F432846

General Info

Members Datasets Scaffolds Average Seq Length
394 212 788 63

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100000994|Ga0068859_10000099421
Length 74
Sequence MRCGLFVASRFMKCPTCGKPVDWKNNPVRPFCSERCQLVDLGKWVEGEYRVPGEPLPQERNEPMAVEHDGDKEF

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
150 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
151 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
152 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
163 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
164 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
165 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
166 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
167 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
168 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
169 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
172 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
173 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
174 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
175 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
176 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
177 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
178 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
179 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
180 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
181 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
182 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
183 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
184 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
185 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
186 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
187 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
188 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
189 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
190 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
191 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
192 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
193 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
196 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
197 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
198 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
199 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
200 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
201 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
202 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
203 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.05
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 32.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100000994 3300005617 Bacteria 29030
2 SwRhRL2b_contig_1697206 2162886007 Unclassified 1381
3 CNBas_1000141 3300000531 Bacteria 2422
4 Ga0065714_10064425 3300005288 Bacteria 189652
5 Ga0065704_10008600 3300005289 Unclassified 2524
6 Ga0065712_10022271 3300005290 Bacteria 1795
7 Ga0065712_10357852 3300005290 Bacteria 756
8 Ga0065715_10008001 3300005293 Bacteria 2548
9 Ga0065715_10108500 3300005293 Bacteria 2715
10 Ga0065715_10133054 3300005293 Bacteria 1979
11 Ga0065715_10190292 3300005293 Bacteria 1419
12 Ga0065715_10321742 3300005293 Bacteria 1001
13 Ga0065715_10523586 3300005293 Bacteria 761
14 Ga0065715_10880911 3300005293 Unclassified 581
15 Ga0065715_10962828 3300005293 Unclassified 552
16 Ga0065707_10000669 3300005295 Bacteria 21770
17 Ga0065707_10010422 3300005295 Unclassified 2379
18 Ga0065707_10127685 3300005295 Bacteria 1979
19 Ga0065707_10212192 3300005295 Bacteria 1260
20 Ga0070676_10314050 3300005328 Unclassified 1066
21 Ga0070676_11339872 3300005328 Bacteria 548
22 Ga0070690_100354064 3300005330 Bacteria 1066
23 Ga0070670_100000167 3300005331 Bacteria 59452
24 Ga0070670_100026177 3300005331 Bacteria 5021
