067 Bacteria 3478
250 Ga0207678_10448834 3300026067 Bacteria 1121
251 Ga0207708_10051537 3300026075 Bacteria 3133
252 Ga0207676_10204715 3300026095 Bacteria 1746
253 Ga0207674_10062664 3300026116 Bacteria 3755
254 Ga0207675_100466459 3300026118 Bacteria 1253
255 Ga0207683_10166799 3300026121 Unclassified 1993
256 Ga0207683_10207552 3300026121 Bacteria 1782
257 Ga0268266_10000001 3300028379 Bacteria 4040580
258 Ga0268265_10011767 3300028380 Bacteria 5916
259 Ga0268265_10053896 3300028380 Bacteria 3048
260 Ga0268265_10061998 3300028380 Bacteria 2872
261 Ga0307515_10000016 3300028794 Bacteria 554870
262 Ga0265327_10001840 3300031251 Bacteria 24631
263 Ga0307509_10000370 3300031507 Bacteria 75863
264 Ga0307508_10001453 3300031616 Bacteria 26619
265 Ga0307508_10276187 3300031616 Bacteria 1274
266 Ga0307516_10000090 3300031730 Bacteria 101690
267 Ga0307405_10062289 3300031731 Bacteria 2362
268 Ga0307413_10000317 3300031824 Bacteria 15034
269 Ga0307413_10020398 3300031824 Bacteria 3524
270 Ga0307413_10227636 3300031824 Bacteria 1367
271 Ga0307410_10003649 3300031852 Bacteria 7770
272 Ga0307410_10007587 3300031852 Bacteria 5951
273 Ga0307406_10017423 3300031901 Bacteria 4181
274 Ga0307406_10434908 3300031901 Bacteria 1049
275 Ga0307407_10000336 3300031903 Bacteria 14099
276 Ga0307407_10001832 3300031903 Bacteria 7983
277 Ga0307407_10018869 3300031903 Bacteria 3500
278 Ga0307412_10290192 3300031911 Bacteria 1288
279 Ga0307409_100438583 3300031995 Bacteria 1257
280 Ga0307416_100062262 3300032002 Bacteria 3050
281 Ga0307416_100116583 3300032002 Bacteria 2368
282 Ga0307416_100559811 3300032002 Bacteria 1218
283 Ga0307416_100960439 3300032002 Bacteria 957
284 Ga0307414_10000999 3300032004 Bacteria 14449
285 Ga0307414_10011338 3300032004 Bacteria 5222
286 Ga0307414_10052800 3300032004 Bacteria 2831
287 Ga0307414_10053454 3300032004 Bacteria 2816
288 Ga0307411_10001162 3300032005 Bacteria 10336
289 Ga0307411_10158641 3300032005 Bacteria 1691
290 Ga0307411_10627266 3300032005 Bacteria 928
291 Ga0307415_100004719 3300032126 Bacteria 7131
292 Ga0307415_100013108 3300032126 Bacteria 4824
293 Ga0373947_0055829 3300035725 Bacteria 2386
294 Ga0373925_0145785 3300037068 Archaea 1856
295 Ga0395899_0006130 3300037312 Bacteria 9319
296 Ga0395899_0011373 3300037312 Bacteria 6817
297 Ga0395899_0059475 3300037312 Bacteria 2817
298 Ga0395899_0062185 3300037312 Bacteria 2749
299 Ga0395900_0007210 3300037418 Bacteria 11521
300 Ga0395900_0011874 3300037418 Bacteria 8907
301 Ga0395900_0018465 3300037418 Bacteria 7112
302 Ga0395900_0072137 3300037418 Bacteria 3550
303 Ga0395900_0083092 3300037418 Bacteria 3290
304 Ga0395900_0468415 3300037418 Bacteria 1214
305 Ga0395898_0044219 3300037466 Bacteria 4386
306 Ga0395898_0190819 3300037466 Bacteria 1957
307 Ga0395901_0005556 3300038443 Bacteria 12756
308 Ga0395901_0064598 3300038443 Bacteria 3810
309 Ga0395901_0478557 3300038443 Bacteria 1270
310 Ga0395901_0790716 3300038443 Bacteria 938
