F432612

General Info

Members Datasets Scaffolds Average Seq Length
393 255 786 599

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10040734|Ga0207646_100407344
Length 668
Sequence MSEPSDLPQGVAGLSEQLITGNRGHRRSSRHGVIRPQQYIQSGVMTEGGMSASSVLRKMRERQELQLAAALSRADRPMAAAWWSLLFVRGLLPAGFSIATGVLVGAIQHRYSLTAALTVVAVLFVLLQVLGPLHTALSANLGDRTAAWLYDEMTRACAAVPGIGHLEDPELAADLQVARDFDRGMTAPPLSVSMDFIAGGMVDMVAGLAQACVLFGFAWWAPPALAGAWLGTHWLLRESAVWKDRNTEEVRQAQRDADYAYRLAVDPPAAKELRIFGLPDWVLERFILSRRRLHRLQYEATRMRERSVLASLALVLAANMLVLSMLVSAALDHRLALGGLVVYASAAVGTSMIAFGGLNWALDGAAAPVAAVARLKSAMGRAGSITSGVRQADGMPADQIRFRDVTFAYPAAPERPVLRGLDLQIPAGSSLAIVGQNGAGKTTLAKLLCRLYDPQSGAIEVDGVDLRDLDLDSWRRRVTAVFQDFVRFELTLRENVAPAGGPAGARQTPTALDDAVNAALAEAGAGALASLDTVLAKGYAGGTDLSGGQWQRVALARALSAVHFGAGLVLLDEPTAQLDVRGEAEIFERILAATRSCTTILISHRFSTVRHVDRIAVVENGAXXXXGSHEELMDRRGRYWTMFSLQARRFVTGTPEEGEEEVTFDVLS

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
114 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
115 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
116 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
117 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
118 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
153 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
154 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
249 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
250 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 4.07
Rhizosphere 93.13
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10040734 3300025922 Bacteria 4177
2 JGI25406J46586_10000395 3300003203 Bacteria 20013
3 Ga0065707_10003985 3300005295 Bacteria 5197
4 Ga0070658_10063128 3300005327 Bacteria 3019
5 Ga0070683_100132776 3300005329 Bacteria 2357
6 Ga0070670_100032811 3300005331 Bacteria 4474
7 Ga0068868_100093072 3300005338 Bacteria 2430
8 Ga0070689_100005440 3300005340 Bacteria 8695
9 Ga0070689_100006735 3300005340 Bacteria 7986
10 Ga0070689_100056565 3300005340 Bacteria 3042
11 Ga0070689_100081255 3300005340 Bacteria 2544
12 Ga0070668_100000577 3300005347 Bacteria 24601
13 Ga0070675_100005660 3300005354 Bacteria 9568
14 Ga0070673_100063506 3300005364 Bacteria 2938
15 Ga0070688_100064652 3300005365 Bacteria 2322
16 Ga0070709_10000352 3300005434 Bacteria 28446
17 Ga0070709_10002165 3300005434 Bacteria 10642
18 Ga0070714_100016627 3300005435 Bacteria 5946
19 Ga0070714_100018334 3300005435 Bacteria 5685
20 Ga0070714_100039224 3300005435 Bacteria 3986
21 Ga0070714_100044310 3300005435 Bacteria 3766
22 Ga0070713_100001728 3300005436 Bacteria 14071
23 Ga0070713_100119052 3300005436 Bacteria 2313
24 Ga0070705_100007128 3300005440 Bacteria 5500
25 Ga0070700_100008065 3300005441 Bacteria 5726
26 Ga0070694_100005080 3300005444 Bacteria 7934
27 Ga0068867_100005194 3300005459 Bacteria 9188
28 Ga0070706_100006662 3300005467 Bacteria 10896
29 Ga0070706_100013308 3300005467 Bacteria 7608
30 Ga0070706_100031998 3300005467 Bacteria 4851
31 Ga0070707_100002575 3300005468 Bacteria 17229
32 Ga0070707_100090676 3300005468 Bacteria 2958
33 Ga0070698_100002394 3300005471 Bacteria 20660
34 Ga0070698_100002835 3300005471 Bacteria 19072
35 Ga0070698_100003372 3300005471 Bacteria 17579