25 Ga0070670_100377939 3300005331 Bacteria 1248
26 Ga0070670_100394737 3300005331 Bacteria 1221
27 Ga0070670_101111825 3300005331 Unclassified 721
28 Ga0070677_10399736 3300005333 Unclassified 724
29 Ga0070677_10819505 3300005333 Unclassified 533
30 Ga0068869_100172400 3300005334 Bacteria 1691
31 Ga0068869_100183887 3300005334 Bacteria 1640
32 Ga0068869_100483274 3300005334 Bacteria 1032
33 Ga0068869_100815712 3300005334 Bacteria 803
34 Ga0068869_101242897 3300005334 Unclassified 656
35 Ga0070680_100001034 3300005336 Bacteria 19934
36 Ga0070680_100222869 3300005336 Unclassified 1592
37 Ga0070680_101853502 3300005336 Unclassified 523
38 Ga0070682_100004202 3300005337 Bacteria 7989
39 Ga0070682_101154879 3300005337 Unclassified 651
40 Ga0070660_100033365 3300005339 Unclassified 3881
41 Ga0070660_100439497 3300005339 Bacteria 1081
42 Ga0070689_100009282 3300005340 Bacteria 6969
43 Ga0070687_100151490 3300005343 Bacteria 1362
44 Ga0070687_100239166 3300005343 Bacteria 1122
45 Ga0070661_100031670 3300005344 Unclassified 3825
46 Ga0070661_101378114 3300005344 Unclassified 593
47 Ga0070692_10031460 3300005345 Bacteria 2660
48 Ga0070692_10039080 3300005345 Bacteria 2422
49 Ga0070692_10068831 3300005345 Bacteria 1882
50 Ga0070692_10570759 3300005345 Unclassified 744
51 Ga0070669_100367198 3300005353 Bacteria 1171
52 Ga0070675_100164155 3300005354 Unclassified 1912
53 Ga0070671_100221297 3300005355 Unclassified 1606
54 Ga0070671_100932317 3300005355 Bacteria 759
55 Ga0070673_100151583 3300005364 Unclassified 1964
56 Ga0070673_100194930 3300005364 Bacteria 1742
57 Ga0070659_100084156 3300005366 Bacteria 2543
58 Ga0070667_101177430 3300005367 Bacteria 717
59 Ga0070667_101929295 3300005367 Unclassified 556
60 Ga0070703_10073234 3300005406 Bacteria 1149
61 Ga0070701_10396117 3300005438 Bacteria 874
62 Ga0070705_100292799 3300005440 Bacteria 1163
63 Ga0070705_100432673 3300005440 Bacteria 983
64 Ga0070700_100000228 3300005441 Bacteria 30994
65 Ga0070700_100572573 3300005441 Unclassified 881
66 Ga0070694_100089192 3300005444 Bacteria 2160
67 Ga0070694_100194725 3300005444 Unclassified 1507
68 Ga0070694_100231054 3300005444 Bacteria 1391
69 Ga0070694_100809492 3300005444 Unclassified 769
70 Ga0070694_101159207 3300005444 Unclassified 646
71 Ga0070694_101594946 3300005444 Bacteria 554
72 Ga0070708_100002706 3300005445 Bacteria 13739
73 Ga0070708_100211592 3300005445 Unclassified 1817
74 Ga0070681_10001694 3300005458 Bacteria 19718
75 Ga0070681_10061530 3300005458 Unclassified 3728
76 Ga0068867_100709449 3300005459 Bacteria 888
77 Ga0068867_102405387 3300005459 Bacteria 501
78 Ga0070706_100003593 3300005467 Bacteria 15213
79 Ga0070707_100006191 3300005468 Bacteria 11143
80 Ga0070698_100002114 3300005471 Bacteria 22082
81 Ga0070698_100740634 3300005471 Bacteria 926
82 Ga0074259_10924214 3300005507 Unclassified 516
83 Ga0070699_101566819 3300005518 Unclassified 604
84 Ga0070699_101714065 3300005518 Unclassified 575
85 Ga0070679_100001724 3300005530 Bacteria 19718
86 Ga0070679_100030693 3300005530 Bacteria 5308
87 Ga0070697_100001663 3300005536 Bacteria 16961
88 Ga0070697_100077482 3300005536 Unclassified 2735
89 Ga0070697_101316136 3300005536 Unclassified 645
90 Ga0068853_100005108 3300005539 Bacteria 10253
91 Ga0068853_100095628 3300005539 Unclassified 2620
92 Ga0068853_100098164 3300005539 Bacteria 2586
93 Ga0068853_100334712 3300005539 Bacteria 1405
94 Ga0068853_100760029 3300005539 Unclassified 926
95 Ga0070695_100266338 3300005545 Unclassified 1253
96 Ga0070695_101773210 3300005545 Bacteria 517
97 Ga0070696_100274602 3300005546 Bacteria 1283
98 Ga0070696_100637641 3300005546 Bacteria 862
99 Ga0070696_100969979 3300005546 Unclassified 709
100 Ga0070693_100098870 3300005547 Bacteria 1774
101 Ga0070693_100116992 3300005547 Bacteria 1648
102 Ga0070665_101859551 3300005548 Unclassified 608
103 Ga0070704_101398684 3300005549 Bacteria 642
104 Ga0070664_100040907 3300005564 Unclassified 3910