311 Ga0436365_1920143 3300039437 Bacteria 2628
312 Ga0439453_0017390 3300041408 Bacteria 1262
313 Ga0451787_361794 3300041441 Bacteria 2092
314 Ga0451789_0086374 3300041443 Bacteria 1540
315 Ga0451791_0000443 3300041451 Bacteria 1167
316 Ga0451797_0655548 3300041453 Bacteria 1404
317 Ga0451797_0717435 3300041453 Bacteria 1526
318 Ga0451795_0821407 3300041456 Bacteria 1490
319 Ga0451802_0620063 3300041460 Bacteria 1736
320 Ga0451807_1056934 3300041486 Bacteria 2711
321 Ga0451837_0188829 3300041494 Bacteria 1811
322 Ga0451837_1408156 3300041494 Bacteria 1564
323 Ga0439449_0000621 3300042007 Bacteria 13286
324 Ga0439462_0008317 3300042015 Bacteria 2612
325 Ga0466966_0094628 3300044684 Bacteria 1851
326 Ga0453684_0008356 3300044712 Bacteria 18597
327 Ga0453684_0754336 3300044712 Bacteria 1053
328 Ga0466967_0751002 3300045976 Unclassified 967
329 Ga0495638_0005875 3300046460 Bacteria 9025
330 Ga0495638_0035948 3300046460 Bacteria 3156
331 Ga0495630_0444796 3300046517 Bacteria 993
332 Ga0495632_0092801 3300046519 Bacteria 1429
333 Ga0495645_0346154 3300046543 Bacteria 959
334 Ga0495668_0111683 3300046616 Bacteria 1495
335 Ga0495625_0092004 3300046660 Bacteria 2096
336 Ga0495649_0200955 3300046694 Bacteria 1035
337 Ga0495686_0000086 3300047472 Bacteria 197490
338 Ga0495686_0001227 3300047472 Bacteria 29301
339 Ga0495686_0005129 3300047472 Bacteria 10461
340 Ga0495686_0163810 3300047472 Bacteria 1297
341 Ga0496102_0439164 3300048905 Bacteria 1225
342 Ga0496104_0195188 3300048907 Bacteria 1936
343 Ga0496108_0000087 3300048911 Bacteria 97626
344 Ga0496108_0061747 3300048911 Bacteria 3155
345 Ga0496109_0005438 3300048912 Bacteria 10655
346 Ga0496109_0121018 3300048912 Bacteria 2439
347 Ga0496109_0242881 3300048912 Bacteria 1695
348 Ga0496110_0081603 3300048913 Bacteria 2883
349 Ga0496110_0168075 3300048913 Bacteria 1989
350 Ga0496110_0530390 3300048913 Bacteria 1071
351 Ga0496114_0283980 3300048917 Bacteria 1460
352 Ga0496115_0013757 3300048918 Bacteria 6126
353 Ga0496117_0004502 3300048920 Bacteria 15321
354 Ga0496117_0022065 3300048920 Bacteria 5118
355 Ga0496117_0218109 3300048920 Bacteria 1064
356 Ga0496118_0000101 3300048921 Bacteria 159577
357 Ga0496118_0088500 3300048921 Bacteria 2141
358 Ga0496119_0005190 3300048922 Bacteria 12586
359 Ga0496120_0000161 3300048923 Bacteria 112351
360 Ga0496121_0159045 3300048924 Bacteria 1654
361 Ga0496121_0303488 3300048924 Bacteria 1082
362 Ga0496122_0000212 3300048925 Bacteria 129245
363 Ga0496122_0000647 3300048925 Bacteria 70731
364 Ga0496123_0000234 3300048926 Bacteria 112524
365 Ga0496123_0001661 3300048926 Bacteria 29841
366 Ga0496124_0000415 3300048927 Bacteria 76192
367 Ga0496126_0390475 3300048929 Bacteria 1131
368 Ga0501043_0206353 3300049579 Bacteria 1524
369 Ga0501067_0117838 3300049583 Bacteria 1477
370 Ga0501068_0394473 3300049584 Bacteria 892
371 Ga0501257_000209 3300049686 Bacteria 11725
372 Ga0501080_0547950 3300049742 Bacteria 1030
373 Ga0501264_000645 3300049761 Bacteria 4870
