F433181

General Info

Members Datasets Scaffolds Average Seq Length
395 221 780 208

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10061421|Ga0075433_100614212
Length 247
Sequence LWLLPFRVLYQSRFSPRVTRSGVFEHHELISQSAQGRNMTTSNPIRILTVDDHAVFRQGVAAIIRHQADMQLVAEASNAAEAIQGFREHTPDVTLMDLRLPDMSGIDAMIAILSEFPQARIVILTTFVPDVEIQRALEAGARGYLAKSMRPQELLDIIRQVHAGKKRIPDEIVAHLVEHYSDEALTEREIEVLREIACGKRNRDIADDLFISELTVKMHIKNIMKKLAATDRTQAFAIGVRRGIIQL

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
100 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
101 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
149 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
158 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
159 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
176 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
177 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
194 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
195 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
196 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
197 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
198 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
199 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
200 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
201 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
202 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
203 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
204 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
205 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
206 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
207 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
208 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
209 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
221 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.51
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.76
Nodule 0
Rhizoplane 1.77
Rhizosphere 90.63
Stem 0
Stem Tuber 0
Unclassified 21.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10061421 3300006852 Bacteria 3291
2 MRS1b_contig_1683809 2162886011 Bacteria 1209
3 MBSR1b_contig_1766911 2162886012 Unclassified 830
4 rootL2_10115316 3300003322 Bacteria 1599
5 rootH1_10164950 3300003323 Bacteria 2751
6 Ga0065712_10005249 3300005290 Unclassified 2944
7 Ga0065712_10008546 3300005290 Bacteria 2664
8 Ga0065712_10132557 3300005290 Bacteria 1532
9 Ga0065715_10003685 3300005293 Bacteria 4198
10 Ga0065715_10174239 3300005293 Unclassified 1524
11 Ga0065715_10191797 3300005293 Bacteria 1411
12 Ga0065715_10296267 3300005293 Unclassified 1047
13 Ga0070658_10001436 3300005327 Bacteria 20320
14 Ga0070670_100000071 3300005331 Bacteria 102454
15 Ga0070670_100161737 3300005331 Bacteria 1940
16 Ga0070666_10250335 3300005335 Bacteria 1254
17 Ga0068868_100115523 3300005338 Unclassified 2185
18 Ga0068868_100272427 3300005338 Bacteria 1430
19 Ga0070689_100126135 3300005340 Bacteria 2048
20 Ga0070689_100243878 3300005340 Bacteria 1481
21 Ga0070661_100533969 3300005344 Bacteria 942
22 Ga0070692_10052479 3300005345 Bacteria 2124
23 Ga0070692_10145103 3300005345 Bacteria 1347
24 Ga0070669_100245038 3300005353 Unclassified 1425
25 Ga0070671_100148913 3300005355 Unclassified 1976
26 Ga0070671_100451476 3300005355 Bacteria 1103
27 Ga0070673_100614280 3300005364 Bacteria 992
28 Ga0070688_100011229 3300005365 Unclassified 4973
29 Ga0070667_100126016 3300005367 Bacteria 2232
30 Ga0070667_100573380 3300005367 Bacteria 1038
31 Ga0070709_10113348 3300005434 Unclassified 1826
32 Ga0070709_10327346 3300005434 Unclassified 1126
33 Ga0070714_100127917 3300005435 Bacteria 2267
34 Ga0070714_101187889 3300005435 Bacteria 744
35 Ga0070713_100144643 3300005436 Bacteria 2109
36 Ga0070701_10073018 3300005438 Unclassified 1839
37 Ga0070700_100016135 3300005441 Bacteria 4250
38 Ga0070700_100142075 3300005441 Unclassified 1633
39 Ga0070694_100178337 3300005444 Bacteria 1570
40 Ga0070708_100113726 3300005445 Bacteria 2490
41 Ga0070708_100852217 3300005445 Bacteria 856
42 Ga0070663_100355084 3300005455 Unclassified 1188
43 Ga0070662_100228020 3300005457 Bacteria 1489
44 Ga0068867_100251535 3300005459 Unclassified 1437
45 Ga0068867_100322800 3300005459 Bacteria 1280
46 Ga0070706_100066351 3300005467 Bacteria 3338