105 Ga0070664_100147389 3300005564 Bacteria 2076
106 Ga0068857_100138403 3300005577 Bacteria 2199
107 Ga0068857_100342325 3300005577 Bacteria 1383
108 Ga0068857_100498437 3300005577 Bacteria 1143
109 Ga0068856_100001146 3300005614 Bacteria 27859
110 Ga0070702_100045089 3300005615 Bacteria 2492
111 Ga0070702_101236550 3300005615 Unclassified 604
112 Ga0068852_100039016 3300005616 Bacteria 3996
113 Ga0068859_100040457 3300005617 Bacteria 4679
114 Ga0068859_100093094 3300005617 Bacteria 3065
115 Ga0068859_100493669 3300005617 Unclassified 1319
116 Ga0068859_100553636 3300005617 Bacteria 1244
117 Ga0068859_100771474 3300005617 Bacteria 1050
118 Ga0068859_101954964 3300005617 Bacteria 648
119 Ga0068859_102419800 3300005617 Unclassified 579
120 Ga0068864_100060375 3300005618 Unclassified 3283
121 Ga0068864_101155604 3300005618 Unclassified 772
122 Ga0068864_101484971 3300005618 Unclassified 681
123 Ga0068861_100198880 3300005719 Bacteria 1681
124 Ga0068851_10006646 3300005834 Bacteria 5292
125 Ga0068870_10013691 3300005840 Bacteria 3818
126 Ga0068870_10069236 3300005840 Bacteria 1920
127 Ga0068870_10324293 3300005840 Unclassified 979
128 Ga0068863_100007830 3300005841 Bacteria 10447
129 Ga0068863_100944535 3300005841 Bacteria 864
130 Ga0068863_101064781 3300005841 Unclassified 813
131 Ga0068858_100015277 3300005842 Bacteria 7224
132 Ga0068858_100140067 3300005842 Bacteria 2270
133 Ga0068858_100186242 3300005842 Bacteria 1961
134 Ga0068858_100222037 3300005842 Bacteria 1790
135 Ga0068858_100971933 3300005842 Bacteria 831
136 Ga0068858_101109715 3300005842 Unclassified 777
137 Ga0068858_101755165 3300005842 Bacteria 613
138 Ga0068860_100114721 3300005843 Bacteria 2576
139 Ga0068860_100199501 3300005843 Bacteria 1938
140 Ga0068860_100905032 3300005843 Unclassified 898
141 Ga0068862_100068161 3300005844 Bacteria 3069
142 Ga0068862_100217071 3300005844 Bacteria 1730
143 Ga0081539_10002144 3300005985 Bacteria 29163
144 Ga0070716_101017534 3300006173 Unclassified 656
145 Ga0097621_100013481 3300006237 Bacteria 6094
146 Ga0068871_100091173 3300006358 Bacteria 2539
147 Ga0075431_100368107 3300006847 Bacteria 1443
148 Ga0075433_10111560 3300006852 Bacteria 2426
149 Ga0075433_10181386 3300006852 Bacteria 1873
150 Ga0075434_100024424 3300006871 Bacteria 5908
151 Ga0075434_100371600 3300006871 Bacteria 1451
152 Ga0075434_100861007 3300006871 Bacteria 922
153 Ga0075434_101614699 3300006871 Bacteria 657
154 Ga0075429_100033905 3300006880 Bacteria 4436
155 Ga0097620_100000994 3300006931 Bacteria 29030
156 Ga0097620_100040459 3300006931 Bacteria 4679
157 Ga0097620_100093094 3300006931 Bacteria 3065
158 Ga0097620_100493662 3300006931 Unclassified 1319
159 Ga0097620_100553637 3300006931 Bacteria 1244
160 Ga0097620_100771350 3300006931 Bacteria 1050
161 Ga0097620_102419774 3300006931 Unclassified 579
162 Ga0075435_100266835 3300007076 Bacteria 1459
163 Ga0075435_100626030 3300007076 Bacteria 934
164 Ga0105240_11458364 3300009093 Bacteria 718
165 Ga0111539_10001706 3300009094 Bacteria 29249
166 Ga0111539_13487270 3300009094 Unclassified 505
167 Ga0105247_10060037 3300009101 Bacteria 2356
168 Ga0105247_10349814 3300009101 Unclassified 1039
169 Ga0105247_11484082 3300009101 Unclassified 552
170 Ga0114129_10023494 3300009147 Bacteria 8740
171 Ga0114129_10138091 3300009147 Bacteria 3344
172 Ga0114129_10278050 3300009147 Unclassified 2238
173 Ga0114129_10542708 3300009147 Bacteria 1513
174 Ga0105243_10022334 3300009148 Unclassified 4808
175 Ga0105243_11120589 3300009148 Bacteria 796
176 Ga0105241_12604752 3300009174 Unclassified 508
177 Ga0105248_10036997 3300009177 Bacteria 5459
178 Ga0105248_10043134 3300009177 Bacteria 5058
179 Ga0105248_10049473 3300009177 Unclassified 4714
180 Ga0105248_10089899 3300009177 Bacteria 3457
181 Ga0105248_10943660 3300009177 Unclassified 974
182 Ga0105248_11596447 3300009177 Unclassified 739