374 Ga0501268_011768 3300049765 Bacteria 1387
375 Ga0501279_011927 3300049775 Bacteria 1180
376 Ga0501044_0031817 3300049823 Bacteria 5549
377 nmdc:mga0k408_40405_c1 3300050493 Bacteria 2684
378 nmdc:mga05p37_56262_c1 3300050507 Bacteria 4843
379 nmdc:mga09592_4922_c1 3300050508 Bacteria 10829
380 nmdc:mga0qj67_321463_c1 3300050509 Bacteria 1253
381 nmdc:mga0qj67_6928_c1 3300050509 Bacteria 8345
382 nmdc:mga06r32_15970_c1 3300050510 Bacteria 6832
383 nmdc:mga06r32_304_c1 3300050510 Bacteria 40653
384 nmdc:mga06r32_485683_c1 3300050510 Bacteria 1213
385 nmdc:mga0n895_292331_c1 3300050512 Bacteria 1652
386 nmdc:mga0n895_94221_c1 3300050512 Bacteria 2998
387 nmdc:mga0rr50_9763_c1 3300050513 Bacteria 6056
388 Ga0500610_0000947 3300053079 Bacteria 9404
389 Ga0500578_0000315 3300053086 Bacteria 59398
390 Ga0500643_009254 3300053087 Bacteria 3776
391 Ga0500641_0009253 3300053096 Bacteria 3539
392 Ga0500597_000070 3300053120 Bacteria 20751
393 Ga0500642_0036362 3300053130 Bacteria 2098
394 Ga0500622_0000022 3300053156 Bacteria 267246
395 Ga0501084_0487102 3300054114 Bacteria 1042
396 Ga0500661_004311 3300055283 Bacteria 2661
397 Ga0070683_100052792
398 SwRhRL2b_contig_3721840
399 JGI24035J26624_1006377
400 JGI25154J39366_1000019
401 rootH1_10145152
402 rootH2_10024374
403 rootL2_10288706
404 rootH1_10271045
405 Ga0055531_10000592
406 Ga0065704_10084984
407 Ga0065712_10072680
408 Ga0065715_10150809
409 Ga0065707_10303718
410 Ga0070658_10154634
411 Ga0070658_10198248
412 Ga0070690_100035076
413 Ga0070670_100009802
414 Ga0070670_100061572
415 Ga0070670_100241840
416 Ga0070677_10001910
417 Ga0070677_10006845
418 Ga0068869_100070672
419 Ga0070666_10106812
420 Ga0070666_10159370
421 Ga0070680_100005471
422 Ga0070680_100085283
423 Ga0070682_100444913
424 Ga0068868_100192670
425 Ga0068868_100241253
426 Ga0070660_100003441
427 Ga0070660_100074229
428 Ga0070660_100344896
429 Ga0070660_100432267
430 Ga0070689_100036373
431 Ga0070691_10116300
432 Ga0070661_100002694
433 Ga0070661_100260466
434 Ga0070692_10000492
435 Ga0070692_10102273
436 Ga0070668_100291473
437 Ga0070675_100000001
438 Ga0070675_100026341
439 Ga0070671_100064453
440 Ga0070673_100041891
441 Ga0070673_100272503
442 Ga0070688_100053093
443 Ga0070659_100276481
444 Ga0070667_100000065
445 Ga0070667_100019631
446 Ga0070667_100229003
447 Ga0070667_100273831
448 Ga0070667_100375019
449 Ga0070713_100245642
450 Ga0070700_100035582
451 Ga0070694_100245260
452 Ga0070708_100069042
453 Ga0070663_100000317
454 Ga0070663_100273095
455 Ga0070678_100139703
456 Ga0070678_100307902
457 Ga0070681_10002016
458 Ga0070681_10040508
459 Ga0070681_10264717
460 Ga0070706_100076886
461 Ga0070707_100078194
462 Ga0070679_100000386
463 Ga0070679_100004692
464 Ga0070679_100021938
465 Ga0070679_100088140
466 Ga0070697_100024757
467 Ga0068853_100003887
468 Ga0068853_100010502
469 Ga0068853_100269723
470 Ga0068853_100787268
471 Ga0070686_100104190
472 Ga0070695_100206573
473 Ga0070695_100400800