47 Ga0070707_100105745 3300005468 Bacteria 2729
48 Ga0070707_100387341 3300005468 Unclassified 1357
49 Ga0070707_100669403 3300005468 Unclassified 1001
50 Ga0070698_100021830 3300005471 Bacteria 6704
51 Ga0070698_100043234 3300005471 Bacteria 4620
52 Ga0070698_100505486 3300005471 Unclassified 1147
53 Ga0070699_100003123 3300005518 Bacteria 14655
54 Ga0070699_100027419 3300005518 Bacteria 4912
55 Ga0070699_100076967 3300005518 Bacteria 2904
56 Ga0070699_100556811 3300005518 Unclassified 1044
57 Ga0070679_100307944 3300005530 Bacteria 1534
58 Ga0070697_100005706 3300005536 Bacteria 9588
59 Ga0070697_100058129 3300005536 Bacteria 3146
60 Ga0070697_100126077 3300005536 Bacteria 2144
61 Ga0070697_100133321 3300005536 Bacteria 2084
62 Ga0070697_100312658 3300005536 Bacteria 1352
63 Ga0070697_100566728 3300005536 Unclassified 996
64 Ga0070672_100178392 3300005543 Bacteria 1769
65 Ga0070686_100035317 3300005544 Bacteria 3087
66 Ga0070693_100042596 3300005547 Bacteria 2559
67 Ga0070665_100030844 3300005548 Bacteria 5396
68 Ga0070704_100305801 3300005549 Bacteria 1327
69 Ga0068857_100008682 3300005577 Bacteria 8794
70 Ga0068857_100240778 3300005577 Bacteria 1656
71 Ga0068854_100068702 3300005578 Bacteria 2584
72 Ga0068854_100176430 3300005578 Bacteria 1666
73 Ga0068854_100321173 3300005578 Unclassified 1258
74 Ga0068854_100405344 3300005578 Bacteria 1129
75 Ga0068856_100373721 3300005614 Bacteria 1444
76 Ga0070702_100142630 3300005615 Bacteria 1528
77 Ga0068852_100770883 3300005616 Bacteria 975
78 Ga0068859_100008697 3300005617 Bacteria 10266
79 Ga0068859_100040057 3300005617 Bacteria 4702
80 Ga0068859_100131912 3300005617 Bacteria 2570
81 Ga0068859_100170108 3300005617 Bacteria 2260
82 Ga0068859_100613677 3300005617 Bacteria 1180
83 Ga0068859_100786715 3300005617 Bacteria 1039
84 Ga0068859_100896065 3300005617 Bacteria 972
85 Ga0068864_100252930 3300005618 Unclassified 1636
86 Ga0068864_100318517 3300005618 Bacteria 1460
87 Ga0068861_100060350 3300005719 Bacteria 2906
88 Ga0068861_100234314 3300005719 Bacteria 1558
89 Ga0068861_100379658 3300005719 Unclassified 1248
90 Ga0068870_10022567 3300005840 Bacteria 3094
91 Ga0068863_100043722 3300005841 Unclassified 4252
92 Ga0068863_100211496 3300005841 Unclassified 1868
93 Ga0068858_100028802 3300005842 Bacteria 5157
94 Ga0068858_100056202 3300005842 Bacteria 3638
95 Ga0068858_100057224 3300005842 Unclassified 3604
96 Ga0068858_100135605 3300005842 Bacteria 2310
97 Ga0068858_100687622 3300005842 Bacteria 995
98 Ga0068860_100040250 3300005843 Bacteria 4468
99 Ga0068860_100361209 3300005843 Bacteria 1431
100 Ga0068860_100374083 3300005843 Bacteria 1405
101 Ga0068862_100057808 3300005844 Bacteria 3327
102 Ga0068862_100564799 3300005844 Bacteria 1088
103 Ga0068862_100713778 3300005844 Bacteria 972
104 Ga0081539_10040587 3300005985 Bacteria 2730
105 Ga0070717_10043241 3300006028 Unclassified 3676
106 Ga0070717_10128788 3300006028 Bacteria 2175
107 Ga0070715_10039561 3300006163 Unclassified 1965
108 Ga0070716_100001782 3300006173 Bacteria 9747
109 Ga0070716_100015142 3300006173 Bacteria 3957
110 Ga0070716_100248399 3300006173 Bacteria 1210
111 Ga0070712_100088779 3300006175 Bacteria 2260
112 Ga0070712_100160245 3300006175 Bacteria 1737
113 Ga0070712_100163591 3300006175 Bacteria 1720
114 Ga0070712_100609173 3300006175 Unclassified 925
115 Ga0097621_100478305 3300006237 Bacteria 1125
116 Ga0068871_100162290 3300006358 Bacteria 1912
117 Ga0075428_100146873 3300006844 Bacteria 2563
118 Ga0075428_100169444 3300006844 Bacteria 2368
119 Ga0075428_100408486 3300006844 Bacteria 1455
120 Ga0075428_100813469 3300006844 Unclassified 993
121 Ga0075428_100817670 3300006844 Bacteria 990
122 Ga0075430_100112953 3300006846 Bacteria 2265
123 Ga0075431_100300808 3300006847 Bacteria 1621
124 Ga0075431_100451049 3300006847 Unclassified 1282
125 Ga0075433_10009349 3300006852 Bacteria 7837
126 Ga0075433_10347893 3300006852 Bacteria 1310
127 Ga0075433_10400317 3300006852 Unclassified 1211
128 Ga0075434_100004796 3300006871 Bacteria 12252
129 Ga0075434_100025041 3300006871 Bacteria 5837
130 Ga0075434_100036424 3300006871 Bacteria 4867
131 Ga0075434_100078345 3300006871 Unclassified 3300
132 Ga0075434_100106222 3300006871 Bacteria 2817
133 Ga0075434_100211177 3300006871 Unclassified 1961
134 Ga0075429_100376272 3300006880 Unclassified 1243