183 Ga0105238_10006965 3300009551 Bacteria 11296
184 Ga0105249_10217723 3300009553 Unclassified 1877
185 Ga0105239_10993177 3300010375 Bacteria 965
186 Ga0105239_11143451 3300010375 Bacteria 897
187 Ga0105239_11424154 3300010375 Unclassified 800
188 Ga0105246_11027245 3300011119 Unclassified 748
189 Ga0157373_11062678 3300013100 Bacteria 606
190 Ga0157378_10819322 3300013297 Unclassified 957
191 Ga0157378_11306935 3300013297 Bacteria 766
192 Ga0163162_10033223 3300013306 Bacteria 5125
193 Ga0163162_10199723 3300013306 Bacteria 2128
194 Ga0163162_10799998 3300013306 Unclassified 1060
195 Ga0157372_10448601 3300013307 Unclassified 1503
196 Ga0157372_11605752 3300013307 Bacteria 749
197 Ga0157375_10079468 3300013308 Bacteria 3316
198 Ga0163163_10014737 3300014325 Bacteria 7194
199 Ga0157379_10853239 3300014968 Unclassified 862
200 Ga0207653_10003520 3300025885 Bacteria 4932
201 Ga0207710_10055099 3300025900 Bacteria 1792
202 Ga0207710_10179021 3300025900 Unclassified 1039
203 Ga0207647_10011682 3300025904 Bacteria 6146
204 Ga0207647_10176761 3300025904 Bacteria 1242
205 Ga0207643_10001070 3300025908 Bacteria 16179
206 Ga0207684_10000053 3300025910 Bacteria 225260
207 Ga0207684_10004145 3300025910 Bacteria 13786
208 Ga0207654_10281064 3300025911 Unclassified 1126
209 Ga0207654_10866859 3300025911 Unclassified 654
210 Ga0207707_10000033 3300025912 Bacteria 158362
211 Ga0207707_10024311 3300025912 Bacteria 5303
212 Ga0207707_10156436 3300025912 Bacteria 1994
213 Ga0207695_10096869 3300025913 Bacteria 2951
214 Ga0207695_11091408 3300025913 Unclassified 678
215 Ga0207671_10004666 3300025914 Bacteria 12970
216 Ga0207671_10508024 3300025914 Bacteria 961
217 Ga0207660_10000364 3300025917 Bacteria 29558
218 Ga0207660_10092079 3300025917 Bacteria 2249
219 Ga0207649_10019574 3300025920 Unclassified 3870
220 Ga0207652_10000032 3300025921 Bacteria 143319
221 Ga0207646_10552470 3300025922 Bacteria 1035
222 Ga0207681_10492087 3300025923 Bacteria 1003
223 Ga0207650_10000007 3300025925 Bacteria 530810
224 Ga0207650_10045699 3300025925 Bacteria 3222
225 Ga0207690_10071536 3300025932 Unclassified 2392
226 Ga0207686_11445164 3300025934 Unclassified 566
227 Ga0207711_10037622 3300025941 Bacteria 4112
228 Ga0207711_10169625 3300025941 Bacteria 1979
229 Ga0207711_10446917 3300025941 Unclassified 1203
230 Ga0207689_10113094 3300025942 Bacteria 2232
231 Ga0207689_10288677 3300025942 Unclassified 1359
232 Ga0207689_10408614 3300025942 Unclassified 1132
233 Ga0207689_10792304 3300025942 Bacteria 800
234 Ga0207689_11103259 3300025942 Unclassified 669
235 Ga0207679_10052592 3300025945 Unclassified 2987
236 Ga0207667_10552867 3300025949 Bacteria 1164
237 Ga0207651_10242833 3300025960 Bacteria 1469
238 Ga0207651_10539614 3300025960 Unclassified 1013
239 Ga0207712_10056459 3300025961 Bacteria 2766
240 Ga0207712_10218529 3300025961 Unclassified 1522
241 Ga0207640_10534375 3300025981 Bacteria 982
242 Ga0207658_11483338 3300025986 Unclassified 620
243 Ga0207703_10007918 3300026035 Bacteria 8402
244 Ga0207703_10057408 3300026035 Bacteria 3174
245 Ga0207703_10091205 3300026035 Bacteria 2562
246 Ga0207639_10021500 3300026041 Bacteria 4635
247 Ga0207639_10111901 3300026041 Unclassified 2227
248 Ga0207678_10609228 3300026067 Bacteria 958
249 Ga0207708_10000096 3300026075 Bacteria 67574
250 Ga0207708_10043988 3300026075 Bacteria 3402
251 Ga0207708_10048966 3300026075 Bacteria 3218
252 Ga0207702_10017905 3300026078 Bacteria 5863
253 Ga0207641_10057878 3300026088 Bacteria 3297
254 Ga0207641_10198682 3300026088 Bacteria 1847
255 Ga0207641_10340583 3300026088 Bacteria 1427
256 Ga0207641_11417742 3300026088 Bacteria 696
257 Ga0207641_11444084 3300026088 Unclassified 689
258 Ga0207648_10481735 3300026089 Bacteria 1133
259 Ga0207648_11089012 3300026089 Unclassified 749
260 Ga0207676_10014424 3300026095 Bacteria 5686
261 Ga0207676_10364287 3300026095 Bacteria 1340
262 Ga0207676_10559103 3300026095 Unclassified 1094