474 Ga0070696_100086486
475 Ga0070665_100000126
476 Ga0070665_100016242
477 Ga0068855_100007506
478 Ga0068855_100008584
479 Ga0068855_100026287
480 Ga0068857_100011139
481 Ga0068857_100114859
482 Ga0068857_100185150
483 Ga0068854_100067098
484 Ga0068854_100113978
485 Ga0070702_100109162
486 Ga0068852_100171519
487 Ga0068852_100236407
488 Ga0068859_100000180
489 Ga0068859_100005511
490 Ga0068859_100782258
491 Ga0068864_100020649
492 Ga0068864_100358849
493 Ga0068861_100418780
494 Ga0068870_10331620
495 Ga0068863_100057486
496 Ga0068863_100070639
497 Ga0068863_100086164
498 Ga0068863_100324679
499 Ga0068858_100040190
500 Ga0068858_100104986
501 Ga0068862_100001242
502 Ga0068862_100272467
503 Ga0081455_10011714
504 Ga0070717_10102371
505 Ga0075364_10085099
506 Ga0075366_10244061
507 Ga0068871_100098689
508 Ga0075428_100000169
509 Ga0075428_100003108
510 Ga0075428_100045412
511 Ga0075428_100092237
512 Ga0075430_100013013
513 Ga0075430_100064882
514 Ga0075431_100001534
515 Ga0075431_100149533
516 Ga0075434_100207506
517 Ga0075429_100131126
518 Ga0068865_100145528
519 Ga0068865_100149086
520 Ga0068865_100367353
521 Ga0097620_100000180
522 Ga0097620_100005511
523 Ga0097620_100782307
524 Ga0075435_100017236
525 Ga0099795_10053272
526 Ga0105251_10000108
527 Ga0105240_10003430
528 Ga0105240_10124986
529 Ga0105240_10164409
530 Ga0105240_10452586
531 Ga0111539_10038326
532 Ga0111539_10091018
533 Ga0105245_10000043
534 Ga0105245_10024491
535 Ga0105245_10412651
536 Ga0105247_10305138
537 Ga0114129_10001590
538 Ga0105243_10255956
539 Ga0105243_10354837
540 Ga0105242_10008373
541 Ga0105242_10088886
542 Ga0105248_10006986
543 Ga0105248_10088597
544 Ga0105248_10318970
545 Ga0105237_10004639
546 Ga0105237_10062196
547 Ga0105237_10336927
548 Ga0105238_10021514
549 Ga0105249_10000367
550 Ga0105249_10090975
551 Ga0105239_10016337
552 Ga0105239_10019611
553 Ga0105239_10250665
554 Ga0105246_10193811
555 Ga0157373_10052841
556 Ga0157371_10000618
557 Ga0157371_10004645
558 Ga0157371_10032961
559 Ga0157371_10241932
560 Ga0157370_10000242
561 Ga0157370_10000457
562 Ga0157370_10001541
563 Ga0157369_10019989
564 Ga0157374_10033084
565 Ga0157374_10033550
566 Ga0157374_10130307
567 Ga0163162_10514346
568 Ga0157375_10105965
569 Ga0157375_10138680
570 Ga0157375_10229089
571 Ga0163163_10001605
572 Ga0157380_10216080
573 Ga0157380_10424579
574 Ga0157376_10188372
575 Ga0163161_10099157
576 Ga0163161_10201991
577 Ga0209758_1004347
578 Ga0209257_1000006
579 Ga0207697_10002047
580 Ga0207713_1000595
581 Ga0207710_10168739
582 Ga0207688_10102161
583 Ga0207680_10030984
584 Ga0207680_10144211
585 Ga0207643_10213516
586 Ga0207705_10037591
587 Ga0207684_10006362
588 Ga0207707_10000659
589 Ga0207707_10005489
590 Ga0207695_10008285
591 Ga0207695_10153884
592 Ga0207695_10266287
593 Ga0207671_10190096
594 Ga0207660_10001881
595 Ga0207660_10060502
596 Ga0207662_10061895
597 Ga0207657_10015707
598 Ga0207657_10040504
599 Ga0207649_10003722
600 Ga0207652_10000074