36 Ga0070698_100018654 3300005471 Bacteria 7302
37 Ga0070699_100001925 3300005518 Bacteria 18726
38 Ga0070679_100035697 3300005530 Bacteria 4932
39 Ga0070684_100012844 3300005535 Bacteria 6728
40 Ga0070697_100015577 3300005536 Bacteria 5970
41 Ga0070695_100007491 3300005545 Bacteria 6465
42 Ga0070696_100002096 3300005546 Bacteria 13114
43 Ga0070696_100004035 3300005546 Bacteria 9789
44 Ga0070665_100061497 3300005548 Unclassified 3765
45 Ga0070665_100152919 3300005548 Bacteria 2310
46 Ga0070704_100017279 3300005549 Bacteria 4584
47 Ga0070704_100081314 3300005549 Bacteria 2386
48 Ga0068855_100005348 3300005563 Bacteria 15660
49 Ga0068855_100095299 3300005563 Bacteria 3430
50 Ga0070664_100031866 3300005564 Bacteria 4408
51 Ga0068856_100017600 3300005614 Bacteria 6926
52 Ga0068852_100052781 3300005616 Bacteria 3496
53 Ga0068859_100073530 3300005617 Bacteria 3456
54 Ga0068864_100007586 3300005618 Bacteria 8937
55 Ga0068861_100012577 3300005719 Bacteria 5904
56 Ga0068861_100025492 3300005719 Bacteria 4290
57 Ga0068870_10009983 3300005840 Bacteria 4341
58 Ga0068863_100079054 3300005841 Bacteria 3115
59 Ga0068858_100001973 3300005842 Bacteria 20964
60 Ga0068862_100039738 3300005844 Bacteria 3997
61 Ga0081538_10004681 3300005981 Bacteria 12537
62 Ga0081538_10019614 3300005981 Bacteria 5015
63 Ga0081538_10022524 3300005981 Bacteria 4562
64 Ga0081539_10000029 3300005985 Bacteria 322399
65 Ga0081539_10002730 3300005985 Bacteria 23874
66 Ga0070717_10031338 3300006028 Bacteria 4277
67 Ga0070717_10136836 3300006028 Bacteria 2110
68 Ga0075365_10003607 3300006038 Bacteria 8011
69 Ga0070715_10003067 3300006163 Bacteria 5241
70 Ga0070716_100003785 3300006173 Bacteria 7170
71 Ga0070712_100005464 3300006175 Bacteria 7870
72 Ga0075428_100004289 3300006844 Bacteria 15704
73 Ga0075428_100022400 3300006844 Bacteria 6995
74 Ga0075428_100037633 3300006844 Bacteria 5325
75 Ga0075428_100038305 3300006844 Bacteria 5276
76 Ga0075428_100043233 3300006844 Bacteria 4953
77 Ga0075430_100000737 3300006846 Bacteria 25077
78 Ga0075430_100004548 3300006846 Bacteria 11678
79 Ga0075430_100029794 3300006846 Bacteria 4632
80 Ga0075430_100041809 3300006846 Bacteria 3878
81 Ga0075431_100010915 3300006847 Bacteria 9139
82 Ga0075431_100039903 3300006847 Bacteria 4837
83 Ga0075431_100120075 3300006847 Bacteria 2712
84 Ga0075433_10001651 3300006852 Bacteria 16579
85 Ga0075434_100018538 3300006871 Bacteria 6725
86 Ga0075434_100038993 3300006871 Bacteria 4708
87 Ga0075434_100121185 3300006871 Bacteria 2631
88 Ga0075429_100009816 3300006880 Bacteria 8300
89 Ga0075429_100025986 3300006880 Bacteria 5082
90 Ga0075429_100065396 3300006880 Bacteria 3166
91 Ga0075429_100078224 3300006880 Bacteria 2882
92 Ga0075436_100044075 3300006914 Bacteria 3075
93 Ga0097620_100073533 3300006931 Bacteria 3456
94 Ga0075435_100015962 3300007076 Bacteria 5655
95 Ga0105240_10002158 3300009093 Bacteria 32145
96 Ga0105240_10002353 3300009093 Bacteria 30498
97 Ga0111539_10002014 3300009094 Bacteria 27110
98 Ga0111539_10018200 3300009094 Bacteria 8703
99 Ga0111539_10090817 3300009094 Bacteria 3589
100 Ga0105245_10140496 3300009098 Bacteria 2274
101 Ga0114129_10001622 3300009147 Bacteria 30502