263 Ga0207676_10693541 3300026095 Unclassified 986
264 Ga0207676_11684882 3300026095 Unclassified 632
265 Ga0207674_10160801 3300026116 Bacteria 2200
266 Ga0207675_100076688 3300026118 Bacteria 3130
267 Ga0207675_100301092 3300026118 Bacteria 1562
268 Ga0207675_100660004 3300026118 Bacteria 1052
269 Ga0207675_101314643 3300026118 Bacteria 743
270 Ga0207675_102575530 3300026118 Unclassified 519
271 Ga0207698_10139196 3300026142 Unclassified 2088
272 Ga0207428_10004223 3300027907 Bacteria 13752
273 Ga0268265_10062500 3300028380 Bacteria 2861
274 Ga0268264_10079065 3300028381 Bacteria 2805
275 Ga0316182_1066197 3300030745 Bacteria 578
276 Ga0307408_100014368 3300031548 Bacteria 5259
277 Ga0307405_10178150 3300031731 Bacteria 1523
278 Ga0307405_10703421 3300031731 Unclassified 837
279 Ga0307406_10007304 3300031901 Bacteria 6120
280 Ga0307406_10736588 3300031901 Bacteria 826
281 Ga0307412_10002204 3300031911 Bacteria 10817
282 Ga0307409_100378298 3300031995 Unclassified 1345
283 Ga0307416_100162621 3300032002 Bacteria 2065
284 Ga0307416_100195708 3300032002 Bacteria 1912
285 Ga0307414_10002865 3300032004 Bacteria 9109
286 Ga0307414_10061636 3300032004 Bacteria 2658
287 Ga0307411_10024242 3300032005 Bacteria 3613
288 Ga0307411_10167436 3300032005 Bacteria 1653
289 Ga0307415_100024314 3300032126 Bacteria 3779
290 Ga0307415_100148343 3300032126 Bacteria 1801
291 Ga0373930_0049947 3300034816 Unclassified 911
292 Ga0373929_0177731 3300035085 Unclassified 585
293 Ga0373940_0003144 3300035088 Bacteria 3330
294 Ga0373940_0105387 3300035088 Bacteria 860
295 Ga0373949_0101826 3300035090 Bacteria 788
296 Ga0373941_0020796 3300035115 Unclassified 1844
297 Ga0373961_0039166 3300035241 Bacteria 1361
298 Ga0373962_0023974 3300035242 Bacteria 1628
299 Ga0373931_0519523 3300035691 Unclassified 770
300 Ga0395898_0037076 3300037466 Unclassified 4838
301 Ga0395905_1121696 3300037471 Bacteria 690
302 Ga0395901_0071182 3300038443 Bacteria 3624
303 Ga0242419_000677 3300038698 Bacteria 1908
304 Ga0242420_000546 3300038996 Bacteria 4334
305 Ga0242420_007008 3300038996 Bacteria 1800
306 Ga0242420_059632 3300038996 Bacteria 759
307 Ga0450889_001672 3300042144 Unclassified 2256
308 Ga0439459_0043254 3300042438 Unclassified 965
309 Ga0451576_0386806 3300045051 Bacteria 1466
310 Ga0496102_0404246 3300048905 Bacteria 1284
311 Ga0496103_0500776 3300048906 Bacteria 777
312 Ga0496104_0023836 3300048907 Bacteria 5628
313 Ga0496106_0008743 3300048909 Bacteria 7490
314 Ga0496106_0763540 3300048909 Bacteria 768
315 Ga0496106_0908084 3300048909 Bacteria 695
316 Ga0496107_0066734 3300048910 Bacteria 2609
317 Ga0496108_0212585 3300048911 Unclassified 1679
318 Ga0496108_0346779 3300048911 Bacteria 1296
319 Ga0496109_0208481 3300048912 Unclassified 1838
320 Ga0496109_0439964 3300048912 Unclassified 1232
321 Ga0496112_0318016 3300048915 Bacteria 1501
322 Ga0501290_038469 3300049513 Unclassified 709
323 Ga0501290_074255 3300049513 Bacteria 570
324 Ga0501291_002190 3300049514 Bacteria 2319
325 Ga0501292_001496 3300049515 Bacteria 2883
326 Ga0501292_028595 3300049515 Unclassified 929
327 Ga0501297_002426 3300049520 Bacteria 1802
328 Ga0501298_000750 3300049521 Bacteria 4555
329 Ga0501298_002573 3300049521 Bacteria 2757
330 Ga0501299_000194 3300049522 Bacteria 6846
331 Ga0501299_006528 3300049522 Bacteria 1832
332 Ga0501300_007951 3300049523 Bacteria 1554
333 Ga0501303_018764 3300049526 Bacteria 719
334 Ga0501041_0451902 3300049577 Bacteria 816
335 Ga0501198_002344 3300049649 Bacteria 2546
336 Ga0501206_007259 3300049653 Bacteria 1452
337 Ga0501210_020901 3300049657 Unclassified 618
338 Ga0501211_009134 3300049658 Unclassified 970
339 Ga0501216_023944 3300049660 Bacteria 1089
340 Ga0501216_061254 3300049660 Bacteria 759
341 Ga0501217_007750 3300049661 Bacteria 2307
342 Ga0501223_010497 3300049663 Bacteria 1861
343 Ga0501224_002568 3300049664 Bacteria 2489