135 Ga0068865_100270789 3300006881 Bacteria 1348
136 Ga0075436_100094766 3300006914 Bacteria 2076
137 Ga0075436_100205256 3300006914 Unclassified 1396
138 Ga0097620_100008697 3300006931 Bacteria 10266
139 Ga0097620_100040052 3300006931 Bacteria 4702
140 Ga0097620_100131906 3300006931 Bacteria 2570
141 Ga0097620_100170112 3300006931 Bacteria 2260
142 Ga0097620_100613664 3300006931 Bacteria 1180
143 Ga0097620_100786760 3300006931 Unclassified 1039
144 Ga0097620_100896061 3300006931 Bacteria 972
145 Ga0075435_100041333 3300007076 Bacteria 3685
146 Ga0075435_100092996 3300007076 Bacteria 2491
147 Ga0099794_10107236 3300007265 Unclassified 1397
148 Ga0099795_10122504 3300007788 Unclassified 1041
149 Ga0105251_10049707 3300009011 Bacteria 2006
150 Ga0105251_10148087 3300009011 Unclassified 1061
151 Ga0105240_10054159 3300009093 Bacteria 5029
152 Ga0105240_10166697 3300009093 Bacteria 2612
153 Ga0111539_10001477 3300009094 Bacteria 31407
154 Ga0111539_10648132 3300009094 Bacteria 1230
155 Ga0105247_10000411 3300009101 Bacteria 36332
156 Ga0105247_10001245 3300009101 Bacteria 18879
157 Ga0114129_10012229 3300009147 Bacteria 12211
158 Ga0114129_10031405 3300009147 Bacteria 7507
159 Ga0114129_10050899 3300009147 Bacteria 5816
160 Ga0105243_10033144 3300009148 Bacteria 3993
161 Ga0105241_10022597 3300009174 Bacteria 4659
162 Ga0105241_10284740 3300009174 Bacteria 1413
163 Ga0105241_10381202 3300009174 Bacteria 1232
164 Ga0105241_10474614 3300009174 Bacteria 1111
165 Ga0105242_10024538 3300009176 Bacteria 4763
166 Ga0105242_10097925 3300009176 Bacteria 2480
167 Ga0105248_10072653 3300009177 Bacteria 3866
168 Ga0105248_10097295 3300009177 Bacteria 3316
169 Ga0105248_10464098 3300009177 Unclassified 1427
170 Ga0105248_10552698 3300009177 Bacteria 1299
171 Ga0105248_10853445 3300009177 Bacteria 1028
172 Ga0105237_10102114 3300009545 Bacteria 2859
173 Ga0105237_10121583 3300009545 Bacteria 2606
174 Ga0105237_10619983 3300009545 Unclassified 1089
175 Ga0105238_10001447 3300009551 Bacteria 23857
176 Ga0105238_10082116 3300009551 Bacteria 3213
177 Ga0105249_10274447 3300009553 Bacteria 1681
178 Ga0105249_10453566 3300009553 Unclassified 1321
179 Ga0099796_10073854 3300010159 Bacteria 1237
180 Ga0105239_10078890 3300010375 Bacteria 3623
181 Ga0105239_10258428 3300010375 Bacteria 1957
182 Ga0105239_10491759 3300010375 Bacteria 1394
183 Ga0105246_10033774 3300011119 Bacteria 3403
184 Ga0105246_10049609 3300011119 Unclassified 2875
185 Ga0105246_10337747 3300011119 Bacteria 1230
186 Ga0105246_10934144 3300011119 Bacteria 780
187 Ga0157373_10060364 3300013100 Bacteria 2687
188 Ga0157374_10216495 3300013296 Bacteria 1879
189 Ga0157374_11053832 3300013296 Unclassified 833
190 Ga0157378_10585327 3300013297 Bacteria 1125
191 Ga0163162_10085503 3300013306 Bacteria 3231
192 Ga0163162_10134154 3300013306 Unclassified 2586
193 Ga0163162_11069923 3300013306 Bacteria 913
194 Ga0157372_11074369 3300013307 Unclassified 931
195 Ga0157375_10743621 3300013308 Bacteria 1132
196 Ga0157375_10828788 3300013308 Unclassified 1073
197 Ga0163163_10000188 3300014325 Bacteria 63392
198 Ga0163163_10049574 3300014325 Bacteria 4133
199 Ga0163163_10059688 3300014325 Bacteria 3774
200 Ga0163163_11066154 3300014325 Bacteria 871
201 Ga0157376_10687261 3300014969 Unclassified 1027
202 Ga0163161_10331614 3300017792 Bacteria 1205
203 Ga0163161_10396045 3300017792 Bacteria 1107
204 Ga0213872_10073495 3300021361 Bacteria 1540
205 Ga0213872_10138036 3300021361 Unclassified 1071
206 Ga0213874_10033719 3300021377 Unclassified 1494
207 Ga0213876_10000169 3300021384 Bacteria 68458
208 Ga0213876_10000256 3300021384 Bacteria 49819
209 Ga0213876_10018667 3300021384 Bacteria 3662
210 Ga0213871_10030709 3300021441 Bacteria 1399
211 Ga0224572_1000152 3300024225 Bacteria 6029
212 Ga0228598_1000595 3300024227 Bacteria 7602
213 Ga0207697_10000661 3300025315 Bacteria 19575
214 Ga0207710_10000602 3300025900 Bacteria 21021
215 Ga0207710_10002535 3300025900 Bacteria 8446
216 Ga0207699_10107341 3300025906 Unclassified 1783
217 Ga0207699_10728839 3300025906 Unclassified 726
218 Ga0207643_10041014 3300025908 Bacteria 2607
219 Ga0207643_10099352 3300025908 Bacteria 1705
220 Ga0207684_10271701 3300025910 Unclassified 1462
221 Ga0207654_10115351 3300025911 Unclassified 1678
222 Ga0207654_10223344 3300025911 Unclassified 1251