102 Ga0114129_10019816 3300009147 Bacteria 9572
103 Ga0114129_10020761 3300009147 Bacteria 9334
104 Ga0114129_10029379 3300009147 Bacteria 7787
105 Ga0114129_10032013 3300009147 Bacteria 7433
106 Ga0114129_10032794 3300009147 Bacteria 7338
107 Ga0114129_10151916 3300009147 Bacteria 3168
108 Ga0114129_10157905 3300009147 Bacteria 3100
109 Ga0114129_10254302 3300009147 Bacteria 2357
110 Ga0114129_10265644 3300009147 Bacteria 2298
111 Ga0105243_10041412 3300009148 Bacteria 3602
112 Ga0105242_10146143 3300009176 Bacteria 2057
113 Ga0105248_10053689 3300009177 Bacteria 4520
114 Ga0105248_10111846 3300009177 Bacteria 3080
115 Ga0157370_10000533 3300013104 Bacteria 47668
116 Ga0157370_10012981 3300013104 Bacteria 8608
117 Ga0157369_10009202 3300013105 Bacteria 11302
118 Ga0157369_10011778 3300013105 Bacteria 9932
119 Ga0157369_10079224 3300013105 Bacteria 3518
120 Ga0157374_10014772 3300013296 Bacteria 6838
121 Ga0163162_10065923 3300013306 Bacteria 3670
122 Ga0157372_10011041 3300013307 Bacteria 9613
123 Ga0157372_10044165 3300013307 Bacteria 4937
124 Ga0157372_10078509 3300013307 Bacteria 3730
125 Ga0157375_10043943 3300013308 Bacteria 4336
126 Ga0163163_10000153 3300014325 Bacteria 71877
127 Ga0163163_10018745 3300014325 Bacteria 6486
128 Ga0163163_10019110 3300014325 Bacteria 6429
129 Ga0163163_10019997 3300014325 Bacteria 6299
130 Ga0163163_10174004 3300014325 Bacteria 2199
131 Ga0182008_10007356 3300014497 Bacteria 6085
132 Ga0157379_10003915 3300014968 Bacteria 12693
133 Ga0213872_10000509 3300021361 Bacteria 30664
134 Ga0213876_10005819 3300021384 Bacteria 6751
135 Ga0213875_10001205 3300021388 Bacteria 17615
136 Ga0207692_10002204 3300025898 Bacteria 7455
137 Ga0207680_10011526 3300025903 Bacteria 4470
138 Ga0207685_10003438 3300025905 Bacteria 3850
139 Ga0207699_10000266 3300025906 Bacteria 28713
140 Ga0207699_10003859 3300025906 Bacteria 7159
141 Ga0207645_10011980 3300025907 Bacteria 5898
142 Ga0207643_10031374 3300025908 Bacteria 2962
143 Ga0207705_10088578 3300025909 Bacteria 2264
144 Ga0207684_10010044 3300025910 Bacteria 8339
145 Ga0207707_10036881 3300025912 Bacteria 4272
146 Ga0207695_10001522 3300025913 Bacteria 38439
147 Ga0207695_10049668 3300025913 Bacteria 4419
148 Ga0207693_10005786 3300025915 Bacteria 10254
149 Ga0207693_10029210 3300025915 Bacteria 4356
150 Ga0207693_10041813 3300025915 Bacteria 3608
151 Ga0207660_10080602 3300025917 Bacteria 2391
152 Ga0207652_10002617 3300025921 Bacteria 15109
153 Ga0207646_10003495 3300025922 Bacteria 17712
154 Ga0207646_10027483 3300025922 Bacteria 5189
155 Ga0207646_10061590 3300025922 Bacteria 3349
156 Ga0207681_10042218 3300025923 Bacteria 3045
157 Ga0207659_10000397 3300025926 Bacteria 26260
158 Ga0207659_10014793 3300025926 Bacteria 5042
159 Ga0207700_10028590 3300025928 Bacteria 3922
160 Ga0207700_10056935 3300025928 Bacteria 2945
161 Ga0207700_10083848 3300025928 Bacteria 2496
162 Ga0207664_10048968 3300025929 Bacteria 3325
163 Ga0207664_10054988 3300025929 Bacteria 3157
164 Ga0207664_10071471 3300025929 Bacteria 2795
165 Ga0207706_10125823 3300025933 Bacteria 2254
166 Ga0207709_10018868 3300025935 Bacteria 3868
167 Ga0207670_10003569 3300025936 Bacteria 8262