344 Ga0501224_065842 3300049664 Unclassified 569
345 Ga0501227_019602 3300049665 Bacteria 1543
346 Ga0501227_051234 3300049665 Bacteria 1042
347 Ga0501233_001693 3300049668 Bacteria 3794
348 Ga0501233_005220 3300049668 Bacteria 2406
349 Ga0501235_013045 3300049669 Bacteria 1828
350 Ga0501235_229896 3300049669 Unclassified 512
351 Ga0501240_023323 3300049673 Bacteria 947
352 Ga0501242_050694 3300049674 Unclassified 609
353 Ga0501246_001735 3300049676 Unclassified 1688
354 Ga0501249_006278 3300049679 Bacteria 2444
355 Ga0501256_012097 3300049685 Bacteria 838
356 Ga0501257_073562 3300049686 Unclassified 875
357 Ga0501261_011789 3300049690 Bacteria 1169
358 Ga0501219_013180 3300049703 Unclassified 649
359 Ga0501221_054343 3300049704 Archaea 910
360 Ga0501225_0006865 3300049705 Unclassified 3319
361 Ga0501225_0011063 3300049705 Bacteria 2545
362 Ga0501234_002663 3300049707 Unclassified 2811
363 Ga0501234_003127 3300049707 Bacteria 2602
364 Ga0501245_005865 3300049708 Bacteria 1707
365 Ga0501245_014540 3300049708 Bacteria 1176
366 Ga0501245_014562 3300049708 Bacteria 1175
367 Ga0501080_0344812 3300049742 Bacteria 1346
368 Ga0501268_006376 3300049765 Bacteria 1729
369 Ga0501268_014832 3300049765 Unclassified 1274
370 Ga0501272_030211 3300049769 Unclassified 686
371 Ga0501273_000545 3300049770 Bacteria 3088
372 Ga0501278_018117 3300049774 Unclassified 628
373 Ga0501279_005718 3300049775 Bacteria 1638
374 Ga0501279_061954 3300049775 Unclassified 614
375 Ga0501283_006715 3300049779 Bacteria 1619
376 Ga0501200_06699 3300049849 Unclassified 573
377 Ga0501212_000220 3300049851 Bacteria 5033
378 Ga0501212_001025 3300049851 Bacteria 3021
379 Ga0501212_002753 3300049851 Archaea 2148
380 Ga0501226_010401 3300049853 Unclassified 1032
381 nmdc:mga05p37_101150_c1 3300050507 Unclassified 3550
382 nmdc:mga09592_62140_c1 3300050508 Unclassified 3159
383 nmdc:mga06r32_1475058_c1 3300050510 Unclassified 621
384 nmdc:mga08y16_32714_c1 3300050511 Bacteria 5467
385 nmdc:mga0n895_1259472_c1 3300050512 Bacteria 712
386 nmdc:mga0n895_1382938_c1 3300050512 Unclassified 673
387 nmdc:mga0n895_1552314_c1 3300050512 Unclassified 627
388 nmdc:mga0n895_51083_c1 3300050512 Bacteria 4055
389 nmdc:mga0rr50_850897_c1 3300050513 Bacteria 778
390 nmdc:mga0a205_52655_c1 3300050515 Unclassified 3928
391 nmdc:mga0a205_57987_c1 3300050515 Unclassified 3739
392 nmdc:mga0a205_9020_c1 3300050515 Bacteria 9090
393 Ga0501084_0096420 3300054114 Bacteria 2484
394 Ga0501082_0164174 3300060353 Bacteria 1930
395 Ga0068859_100000994
396 SwRhRL2b_contig_1697206
397 CNBas_1000141
398 Ga0065714_10064425
399 Ga0065704_10008600
400 Ga0065712_10022271
401 Ga0065712_10357852
402 Ga0065715_10008001
403 Ga0065715_10108500
404 Ga0065715_10133054
405 Ga0065715_10190292
406 Ga0065715_10321742
407 Ga0065715_10523586
408 Ga0065715_10880911
409 Ga0065715_10962828
410 Ga0065707_10000669
411 Ga0065707_10010422
412 Ga0065707_10127685
413 Ga0065707_10212192
414 Ga0070676_10314050
415 Ga0070676_11339872
416 Ga0070690_100354064
417 Ga0070670_100000167
418 Ga0070670_100026177
419 Ga0070670_100377939
420 Ga0070670_100394737
421 Ga0070670_101111825
422 Ga0070677_10399736
423 Ga0070677_10819505
424 Ga0068869_100172400
425 Ga0068869_100183887
426 Ga0068869_100483274
427 Ga0068869_100815712
428 Ga0068869_101242897
429 Ga0070680_100001034
430 Ga0070680_100222869
431 Ga0070680_101853502
432 Ga0070682_100004202
433 Ga0070682_101154879
434 Ga0070660_100033365
435 Ga0070660_100439497
436 Ga0070689_100009282
437 Ga0070687_100151490
438 Ga0070687_100239166
439 Ga0070661_100031670
440 Ga0070661_101378114
441 Ga0070692_10031460
442 Ga0070692_10039080
443 Ga0070692_10068831
444 Ga0070692_10570759
445 Ga0070669_100367198
446 Ga0070675_100164155
447 Ga0070671_100221297
448 Ga0070671_100932317
449 Ga0070673_100151583
450 Ga0070673_100194930
451 Ga0070659_100084156
452 Ga0070667_101177430
453 Ga0070667_101929295
454 Ga0070703_10073234