223 Ga0207671_10304575 3300025914 Bacteria 1259
224 Ga0207693_10118653 3300025915 Bacteria 2077
225 Ga0207693_10149197 3300025915 Bacteria 1839
226 Ga0207693_10156069 3300025915 Bacteria 1795
227 Ga0207663_10100910 3300025916 Bacteria 1938
228 Ga0207660_10591777 3300025917 Unclassified 903
229 Ga0207652_10240871 3300025921 Bacteria 1631
230 Ga0207646_10061465 3300025922 Bacteria 3353
231 Ga0207646_10089525 3300025922 Bacteria 2755
232 Ga0207646_10476123 3300025922 Unclassified 1126
233 Ga0207646_11101250 3300025922 Bacteria 699
234 Ga0207681_10083672 3300025923 Bacteria 2259
235 Ga0207694_10001759 3300025924 Bacteria 18159
236 Ga0207694_10168719 3300025924 Bacteria 1771
237 Ga0207650_10000006 3300025925 Bacteria 544730
238 Ga0207650_10564650 3300025925 Bacteria 955
239 Ga0207659_10066117 3300025926 Unclassified 2623
240 Ga0207700_10083207 3300025928 Bacteria 2505
241 Ga0207700_10118002 3300025928 Bacteria 2146
242 Ga0207664_10609101 3300025929 Bacteria 981
243 Ga0207644_10035549 3300025931 Unclassified 3492
244 Ga0207706_10460994 3300025933 Bacteria 1099
245 Ga0207670_10000487 3300025936 Bacteria 21916
246 Ga0207670_10102088 3300025936 Bacteria 2050
247 Ga0207665_10010417 3300025939 Bacteria 6106
248 Ga0207665_10023923 3300025939 Bacteria 4024
249 Ga0207665_10229445 3300025939 Bacteria 1364
250 Ga0207691_10227359 3300025940 Bacteria 1616
251 Ga0207711_10056937 3300025941 Bacteria 3360
252 Ga0207711_10079002 3300025941 Bacteria 2871
253 Ga0207711_10224497 3300025941 Bacteria 1719
254 Ga0207711_10339020 3300025941 Bacteria 1391
255 Ga0207711_10390956 3300025941 Bacteria 1291
256 Ga0207711_10872153 3300025941 Bacteria 837
257 Ga0207689_10152322 3300025942 Bacteria 1906
258 Ga0207679_10108705 3300025945 Unclassified 2184
259 Ga0207679_10839342 3300025945 Bacteria 839
260 Ga0207651_10704843 3300025960 Unclassified 890
261 Ga0207712_10411110 3300025961 Bacteria 1139
262 Ga0207640_10054488 3300025981 Unclassified 2615
263 Ga0207640_10159602 3300025981 Bacteria 1667
264 Ga0207640_10195866 3300025981 Bacteria 1527
265 Ga0207640_10236408 3300025981 Unclassified 1409
266 Ga0207640_10261049 3300025981 Unclassified 1350
267 Ga0207658_10006367 3300025986 Bacteria 8060
268 Ga0207677_10163819 3300026023 Bacteria 1731
269 Ga0207677_10376643 3300026023 Bacteria 1197
270 Ga0207677_10618038 3300026023 Unclassified 953
271 Ga0207703_10147408 3300026035 Bacteria 2048
272 Ga0207703_10283112 3300026035 Bacteria 1506
273 Ga0207702_10320784 3300026078 Bacteria 1475
274 Ga0207648_10114110 3300026089 Unclassified 2374
275 Ga0207648_10285049 3300026089 Unclassified 1478
276 Ga0207676_10195679 3300026095 Bacteria 1783
277 Ga0207676_10212418 3300026095 Bacteria 1717
278 Ga0207674_10019106 3300026116 Bacteria 7429
279 Ga0207674_10161976 3300026116 Unclassified 2191
280 Ga0207675_100026013 3300026118 Bacteria 5447
281 Ga0207675_100231607 3300026118 Bacteria 1782
282 Ga0207698_10268727 3300026142 Bacteria 1571
283 Ga0207698_10294936 3300026142 Bacteria 1507
284 Ga0209588_1065628 3300027671 Unclassified 1173
285 Ga0207428_10017020 3300027907 Bacteria 6245
286 Ga0268265_10060272 3300028380 Bacteria 2908
287 Ga0268264_10053616 3300028381 Bacteria 3365
288 Ga0268264_10539780 3300028381 Bacteria 1142
289 Ga0265338_10024204 3300028800 Bacteria 6212
290 Ga0265760_10000884 3300031090 Bacteria 8656
291 Ga0265325_10009957 3300031241 Bacteria 5527
292 Ga0265316_10010108 3300031344 Bacteria 8621
293 Ga0316579_10005051 3300031691 Bacteria 5291
294 Ga0316579_10273309 3300031691 Bacteria 817
295 Ga0316578_10264224 3300031728 Bacteria 1032
296 Ga0307516_10182590 3300031730 Bacteria 1830
297 Ga0316577_10001479 3300031733 Bacteria 11131
298 Ga0307413_11204500 3300031824 Unclassified 659
299 Ga0307410_10282710 3300031852 Bacteria 1303
300 Ga0307406_10112289 3300031901 Bacteria 1879
301 Ga0307414_10130488 3300032004 Bacteria 1950
302 Ga0307415_100275679 3300032126 Bacteria 1380
303 Ga0316585_10070252 3300032137 Bacteria 1136
304 Ga0316580_10163873 3300032139 Bacteria 683
305 Ga0316593_10096697 3300032168 Unclassified 1044
306 Ga0307510_10000005 3300033180 Bacteria 633068
307 Ga0373926_0098186 3300035083 Bacteria 1093
308 Ga0373949_0009291 3300035090 Bacteria 2154
309 Ga0373955_0209490 3300035172 Bacteria 1162
310 Ga0373942_0005657 3300035207 Bacteria 2896