168 Ga0207665_10007280 3300025939 Bacteria 7322
169 Ga0207691_10085654 3300025940 Bacteria 2828
170 Ga0207689_10093207 3300025942 Bacteria 2474
171 Ga0207661_10078816 3300025944 Bacteria 2714
172 Ga0207667_10057389 3300025949 Bacteria 4086
173 Ga0207667_10097886 3300025949 Bacteria 3027
174 Ga0207668_10066158 3300025972 Bacteria 2561
175 Ga0207678_10055709 3300026067 Bacteria 3405
176 Ga0207708_10040429 3300026075 Bacteria 3556
177 Ga0207648_10013162 3300026089 Bacteria 7711
178 Ga0207676_10095560 3300026095 Bacteria 2451
179 Ga0207675_100027314 3300026118 Bacteria 5316
180 Ga0207675_100039333 3300026118 Bacteria 4414
181 Ga0207675_100057045 3300026118 Bacteria 3643
182 Ga0207698_10155794 3300026142 Bacteria 1990
183 Ga0207428_10016464 3300027907 Bacteria 6359
184 Ga0268266_10021406 3300028379 Bacteria 5508
185 Ga0268265_10057034 3300028380 Bacteria 2975
186 Ga0268265_10102943 3300028380 Bacteria 2311
187 Ga0268264_10053109 3300028381 Bacteria 3380
188 Ga0268264_10064598 3300028381 Bacteria 3081
189 Ga0265337_1002616 3300028556 Bacteria 8127
190 Ga0265326_10001970 3300028558 Bacteria 7031
191 Ga0265319_1003879 3300028563 Bacteria 7630
192 Ga0265334_10002664 3300028573 Bacteria 8259
193 Ga0265323_10005483 3300028653 Bacteria 5390
194 Ga0265322_10003489 3300028654 Bacteria 4744
195 Ga0265338_10007069 3300028800 Bacteria 14075
196 Ga0265338_10014471 3300028800 Bacteria 8780
197 Ga0265338_10023708 3300028800 Bacteria 6295
198 Ga0265324_10003957 3300029957 Bacteria 6856
199 Ga0265320_10004715 3300031240 Bacteria 8883
200 Ga0265325_10003596 3300031241 Bacteria 10062
201 Ga0265340_10016077 3300031247 Bacteria 3879
202 Ga0265339_10008266 3300031249 Bacteria 6631
203 Ga0265316_10032599 3300031344 Bacteria 4250
204 Ga0307508_10001255 3300031616 Bacteria 28934
205 Ga0265342_10015726 3300031712 Bacteria 4968
206 Ga0307405_10007194 3300031731 Bacteria 5543
207 Ga0307409_100002219 3300031995 Bacteria 10038
208 Ga0307414_10110929 3300032004 Bacteria 2088
209 Ga0373934_0011209 3300035086 Bacteria 3374
210 Ga0373934_0015596 3300035086 Bacteria 2884
211 Ga0373940_0000515 3300035088 Bacteria 6071
212 Ga0373923_0003834 3300035111 Bacteria 4894
213 Ga0373923_0025195 3300035111 Bacteria 2355
214 Ga0373936_0005952 3300035113 Bacteria 4592
215 Ga0373941_0006073 3300035115 Bacteria 2888
216 Ga0373954_0009483 3300035118 Bacteria 4280
217 Ga0373954_0013179 3300035118 Bacteria 3681
218 Ga0373956_0003161 3300035119 Bacteria 6657
219 Ga0373956_0008535 3300035119 Bacteria 4147
220 Ga0373957_0000422 3300035120 Bacteria 10676
221 Ga0373955_0032614 3300035172 Bacteria 2735
222 Ga0373942_0001710 3300035207 Bacteria 5573
223 Ga0373961_0001168 3300035241 Bacteria 8199
224 Ga0373935_0006118 3300035692 Bacteria 7157
225 Ga0373935_0109933 3300035692 Unclassified 1828
226 Ga0373927_0003429 3300035695 Bacteria 11362
227 Ga0373927_0015566 3300035695 Bacteria 5024
228 Ga0373947_0010969 3300035725 Bacteria 5200
229 Ga0373937_0030281 3300036401 Bacteria 4901
230 Ga0373925_0000017 3300037068 Bacteria 174289
231 Ga0373925_0031659 3300037068 Bacteria 3888
232 Ga0373925_0048317 3300037068 Bacteria 3170
233 Ga0436364_0294229 3300037853 Bacteria 17589
234 Ga0436365_0117976 3300039437 Bacteria 6928