455 Ga0070701_10396117
456 Ga0070705_100292799
457 Ga0070705_100432673
458 Ga0070700_100000228
459 Ga0070700_100572573
460 Ga0070694_100089192
461 Ga0070694_100194725
462 Ga0070694_100231054
463 Ga0070694_100809492
464 Ga0070694_101159207
465 Ga0070694_101594946
466 Ga0070708_100002706
467 Ga0070708_100211592
468 Ga0070681_10001694
469 Ga0070681_10061530
470 Ga0068867_100709449
471 Ga0068867_102405387
472 Ga0070706_100003593
473 Ga0070707_100006191
474 Ga0070698_100002114
475 Ga0070698_100740634
476 Ga0074259_10924214
477 Ga0070699_101566819
478 Ga0070699_101714065
479 Ga0070679_100001724
480 Ga0070679_100030693
481 Ga0070697_100001663
482 Ga0070697_100077482
483 Ga0070697_101316136
484 Ga0068853_100005108
485 Ga0068853_100095628
486 Ga0068853_100098164
487 Ga0068853_100334712
488 Ga0068853_100760029
489 Ga0070695_100266338
490 Ga0070695_101773210
491 Ga0070696_100274602
492 Ga0070696_100637641
493 Ga0070696_100969979
494 Ga0070693_100098870
495 Ga0070693_100116992
496 Ga0070665_101859551
497 Ga0070704_101398684
498 Ga0070664_100040907
499 Ga0070664_100147389
500 Ga0068857_100138403
501 Ga0068857_100342325
502 Ga0068857_100498437
503 Ga0068856_100001146
504 Ga0070702_100045089
505 Ga0070702_101236550
506 Ga0068852_100039016
507 Ga0068859_100040457
508 Ga0068859_100093094
509 Ga0068859_100493669
510 Ga0068859_100553636
511 Ga0068859_100771474
512 Ga0068859_101954964
513 Ga0068859_102419800
514 Ga0068864_100060375
515 Ga0068864_101155604
516 Ga0068864_101484971
517 Ga0068861_100198880
518 Ga0068851_10006646
519 Ga0068870_10013691
520 Ga0068870_10069236
521 Ga0068870_10324293
522 Ga0068863_100007830
523 Ga0068863_100944535
524 Ga0068863_101064781
525 Ga0068858_100015277
526 Ga0068858_100140067
527 Ga0068858_100186242
528 Ga0068858_100222037
529 Ga0068858_100971933
530 Ga0068858_101109715
531 Ga0068858_101755165
532 Ga0068860_100114721
533 Ga0068860_100199501
534 Ga0068860_100905032
535 Ga0068862_100068161
536 Ga0068862_100217071
537 Ga0081539_10002144
538 Ga0070716_101017534
539 Ga0097621_100013481
540 Ga0068871_100091173
541 Ga0075431_100368107
542 Ga0075433_10111560
543 Ga0075433_10181386
544 Ga0075434_100024424
545 Ga0075434_100371600
546 Ga0075434_100861007
547 Ga0075434_101614699
548 Ga0075429_100033905
549 Ga0097620_100000994
550 Ga0097620_100040459
551 Ga0097620_100093094
552 Ga0097620_100493662
553 Ga0097620_100553637
554 Ga0097620_100771350
555 Ga0097620_102419774
556 Ga0075435_100266835
557 Ga0075435_100626030
558 Ga0105240_11458364
559 Ga0111539_10001706
560 Ga0111539_13487270
561 Ga0105247_10060037
562 Ga0105247_10349814
563 Ga0105247_11484082
564 Ga0114129_10023494
565 Ga0114129_10138091
566 Ga0114129_10278050
567 Ga0114129_10542708
568 Ga0105243_10022334
569 Ga0105243_11120589
570 Ga0105241_12604752
571 Ga0105248_10036997
572 Ga0105248_10043134
573 Ga0105248_10049473
574 Ga0105248_10089899
575 Ga0105248_10943660
576 Ga0105248_11596447
577 Ga0105238_10006965
578 Ga0105249_10217723
579 Ga0105239_10993177
580 Ga0105239_11143451
581 Ga0105239_11424154
582 Ga0105246_11027245
583 Ga0157373_11062678
584 Ga0157378_10819322
585 Ga0157378_11306935
586 Ga0163162_10033223
587 Ga0163162_10199723
588 Ga0163162_10799998
589 Ga0157372_10448601
590 Ga0157372_11605752
591 Ga0157375_10079468
592 Ga0163163_10014737
593 Ga0157379_10853239
594 Ga0207653_10003520
595 Ga0207710_10055099
596 Ga0207710_10179021
597 Ga0207647_10011682
598 Ga0207647_10176761
599 Ga0207643_10001070
600 Ga0207684_10000053
601 Ga0207684_10004145
602 Ga0207654_10281064
603 Ga0207654_10866859
604 Ga0207707_10000033
605 Ga0207707_10024311
606 Ga0207707_10156436
607 Ga0207695_10096869
608 Ga0207695_11091408
609 Ga0207671_10004666
610 Ga0207671_10508024
611 Ga0207660_10000364
612 Ga0207660_10092079
613 Ga0207649_10019574
614 Ga0207652_10000032
615 Ga0207646_10552470
616 Ga0207681_10492087
617 Ga0207650_10000007
618 Ga0207650_10045699
619 Ga0207690_10071536