601 Ga0207652_10000276
602 Ga0207652_10002553
603 Ga0207652_10384387
604 Ga0207646_10076310
605 Ga0207694_10003748
606 Ga0207650_10027871
607 Ga0207659_10000004
608 Ga0207659_10015160
609 Ga0207659_10139149
610 Ga0207687_10000024
611 Ga0207687_10019256
612 Ga0207687_10132726
613 Ga0207644_10097528
614 Ga0207690_10021548
615 Ga0207690_10085807
616 Ga0207706_10294932
617 Ga0207670_10047009
618 Ga0207670_10225592
619 Ga0207704_10031243
620 Ga0207691_10028366
621 Ga0207711_10004799
622 Ga0207711_10057377
623 Ga0207711_10206826
624 Ga0207689_10004650
625 Ga0207661_10593821
626 Ga0207679_10003468
627 Ga0207667_10022490
628 Ga0207667_10037691
629 Ga0207667_10081518
630 Ga0207651_10012402
631 Ga0207712_10000107
632 Ga0207668_10128150
633 Ga0207640_10109081
634 Ga0207658_10000420
635 Ga0207658_10009192
636 Ga0207658_10009197
637 Ga0207658_10051791
638 Ga0207677_10118476
639 Ga0207703_10046948
640 Ga0207639_10004612
641 Ga0207639_10128466
642 Ga0207639_10173576
643 Ga0207639_10553833
644 Ga0207678_10000509
645 Ga0207678_10053511
646 Ga0207678_10448834
647 Ga0207708_10051537
648 Ga0207676_10204715
649 Ga0207674_10062664
650 Ga0207675_100466459
651 Ga0207683_10166799
652 Ga0207683_10207552
653 Ga0268266_10000001
654 Ga0268265_10011767
655 Ga0268265_10053896
656 Ga0268265_10061998
657 Ga0307515_10000016
658 Ga0265327_10001840
659 Ga0307509_10000370
660 Ga0307508_10001453
661 Ga0307508_10276187
662 Ga0307516_10000090
663 Ga0307405_10062289
664 Ga0307413_10000317
665 Ga0307413_10020398
666 Ga0307413_10227636
667 Ga0307410_10003649
668 Ga0307410_10007587
669 Ga0307406_10017423
670 Ga0307406_10434908
671 Ga0307407_10000336
672 Ga0307407_10001832
673 Ga0307407_10018869
674 Ga0307412_10290192
675 Ga0307409_100438583
676 Ga0307416_100062262
677 Ga0307416_100116583
678 Ga0307416_100559811
679 Ga0307416_100960439
680 Ga0307414_10000999
681 Ga0307414_10011338
682 Ga0307414_10052800
683 Ga0307414_10053454
684 Ga0307411_10001162
685 Ga0307411_10158641
686 Ga0307411_10627266
687 Ga0307415_100004719
688 Ga0307415_100013108
689 Ga0373947_0055829
690 Ga0373925_0145785
691 Ga0395899_0006130
692 Ga0395899_0011373
693 Ga0395899_0059475
694 Ga0395899_0062185
695 Ga0395900_0007210
696 Ga0395900_0011874
697 Ga0395900_0018465
698 Ga0395900_0072137
699 Ga0395900_0083092
700 Ga0395900_0468415
701 Ga0395898_0044219
702 Ga0395898_0190819
703 Ga0395901_0005556
704 Ga0395901_0064598
705 Ga0395901_0478557
706 Ga0395901_0790716
707 Ga0436365_1920143
708 Ga0439453_0017390
709 Ga0451787_361794
710 Ga0451789_0086374
711 Ga0451791_0000443
712 Ga0451797_0655548
713 Ga0451797_0717435
714 Ga0451795_0821407
715 Ga0451802_0620063
716 Ga0451807_1056934
717 Ga0451837_0188829
718 Ga0451837_1408156
719 Ga0439449_0000621
720 Ga0439462_0008317
721 Ga0466966_0094628
722 Ga0453684_0008356
723 Ga0453684_0754336
724 Ga0466967_0751002
725 Ga0495638_0005875
726 Ga0495638_0035948
727 Ga0495630_0444796
728 Ga0495632_0092801
729 Ga0495645_0346154
730 Ga0495668_0111683