235 Ga0436365_1191808 3300039437 Bacteria 8594
236 Ga0436360_0163647 3300039438 Bacteria 2527
237 Ga0436361_0495466 3300039447 Bacteria 133171
238 Ga0436362_0691512 3300039453 Bacteria 2117
239 Ga0439450_000338 3300042008 Bacteria 5866
240 Ga0439451_007218 3300042009 Bacteria 2269
241 Ga0439463_000141 3300042016 Bacteria 18284
242 Ga0439464_0000456 3300042439 Bacteria 8182
243 Ga0453684_0022283 3300044712 Bacteria 9408
244 Ga0466960_0005883 3300044901 Bacteria 4888
245 Ga0451576_0065484 3300045051 Bacteria 3784
246 Ga0466967_0012275 3300045976 Bacteria 6544
247 Ga0495592_0024739 3300046454 Bacteria 4564
248 Ga0495592_0050178 3300046454 Bacteria 3101
249 Ga0495603_0057376 3300046455 Bacteria 2304
250 Ga0495629_0001321 3300046459 Bacteria 19487
251 Ga0495641_0010269 3300046461 Bacteria 5443
252 Ga0495651_0020165 3300046462 Bacteria 5174
253 Ga0495651_0073684 3300046462 Bacteria 2591
254 Ga0495653_0017793 3300046463 Bacteria 5780
255 Ga0495580_0009935 3300046472 Bacteria 7449
256 Ga0495582_0010188 3300046473 Bacteria 5176
257 Ga0495662_0004723 3300046476 Bacteria 6824
258 Ga0495664_0012264 3300046477 Bacteria 4852
259 Ga0495664_0016436 3300046477 Bacteria 4215
260 Ga0495594_0041704 3300046499 Bacteria 2512
261 Ga0495608_0006164 3300046511 Bacteria 8514
262 Ga0495608_0006315 3300046511 Bacteria 8407
263 Ga0495618_0008218 3300046514 Bacteria 6320
264 Ga0495630_0002765 3300046517 Bacteria 12182
265 Ga0495630_0051404 3300046517 Bacteria 3084
266 Ga0495632_0014182 3300046519 Bacteria 4519
267 Ga0495665_0034349 3300046531 Bacteria 2711
268 Ga0495640_0011542 3300046533 Bacteria 6794
269 Ga0495640_0050150 3300046533 Bacteria 2877
270 Ga0495640_0081801 3300046533 Bacteria 2146
271 Ga0495586_0022694 3300046535 Bacteria 3349
272 Ga0495586_0024283 3300046535 Bacteria 3239
273 Ga0495586_0046513 3300046535 Bacteria 2339
274 Ga0495587_0015778 3300046536 Bacteria 4709
275 Ga0495645_0015462 3300046543 Bacteria 5427
276 Ga0495645_0028132 3300046543 Bacteria 4084
277 Ga0495667_0011027 3300046559 Bacteria 6111
278 Ga0495667_0051131 3300046559 Bacteria 2726
279 Ga0495667_0074774 3300046559 Bacteria 2205
280 Ga0495656_0014776 3300046615 Bacteria 2934
281 Ga0495635_0010056 3300046663 Bacteria 6615
282 Ga0495635_0073934 3300046663 Bacteria 2334
283 Ga0495657_0025962 3300046675 Bacteria 4154
284 Ga0495599_0058564 3300046678 Bacteria 2409
285 Ga0495646_0010773 3300046680 Bacteria 5809
286 Ga0495647_0027959 3300046681 Bacteria 2076
287 Ga0495613_0000507 3300046689 Bacteria 32852
288 Ga0495613_0039507 3300046689 Bacteria 3498
289 Ga0495624_0012945 3300046690 Bacteria 5691
290 Ga0495600_0001840 3300046809 Bacteria 11877
291 Ga0495600_0012872 3300046809 Bacteria 5241
292 Ga0495581_0004729 3300047315 Bacteria 7858
293 Ga0495581_0064830 3300047315 Bacteria 2111
294 Ga0495604_0035386 3300047317 Bacteria 3944
295 Ga0495674_0001285 3300047319 Bacteria 24426
296 Ga0495674_0048867 3300047319 Bacteria 3741
297 Ga0495672_0003529 3300047320 Bacteria 13323
298 Ga0495676_0055063 3300047321 Bacteria 3157
299 Ga0495676_0073552 3300047321 Bacteria 2620
300 Ga0495680_0065402 3300047322 Bacteria 2785
301 Ga0495680_0084322 3300047322 Bacteria 2394
302 Ga0495675_0032510 3300047444 Bacteria 3329