620 Ga0207686_11445164
621 Ga0207711_10037622
622 Ga0207711_10169625
623 Ga0207711_10446917
624 Ga0207689_10113094
625 Ga0207689_10288677
626 Ga0207689_10408614
627 Ga0207689_10792304
628 Ga0207689_11103259
629 Ga0207679_10052592
630 Ga0207667_10552867
631 Ga0207651_10242833
632 Ga0207651_10539614
633 Ga0207712_10056459
634 Ga0207712_10218529
635 Ga0207640_10534375
636 Ga0207658_11483338
637 Ga0207703_10007918
638 Ga0207703_10057408
639 Ga0207703_10091205
640 Ga0207639_10021500
641 Ga0207639_10111901
642 Ga0207678_10609228
643 Ga0207708_10000096
644 Ga0207708_10043988
645 Ga0207708_10048966
646 Ga0207702_10017905
647 Ga0207641_10057878
648 Ga0207641_10198682
649 Ga0207641_10340583
650 Ga0207641_11417742
651 Ga0207641_11444084
652 Ga0207648_10481735
653 Ga0207648_11089012
654 Ga0207676_10014424
655 Ga0207676_10364287
656 Ga0207676_10559103
657 Ga0207676_10693541
658 Ga0207676_11684882
659 Ga0207674_10160801
660 Ga0207675_100076688
661 Ga0207675_100301092
662 Ga0207675_100660004
663 Ga0207675_101314643
664 Ga0207675_102575530
665 Ga0207698_10139196
666 Ga0207428_10004223
667 Ga0268265_10062500
668 Ga0268264_10079065
669 Ga0316182_1066197
670 Ga0307408_100014368
671 Ga0307405_10178150
672 Ga0307405_10703421
673 Ga0307406_10007304
674 Ga0307406_10736588
675 Ga0307412_10002204
676 Ga0307409_100378298
677 Ga0307416_100162621
678 Ga0307416_100195708
679 Ga0307414_10002865
680 Ga0307414_10061636
681 Ga0307411_10024242
682 Ga0307411_10167436
683 Ga0307415_100024314
684 Ga0307415_100148343
685 Ga0373930_0049947
686 Ga0373929_0177731
687 Ga0373940_0003144
688 Ga0373940_0105387
689 Ga0373949_0101826
690 Ga0373941_0020796
691 Ga0373961_0039166
692 Ga0373962_0023974
693 Ga0373931_0519523
694 Ga0395898_0037076
695 Ga0395905_1121696
696 Ga0395901_0071182
697 Ga0242419_000677
698 Ga0242420_000546
699 Ga0242420_007008
700 Ga0242420_059632
701 Ga0450889_001672
702 Ga0439459_0043254
703 Ga0451576_0386806
704 Ga0496102_0404246
705 Ga0496103_0500776
706 Ga0496104_0023836
707 Ga0496106_0008743
708 Ga0496106_0763540
709 Ga0496106_0908084
710 Ga0496107_0066734
711 Ga0496108_0212585
712 Ga0496108_0346779
713 Ga0496109_0208481
714 Ga0496109_0439964
715 Ga0496112_0318016
716 Ga0501290_038469
717 Ga0501290_074255
718 Ga0501291_002190
719 Ga0501292_001496
720 Ga0501292_028595
721 Ga0501297_002426
722 Ga0501298_000750
723 Ga0501298_002573
724 Ga0501299_000194
725 Ga0501299_006528
726 Ga0501300_007951
727 Ga0501303_018764
728 Ga0501041_0451902
729 Ga0501198_002344
730 Ga0501206_007259
731 Ga0501210_020901
732 Ga0501211_009134
733 Ga0501216_023944
734 Ga0501216_061254
735 Ga0501217_007750
736 Ga0501223_010497
737 Ga0501224_002568
738 Ga0501224_065842
739 Ga0501227_019602
740 Ga0501227_051234
741 Ga0501233_001693
742 Ga0501233_005220
743 Ga0501235_013045
744 Ga0501235_229896
745 Ga0501240_023323
746 Ga0501242_050694
747 Ga0501246_001735
748 Ga0501249_006278
749 Ga0501256_012097
750 Ga0501257_073562
751 Ga0501261_011789
752 Ga0501219_013180
753 Ga0501221_054343
754 Ga0501225_0006865
755 Ga0501225_0011063
756 Ga0501234_002663
757 Ga0501234_003127
758 Ga0501245_005865
759 Ga0501245_014540
760 Ga0501245_014562
761 Ga0501080_0344812
762 Ga0501268_006376
763 Ga0501268_014832
764 Ga0501272_030211
765 Ga0501273_000545
766 Ga0501278_018117
767 Ga0501279_005718
768 Ga0501279_061954
769 Ga0501283_006715
770 Ga0501200_06699
771 Ga0501212_000220
772 Ga0501212_001025
773 Ga0501212_002753
774 Ga0501226_010401
775 nmdc:mga05p37_101150_c1
776 nmdc:mga09592_62140_c1
777 nmdc:mga06r32_1475058_c1
778 nmdc:mga08y16_32714_c1
779 nmdc:mga0n895_1259472_c1
780 nmdc:mga0n895_1382938_c1
781 nmdc:mga0n895_1552314_c1
782 nmdc:mga0n895_51083_c1
783 nmdc:mga0rr50_850897_c1
784 nmdc:mga0a205_52655_c1
785 nmdc:mga0a205_57987_c1
786 nmdc:mga0a205_9020_c1
787 Ga0501084_0096420
788 Ga0501082_0164174

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03884

YacG

DNA gyrase inhibitor YacG

12

62

0.96

Map