311 Ga0373927_0030029 3300035695 Bacteria 3547
312 Ga0373947_0404911 3300035725 Bacteria 921
313 Ga0316584_0002082 3300036712 Bacteria 12529
314 Ga0316584_0005996 3300036712 Bacteria 8209
315 Ga0316584_0043836 3300036712 Bacteria 3336
316 Ga0316584_0106369 3300036712 Bacteria 2099
317 Ga0316584_0555821 3300036712 Bacteria 801
318 Ga0316581_0018106 3300037588 Unclassified 2042
319 Ga0316581_0051612 3300037588 Bacteria 1261
320 Ga0436364_1297160 3300037853 Unclassified 1469
321 Ga0395901_0640870 3300038443 Unclassified 1067
322 Ga0436365_0171590 3300039437 Unclassified 876
323 Ga0436365_0240496 3300039437 Unclassified 698
324 Ga0436365_0584623 3300039437 Bacteria 10631
325 Ga0436365_0948856 3300039437 Bacteria 50025
326 Ga0436365_1207177 3300039437 Bacteria 90363
327 Ga0436361_0310328 3300039447 Bacteria 3113
328 Ga0436361_1169776 3300039447 Bacteria 1673
329 Ga0436363_0561764 3300039450 Bacteria 3400
330 Ga0436362_0991802 3300039453 Unclassified 2202
331 Ga0439445_0011469 3300042004 Bacteria 2115
332 Ga0450908_003798 3300042184 Bacteria 2924
333 Ga0439464_0022577 3300042439 Bacteria 1734
334 Ga0495580_0001271 3300046472 Bacteria 22238
335 Ga0496104_0471502 3300048907 Bacteria 1167
336 Ga0496108_0149002 3300048911 Unclassified 2019
337 Ga0496110_0241130 3300048913 Bacteria 1645
338 Ga0496110_0249726 3300048913 Bacteria 1615
339 Ga0496112_0191835 3300048915 Bacteria 2005
340 Ga0496113_0093815 3300048916 Bacteria 2318
341 Ga0496115_0349848 3300048918 Unclassified 1205
342 Ga0496116_0054621 3300048919 Bacteria 2629
343 Ga0496117_0000012 3300048920 Bacteria 608530
344 Ga0496118_0000003 3300048921 Bacteria 773148
345 Ga0496119_0072731 3300048922 Bacteria 2007
346 Ga0496119_0098591 3300048922 Bacteria 1645
347 Ga0496120_0065389 3300048923 Bacteria 2015
348 Ga0496120_0067891 3300048923 Bacteria 1968
349 Ga0496121_0098169 3300048924 Bacteria 2267
350 Ga0496125_0004276 3300048928 Bacteria 16611
351 Ga0496125_0136994 3300048928 Bacteria 1710
352 Ga0496126_0033195 3300048929 Bacteria 4856
353 Ga0496126_0072999 3300048929 Bacteria 3051
354 Ga0501295_060859 3300049518 Bacteria 826
355 Ga0501298_002137 3300049521 Bacteria 2970
356 Ga0501303_009779 3300049526 Bacteria 890
357 Ga0501198_023146 3300049649 Bacteria 999
358 Ga0501201_004115 3300049651 Bacteria 1343
359 Ga0501202_018470 3300049652 Bacteria 1370
360 Ga0501206_004970 3300049653 Bacteria 1707
361 Ga0501227_017239 3300049665 Bacteria 1629
362 Ga0501235_014453 3300049669 Bacteria 1740
363 Ga0501235_024589 3300049669 Bacteria 1345
364 Ga0501239_024939 3300049672 Bacteria 756
365 Ga0501243_005833 3300049675 Bacteria 1858
366 Ga0501250_033623 3300049680 Bacteria 723
367 Ga0501256_014647 3300049685 Bacteria 781
368 Ga0501257_113253 3300049686 Bacteria 721
369 Ga0501258_016065 3300049687 Bacteria 843
370 Ga0501261_026971 3300049690 Bacteria 852
371 Ga0501279_031796 3300049775 Bacteria 785
372 nmdc:mga0k408_290281_c1 3300050493 Bacteria 976
373 nmdc:mga06z11_172903_c1 3300050494 Bacteria 1241
374 nmdc:mga05p37_254470_c1 3300050507 Unclassified 2105
375 nmdc:mga05p37_79576_c1 3300050507 Bacteria 4036
376 nmdc:mga09592_170231_c1 3300050508 Unclassified 1883
377 nmdc:mga0qj67_132065_c1 3300050509 Bacteria 2022
378 nmdc:mga06r32_428176_c1 3300050510 Unclassified 1304
379 nmdc:mga08y16_11974_c1 3300050511 Bacteria 9108
380 nmdc:mga0n895_119219_c1 3300050512 Unclassified 2660
381 nmdc:mga0n895_157379_c1 3300050512 Bacteria 2303
382 nmdc:mga0n895_51448_c1 3300050512 Bacteria 4041
383 nmdc:mga0rr50_651335_c1 3300050513 Bacteria 899
384 nmdc:mga0a205_108856_c1 3300050515 Bacteria 2669
385 nmdc:mga0a205_413680_c1 3300050515 Bacteria 1211
386 nmdc:mga0a205_53570_c1 3300050515 Bacteria 3894
387 nmdc:mga0a205_6130_c1 3300050515 Bacteria 10850
388 nmdc:mga0a205_835587_c1 3300050515 Unclassified 768
389 Ga0500641_0000560 3300053096 Bacteria 13447
390 2898329754 2898329390 Bacteria 5168154
391 Ga0075433_10061421
392 MRS1b_contig_1683809
393 MBSR1b_contig_1766911
394 rootL2_10115316
395 rootH1_10164950
396 Ga0065712_10005249
397 Ga0065712_10008546
398 Ga0065712_10132557
399 Ga0065715_10003685
400 Ga0065715_10174239
401 Ga0065715_10191797
402 Ga0065715_10296267
403 Ga0070658_10001436
404 Ga0070670_100000071
405 Ga0070670_100161737
406 Ga0070666_10250335
407 Ga0068868_100115523
408 Ga0068868_100272427
409 Ga0070689_100126135