303 Ga0495675_0048412 3300047444 Bacteria 2704
304 Ga0495684_0000188 3300047471 Bacteria 47553
305 Ga0495684_0054284 3300047471 Bacteria 3056
306 Ga0495593_0007308 3300047673 Bacteria 6472
307 Ga0495602_0051254 3300048088 Bacteria 3677
308 Ga0496100_0020705 3300048903 Bacteria 3948
309 Ga0496101_0002362 3300048904 Bacteria 11578
310 Ga0496104_0012415 3300048907 Bacteria 7659
311 Ga0496105_0011955 3300048908 Bacteria 6873
312 Ga0496105_0017419 3300048908 Bacteria 5760
313 Ga0496106_0096998 3300048909 Bacteria 2282
314 Ga0496108_0000052 3300048911 Bacteria 131465
315 Ga0496109_0010954 3300048912 Bacteria 7770
316 Ga0496109_0081673 3300048912 Bacteria 2978
317 Ga0496110_0022970 3300048913 Bacteria 5301
318 Ga0496110_0023300 3300048913 Bacteria 5264
319 Ga0496112_0052334 3300048915 Bacteria 4007
320 Ga0496112_0066601 3300048915 Bacteria 3554
321 Ga0496113_0101224 3300048916 Bacteria 2233
322 Ga0496114_0011339 3300048917 Bacteria 7120
323 Ga0496115_0002218 3300048918 Bacteria 13934
324 Ga0501031_0032125 3300049568 Bacteria 3423
325 Ga0501036_0001133 3300049572 Bacteria 20293
326 Ga0501038_0018244 3300049574 Bacteria 6334
327 Ga0501039_0000576 3300049575 Bacteria 26547
328 Ga0501041_0000962 3300049577 Bacteria 15693
329 Ga0501042_0001615 3300049578 Bacteria 13410
330 Ga0501042_0012039 3300049578 Bacteria 5851
331 Ga0501043_0049476 3300049579 Bacteria 3304
332 Ga0501046_0005787 3300049580 Bacteria 11032
333 Ga0501047_0021197 3300049581 Bacteria 6241
334 Ga0501048_0006356 3300049582 Bacteria 8981
335 Ga0501067_0001947 3300049583 Bacteria 11376
336 Ga0501068_0020944 3300049584 Bacteria 3816
337 Ga0501069_0015007 3300049585 Bacteria 4149
338 Ga0501071_0037610 3300049587 Bacteria 3456
339 Ga0501074_0009716 3300049590 Bacteria 6987
340 Ga0501075_0000276 3300049591 Bacteria 28312
341 Ga0501075_0000937 3300049591 Bacteria 18541
342 Ga0501075_0021553 3300049591 Bacteria 4700
343 Ga0501076_0000514 3300049592 Bacteria 24543
344 Ga0501076_0002383 3300049592 Bacteria 12866
345 Ga0501077_0000261 3300049593 Bacteria 31152
346 Ga0501077_0002045 3300049593 Bacteria 12173
347 Ga0501079_0003545 3300049741 Bacteria 11475
348 Ga0501080_0101021 3300049742 Bacteria 2676
349 Ga0501081_0001434 3300049743 Bacteria 14583
350 Ga0501083_0023589 3300049744 Bacteria 4266
351 Ga0501035_0106049 3300049822 Bacteria 2464
352 Ga0501045_0000956 3300049824 Bacteria 18892
353 Ga0501045_0077084 3300049824 Bacteria 2456
354 nmdc:mga05p37_13269_c1 3300050507 Bacteria 9864
355 nmdc:mga05p37_135550_c1 3300050507 Bacteria 3019
356 nmdc:mga05p37_19907_c1 3300050507 Bacteria 8117
357 nmdc:mga05p37_24186_c1 3300050507 Bacteria 7381
358 nmdc:mga05p37_36704_c1 3300050507 Bacteria 6011
359 nmdc:mga09592_25711_c1 3300050508 Bacteria 4874
360 nmdc:mga09592_5023_c1 3300050508 Bacteria 10727
361 nmdc:mga09592_79292_c1 3300050508 Bacteria 2795
362 nmdc:mga0qj67_3038_c1 3300050509 Bacteria 12060
363 nmdc:mga0qj67_48901_c1 3300050509 Bacteria 3342
364 nmdc:mga0qj67_5362_c1 3300050509 Bacteria 9362
365 nmdc:mga0qj67_75_c1 3300050509 Bacteria 70543
366 nmdc:mga06r32_106078_c1 3300050510 Bacteria 2760
367 nmdc:mga06r32_15363_c1 3300050510 Bacteria 6954