731 Ga0495625_0092004
732 Ga0495649_0200955
733 Ga0495686_0000086
734 Ga0495686_0001227
735 Ga0495686_0005129
736 Ga0495686_0163810
737 Ga0496102_0439164
738 Ga0496104_0195188
739 Ga0496108_0000087
740 Ga0496108_0061747
741 Ga0496109_0005438
742 Ga0496109_0121018
743 Ga0496109_0242881
744 Ga0496110_0081603
745 Ga0496110_0168075
746 Ga0496110_0530390
747 Ga0496114_0283980
748 Ga0496115_0013757
749 Ga0496117_0004502
750 Ga0496117_0022065
751 Ga0496117_0218109
752 Ga0496118_0000101
753 Ga0496118_0088500
754 Ga0496119_0005190
755 Ga0496120_0000161
756 Ga0496121_0159045
757 Ga0496121_0303488
758 Ga0496122_0000212
759 Ga0496122_0000647
760 Ga0496123_0000234
761 Ga0496123_0001661
762 Ga0496124_0000415
763 Ga0496126_0390475
764 Ga0501043_0206353
765 Ga0501067_0117838
766 Ga0501068_0394473
767 Ga0501257_000209
768 Ga0501080_0547950
769 Ga0501264_000645
770 Ga0501268_011768
771 Ga0501279_011927
772 Ga0501044_0031817
773 nmdc:mga0k408_40405_c1
774 nmdc:mga05p37_56262_c1
775 nmdc:mga09592_4922_c1
776 nmdc:mga0qj67_321463_c1
777 nmdc:mga0qj67_6928_c1
778 nmdc:mga06r32_15970_c1
779 nmdc:mga06r32_304_c1
780 nmdc:mga06r32_485683_c1
781 nmdc:mga0n895_292331_c1
782 nmdc:mga0n895_94221_c1
783 nmdc:mga0rr50_9763_c1
784 Ga0500610_0000947
785 Ga0500578_0000315
786 Ga0500643_009254
787 Ga0500641_0009253
788 Ga0500597_000070
789 Ga0500642_0036362
790 Ga0500622_0000022
791 Ga0501084_0487102
792 Ga0500661_004311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20613

HipA_2

HipA-like kinase

28

267

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xyv-assembly1.cif.gz_A crystal structure of drosophila melanogaster rhino chromoshadow domain in complex with deadlock n-terminal domain 0.8138 4 34
3p7j-assembly1.cif.gz_B drosophila hp1a chromo shadow domain 0.7918 4 34
6qlz-assembly3.cif.gz_C idol f3ab subdomain 0.7578 9 35
1q3l-assembly1.cif.gz_A chromodomain of hp1 complexed with histone h3 tail containing monomethyllysine 9. 0.7367 4 34
3h3h-assembly1.cif.gz_A crystal structure of a snoal-like protein of unknown function (bth_ii0226) from burkholderia thailandensis e264 at 1.60 a resolution 0.735 8 35
ID Description Score Start End Superfamily
af_Q9VHG0_107_171_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8037 4 34 2.40.50.40
af_Q2FZK7_945_1013_2.30.30.170 Mainly Beta;Roll;SH3 type barrels.; 0.7795 9 34 2.30.30.170
af_Q9U3C6_94_162_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7772 4 36 2.40.50.40
af_Q2FX21_1_55_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.7709 7 35 3.10.110.10
af_B9F3M7_412_749_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7623 11 35 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A6I0T4I7-F1-model_v4 deleted 0.9716 101 238
AF-A0A3M0ZKF9-F1-model_v4 deleted 0.9664 105 236
AF-A0A4Q6AGC0-F1-model_v4 Aminotransferase class I and II 0.9599 1 67 GO:0008483
AF-A0A6I0T4I7-F1-model_v4 deleted 0.958 101 238
AF-A0A3M1F7N4-F1-model_v4 Aminotransferase class I and II 0.9532 121 238 GO:0008483

Map