410 Ga0070689_100243878
411 Ga0070661_100533969
412 Ga0070692_10052479
413 Ga0070692_10145103
414 Ga0070669_100245038
415 Ga0070671_100148913
416 Ga0070671_100451476
417 Ga0070673_100614280
418 Ga0070688_100011229
419 Ga0070667_100126016
420 Ga0070667_100573380
421 Ga0070709_10113348
422 Ga0070709_10327346
423 Ga0070714_100127917
424 Ga0070714_101187889
425 Ga0070713_100144643
426 Ga0070701_10073018
427 Ga0070700_100016135
428 Ga0070700_100142075
429 Ga0070694_100178337
430 Ga0070708_100113726
431 Ga0070708_100852217
432 Ga0070663_100355084
433 Ga0070662_100228020
434 Ga0068867_100251535
435 Ga0068867_100322800
436 Ga0070706_100066351
437 Ga0070707_100105745
438 Ga0070707_100387341
439 Ga0070707_100669403
440 Ga0070698_100021830
441 Ga0070698_100043234
442 Ga0070698_100505486
443 Ga0070699_100003123
444 Ga0070699_100027419
445 Ga0070699_100076967
446 Ga0070699_100556811
447 Ga0070679_100307944
448 Ga0070697_100005706
449 Ga0070697_100058129
450 Ga0070697_100126077
451 Ga0070697_100133321
452 Ga0070697_100312658
453 Ga0070697_100566728
454 Ga0070672_100178392
455 Ga0070686_100035317
456 Ga0070693_100042596
457 Ga0070665_100030844
458 Ga0070704_100305801
459 Ga0068857_100008682
460 Ga0068857_100240778
461 Ga0068854_100068702
462 Ga0068854_100176430
463 Ga0068854_100321173
464 Ga0068854_100405344
465 Ga0068856_100373721
466 Ga0070702_100142630
467 Ga0068852_100770883
468 Ga0068859_100008697
469 Ga0068859_100040057
470 Ga0068859_100131912
471 Ga0068859_100170108
472 Ga0068859_100613677
473 Ga0068859_100786715
474 Ga0068859_100896065
475 Ga0068864_100252930
476 Ga0068864_100318517
477 Ga0068861_100060350
478 Ga0068861_100234314
479 Ga0068861_100379658
480 Ga0068870_10022567
481 Ga0068863_100043722
482 Ga0068863_100211496
483 Ga0068858_100028802
484 Ga0068858_100056202
485 Ga0068858_100057224
486 Ga0068858_100135605
487 Ga0068858_100687622
488 Ga0068860_100040250
489 Ga0068860_100361209
490 Ga0068860_100374083
491 Ga0068862_100057808
492 Ga0068862_100564799
493 Ga0068862_100713778
494 Ga0081539_10040587
495 Ga0070717_10043241
496 Ga0070717_10128788
497 Ga0070715_10039561
498 Ga0070716_100001782
499 Ga0070716_100015142
500 Ga0070716_100248399
501 Ga0070712_100088779
502 Ga0070712_100160245
503 Ga0070712_100163591
504 Ga0070712_100609173
505 Ga0097621_100478305
506 Ga0068871_100162290
507 Ga0075428_100146873
508 Ga0075428_100169444
509 Ga0075428_100408486
510 Ga0075428_100813469
511 Ga0075428_100817670
512 Ga0075430_100112953
513 Ga0075431_100300808
514 Ga0075431_100451049
515 Ga0075433_10009349
516 Ga0075433_10347893
517 Ga0075433_10400317
518 Ga0075434_100004796
519 Ga0075434_100025041
520 Ga0075434_100036424
521 Ga0075434_100078345
522 Ga0075434_100106222
523 Ga0075434_100211177
524 Ga0075429_100376272
525 Ga0068865_100270789
526 Ga0075436_100094766
527 Ga0075436_100205256
528 Ga0097620_100008697
529 Ga0097620_100040052
530 Ga0097620_100131906
531 Ga0097620_100170112
532 Ga0097620_100613664
533 Ga0097620_100786760
534 Ga0097620_100896061
535 Ga0075435_100041333
536 Ga0075435_100092996
537 Ga0099794_10107236
538 Ga0099795_10122504
539 Ga0105251_10049707
540 Ga0105251_10148087
541 Ga0105240_10054159
542 Ga0105240_10166697
543 Ga0111539_10001477
544 Ga0111539_10648132
545 Ga0105247_10000411
546 Ga0105247_10001245
547 Ga0114129_10012229
548 Ga0114129_10031405
549 Ga0114129_10050899
550 Ga0105243_10033144
551 Ga0105241_10022597
552 Ga0105241_10284740
553 Ga0105241_10381202
554 Ga0105241_10474614
555 Ga0105242_10024538
556 Ga0105242_10097925
557 Ga0105248_10072653
558 Ga0105248_10097295
559 Ga0105248_10464098
560 Ga0105248_10552698
561 Ga0105248_10853445
562 Ga0105237_10102114
563 Ga0105237_10121583
564 Ga0105237_10619983
565 Ga0105238_10001447
566 Ga0105238_10082116
567 Ga0105249_10274447
568 Ga0105249_10453566
569 Ga0099796_10073854
570 Ga0105239_10078890
571 Ga0105239_10258428
572 Ga0105239_10491759
573 Ga0105246_10033774
574 Ga0105246_10049609
575 Ga0105246_10337747
576 Ga0105246_10934144
577 Ga0157373_10060364
578 Ga0157374_10216495
579 Ga0157374_11053832
580 Ga0157378_10585327
581 Ga0163162_10085503
582 Ga0163162_10134154
583 Ga0163162_11069923
584 Ga0157372_11074369
585 Ga0157375_10743621
586 Ga0157375_10828788
587 Ga0163163_10000188
588 Ga0163163_10049574
589 Ga0163163_10059688
590 Ga0163163_11066154
591 Ga0157376_10687261
592 Ga0163161_10331614