368 nmdc:mga06r32_46968_c1 3300050510 Bacteria 4122
369 nmdc:mga08y16_24128_c1 3300050511 Bacteria 6421
370 nmdc:mga08y16_37432_c1 3300050511 Bacteria 5095
371 nmdc:mga0n895_211543_c1 3300050512 Bacteria 1969
372 nmdc:mga0n895_25871_c1 3300050512 Bacteria 5551
373 nmdc:mga0n895_33284_c1 3300050512 Bacteria 4953
374 nmdc:mga0rr50_6064_c1 3300050513 Bacteria 7303
375 nmdc:mga08x19_25123_c1 3300050514 Bacteria 3710
376 nmdc:mga0a205_648_c2 3300050515 Bacteria 16589
377 Ga0495601_0003259 3300053077 Bacteria 9273
378 Ga0495601_0004953 3300053077 Bacteria 7728
379 Ga0495601_0017982 3300053077 Bacteria 4297
380 Ga0495612_0028587 3300053078 Bacteria 2245
381 Ga0495619_0009932 3300053085 Bacteria 5994
382 Ga0495619_0102787 3300053085 Bacteria 1946
383 Ga0500646_0000046 3300053090 Bacteria 33395
384 Ga0500566_0000517 3300053094 Bacteria 21548
385 Ga0500555_000650 3300053103 Bacteria 13285
386 Ga0500616_0000202 3300053153 Bacteria 97657
387 Ga0501084_0027013 3300054114 Bacteria 4795
388 Ga0501084_0055254 3300054114 Bacteria 3322
389 Ga0501084_0083718 3300054114 Bacteria 2678
390 Ga0590074_002708 3300059423 Bacteria 2916
391 Ga0501082_0000362 3300060353 Bacteria 40134
392 Ga0501082_0004074 3300060353 Bacteria 12750
393 Ga0530510_0004094 3300061734 Bacteria 10062
394 Ga0207646_10040734
395 JGI25406J46586_10000395
396 Ga0065707_10003985
397 Ga0070658_10063128
398 Ga0070683_100132776
399 Ga0070670_100032811
400 Ga0068868_100093072
401 Ga0070689_100005440
402 Ga0070689_100006735
403 Ga0070689_100056565
404 Ga0070689_100081255
405 Ga0070668_100000577
406 Ga0070675_100005660
407 Ga0070673_100063506
408 Ga0070688_100064652
409 Ga0070709_10000352
410 Ga0070709_10002165
411 Ga0070714_100016627
412 Ga0070714_100018334
413 Ga0070714_100039224
414 Ga0070714_100044310
415 Ga0070713_100001728
416 Ga0070713_100119052
417 Ga0070705_100007128
418 Ga0070700_100008065
419 Ga0070694_100005080
420 Ga0068867_100005194
421 Ga0070706_100006662
422 Ga0070706_100013308
423 Ga0070706_100031998
424 Ga0070707_100002575
425 Ga0070707_100090676
426 Ga0070698_100002394
427 Ga0070698_100002835
428 Ga0070698_100003372
429 Ga0070698_100018654
430 Ga0070699_100001925
431 Ga0070679_100035697
432 Ga0070684_100012844
433 Ga0070697_100015577
434 Ga0070695_100007491
435 Ga0070696_100002096
436 Ga0070696_100004035
437 Ga0070665_100061497
438 Ga0070665_100152919
439 Ga0070704_100017279
440 Ga0070704_100081314
441 Ga0068855_100005348
442 Ga0068855_100095299
443 Ga0070664_100031866
444 Ga0068856_100017600
445 Ga0068852_100052781
446 Ga0068859_100073530
447 Ga0068864_100007586
448 Ga0068861_100012577
449 Ga0068861_100025492
450 Ga0068870_10009983
451 Ga0068863_100079054
452 Ga0068858_100001973
453 Ga0068862_100039738
454 Ga0081538_10004681
455 Ga0081538_10019614
456 Ga0081538_10022524
457 Ga0081539_10000029
458 Ga0081539_10002730
459 Ga0070717_10031338
460 Ga0070717_10136836
461 Ga0075365_10003607
462 Ga0070715_10003067
463 Ga0070716_100003785
464 Ga0070712_100005464
465 Ga0075428_100004289
466 Ga0075428_100022400
467 Ga0075428_100037633
468 Ga0075428_100038305
469 Ga0075428_100043233
470 Ga0075430_100000737
471 Ga0075430_100004548
472 Ga0075430_100029794
473 Ga0075430_100041809
474 Ga0075431_100010915