593 Ga0163161_10396045
594 Ga0213872_10073495
595 Ga0213872_10138036
596 Ga0213874_10033719
597 Ga0213876_10000169
598 Ga0213876_10000256
599 Ga0213876_10018667
600 Ga0213871_10030709
601 Ga0224572_1000152
602 Ga0228598_1000595
603 Ga0207697_10000661
604 Ga0207710_10000602
605 Ga0207710_10002535
606 Ga0207699_10107341
607 Ga0207699_10728839
608 Ga0207643_10041014
609 Ga0207643_10099352
610 Ga0207684_10271701
611 Ga0207654_10115351
612 Ga0207654_10223344
613 Ga0207671_10304575
614 Ga0207693_10118653
615 Ga0207693_10149197
616 Ga0207693_10156069
617 Ga0207663_10100910
618 Ga0207660_10591777
619 Ga0207652_10240871
620 Ga0207646_10061465
621 Ga0207646_10089525
622 Ga0207646_10476123
623 Ga0207646_11101250
624 Ga0207681_10083672
625 Ga0207694_10001759
626 Ga0207694_10168719
627 Ga0207650_10000006
628 Ga0207650_10564650
629 Ga0207659_10066117
630 Ga0207700_10083207
631 Ga0207700_10118002
632 Ga0207664_10609101
633 Ga0207644_10035549
634 Ga0207706_10460994
635 Ga0207670_10000487
636 Ga0207670_10102088
637 Ga0207665_10010417
638 Ga0207665_10023923
639 Ga0207665_10229445
640 Ga0207691_10227359
641 Ga0207711_10056937
642 Ga0207711_10079002
643 Ga0207711_10224497
644 Ga0207711_10339020
645 Ga0207711_10390956
646 Ga0207711_10872153
647 Ga0207689_10152322
648 Ga0207679_10108705
649 Ga0207679_10839342
650 Ga0207651_10704843
651 Ga0207712_10411110
652 Ga0207640_10054488
653 Ga0207640_10159602
654 Ga0207640_10195866
655 Ga0207640_10236408
656 Ga0207640_10261049
657 Ga0207658_10006367
658 Ga0207677_10163819
659 Ga0207677_10376643
660 Ga0207677_10618038
661 Ga0207703_10147408
662 Ga0207703_10283112
663 Ga0207702_10320784
664 Ga0207648_10114110
665 Ga0207648_10285049
666 Ga0207676_10195679
667 Ga0207676_10212418
668 Ga0207674_10019106
669 Ga0207674_10161976
670 Ga0207675_100026013
671 Ga0207675_100231607
672 Ga0207698_10268727
673 Ga0207698_10294936
674 Ga0209588_1065628
675 Ga0207428_10017020
676 Ga0268265_10060272
677 Ga0268264_10053616
678 Ga0268264_10539780
679 Ga0265338_10024204
680 Ga0265760_10000884
681 Ga0265325_10009957
682 Ga0265316_10010108
683 Ga0316579_10005051
684 Ga0316579_10273309
685 Ga0316578_10264224
686 Ga0307516_10182590
687 Ga0316577_10001479
688 Ga0307413_11204500
689 Ga0307410_10282710
690 Ga0307406_10112289
691 Ga0307414_10130488
692 Ga0307415_100275679
693 Ga0316585_10070252
694 Ga0316580_10163873
695 Ga0316593_10096697
696 Ga0307510_10000005
697 Ga0373926_0098186
698 Ga0373949_0009291
699 Ga0373955_0209490
700 Ga0373942_0005657
701 Ga0373927_0030029
702 Ga0373947_0404911
703 Ga0316584_0002082
704 Ga0316584_0005996
705 Ga0316584_0043836
706 Ga0316584_0106369
707 Ga0316584_0555821
708 Ga0316581_0018106
709 Ga0316581_0051612
710 Ga0436364_1297160
711 Ga0395901_0640870
712 Ga0436365_0171590
713 Ga0436365_0240496
714 Ga0436365_0584623
715 Ga0436365_0948856
716 Ga0436365_1207177
717 Ga0436361_0310328
718 Ga0436361_1169776
719 Ga0436363_0561764
720 Ga0436362_0991802
721 Ga0439445_0011469
722 Ga0450908_003798
723 Ga0439464_0022577
724 Ga0495580_0001271
725 Ga0496104_0471502
726 Ga0496108_0149002
727 Ga0496110_0241130
728 Ga0496110_0249726
729 Ga0496112_0191835
730 Ga0496113_0093815
731 Ga0496115_0349848
732 Ga0496116_0054621
733 Ga0496117_0000012
734 Ga0496118_0000003
735 Ga0496119_0072731
736 Ga0496119_0098591
737 Ga0496120_0065389
738 Ga0496120_0067891
739 Ga0496121_0098169
740 Ga0496125_0004276
741 Ga0496125_0136994
742 Ga0496126_0033195
743 Ga0496126_0072999
744 Ga0501295_060859
745 Ga0501298_002137
746 Ga0501303_009779
747 Ga0501198_023146
748 Ga0501201_004115
749 Ga0501202_018470
750 Ga0501206_004970
751 Ga0501227_017239
752 Ga0501235_014453
753 Ga0501235_024589
754 Ga0501239_024939
755 Ga0501243_005833
756 Ga0501250_033623
757 Ga0501256_014647
758 Ga0501257_113253
759 Ga0501258_016065
760 Ga0501261_026971
761 Ga0501279_031796
762 nmdc:mga0k408_290281_c1
763 nmdc:mga06z11_172903_c1
764 nmdc:mga05p37_254470_c1
765 nmdc:mga05p37_79576_c1
766 nmdc:mga09592_170231_c1
767 nmdc:mga0qj67_132065_c1
768 nmdc:mga06r32_428176_c1
769 nmdc:mga08y16_11974_c1
770 nmdc:mga0n895_119219_c1
771 nmdc:mga0n895_157379_c1
772 nmdc:mga0n895_51448_c1
773 nmdc:mga0rr50_651335_c1
774 nmdc:mga0a205_108856_c1
775 nmdc:mga0a205_413680_c1
776 nmdc:mga0a205_53570_c1
777 nmdc:mga0a205_6130_c1
778 nmdc:mga0a205_835587_c1
779 Ga0500641_0000560
780 2898329754

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

47

159

0.98

PF00196

GerE

Bacterial regulatory proteins, luxR family

183

238

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ve6-assembly1.cif.gz_B n-terminal domain of vrar 0.9659 7 140
1qmp-assembly2.cif.gz_B phosphorylated aspartate in the crystal structure of the sporulation response regulator, spo0a 0.964 7 125
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9626 6 118
3eul-assembly2.cif.gz_B structure of the signal receiver domain of the putative response regulator narl from mycobacterium tuberculosis 0.9621 5 127
1qmp-assembly4.cif.gz_D phosphorylated aspartate in the crystal structure of the sporulation response regulator, spo0a 0.9617 7 124
ID Description Score Start End Superfamily
1qmpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.964 7 125 3.40.50.2300
4if4D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9629 7 143 3.40.50.2300
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9626 6 118 3.40.50.2300
3eulC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9622 6 124 3.40.50.2300
4tmyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9549 8 123 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A838EBP0-F1-model_v4 Response regulator transcription factor 0.9844 4 143 GO:0000160
GO:0003677
AF-A0A847WSA3-F1-model_v4 Response regulator transcription factor 0.9812 7 145 GO:0000160
GO:0003677
GO:0010468
AF-A0A7C4SVK3-F1-model_v4 Response regulator transcription factor 0.9805 3 135 GO:0000160
GO:0003677
AF-A0A1W9UMY2-F1-model_v4 Response regulatory domain-containing protein 0.9794 5 140 GO:0000160
GO:0003677
AF-A0A4Q3SH94-F1-model_v4 Response regulator transcription factor 0.9749 6 144 GO:0000160
GO:0003677

Map