475 Ga0075431_100039903
476 Ga0075431_100120075
477 Ga0075433_10001651
478 Ga0075434_100018538
479 Ga0075434_100038993
480 Ga0075434_100121185
481 Ga0075429_100009816
482 Ga0075429_100025986
483 Ga0075429_100065396
484 Ga0075429_100078224
485 Ga0075436_100044075
486 Ga0097620_100073533
487 Ga0075435_100015962
488 Ga0105240_10002158
489 Ga0105240_10002353
490 Ga0111539_10002014
491 Ga0111539_10018200
492 Ga0111539_10090817
493 Ga0105245_10140496
494 Ga0114129_10001622
495 Ga0114129_10019816
496 Ga0114129_10020761
497 Ga0114129_10029379
498 Ga0114129_10032013
499 Ga0114129_10032794
500 Ga0114129_10151916
501 Ga0114129_10157905
502 Ga0114129_10254302
503 Ga0114129_10265644
504 Ga0105243_10041412
505 Ga0105242_10146143
506 Ga0105248_10053689
507 Ga0105248_10111846
508 Ga0157370_10000533
509 Ga0157370_10012981
510 Ga0157369_10009202
511 Ga0157369_10011778
512 Ga0157369_10079224
513 Ga0157374_10014772
514 Ga0163162_10065923
515 Ga0157372_10011041
516 Ga0157372_10044165
517 Ga0157372_10078509
518 Ga0157375_10043943
519 Ga0163163_10000153
520 Ga0163163_10018745
521 Ga0163163_10019110
522 Ga0163163_10019997
523 Ga0163163_10174004
524 Ga0182008_10007356
525 Ga0157379_10003915
526 Ga0213872_10000509
527 Ga0213876_10005819
528 Ga0213875_10001205
529 Ga0207692_10002204
530 Ga0207680_10011526
531 Ga0207685_10003438
532 Ga0207699_10000266
533 Ga0207699_10003859
534 Ga0207645_10011980
535 Ga0207643_10031374
536 Ga0207705_10088578
537 Ga0207684_10010044
538 Ga0207707_10036881
539 Ga0207695_10001522
540 Ga0207695_10049668
541 Ga0207693_10005786
542 Ga0207693_10029210
543 Ga0207693_10041813
544 Ga0207660_10080602
545 Ga0207652_10002617
546 Ga0207646_10003495
547 Ga0207646_10027483
548 Ga0207646_10061590
549 Ga0207681_10042218
550 Ga0207659_10000397
551 Ga0207659_10014793
552 Ga0207700_10028590
553 Ga0207700_10056935
554 Ga0207700_10083848
555 Ga0207664_10048968
556 Ga0207664_10054988
557 Ga0207664_10071471
558 Ga0207706_10125823
559 Ga0207709_10018868
560 Ga0207670_10003569
561 Ga0207665_10007280
562 Ga0207691_10085654
563 Ga0207689_10093207
564 Ga0207661_10078816
565 Ga0207667_10057389
566 Ga0207667_10097886
567 Ga0207668_10066158
568 Ga0207678_10055709
569 Ga0207708_10040429
570 Ga0207648_10013162
571 Ga0207676_10095560
572 Ga0207675_100027314
573 Ga0207675_100039333
574 Ga0207675_100057045
575 Ga0207698_10155794
576 Ga0207428_10016464
577 Ga0268266_10021406
578 Ga0268265_10057034
579 Ga0268265_10102943
580 Ga0268264_10053109
581 Ga0268264_10064598
582 Ga0265337_1002616
583 Ga0265326_10001970
584 Ga0265319_1003879
585 Ga0265334_10002664
586 Ga0265323_10005483
587 Ga0265322_10003489
588 Ga0265338_10007069
589 Ga0265338_10014471
590 Ga0265338_10023708
591 Ga0265324_10003957
592 Ga0265320_10004715
593 Ga0265325_10003596
594 Ga0265340_10016077
595 Ga0265339_10008266
596 Ga0265316_10032599
597 Ga0307508_10001255
598 Ga0265342_10015726
599 Ga0307405_10007194
600 Ga0307409_100002219
601 Ga0307414_10110929
602 Ga0373934_0011209
603 Ga0373934_0015596
604 Ga0373940_0000515
605 Ga0373923_0003834
606 Ga0373923_0025195
607 Ga0373936_0005952
608 Ga0373941_0006073
609 Ga0373954_0009483
610 Ga0373954_0013179
611 Ga0373956_0003161
612 Ga0373956_0008535
613 Ga0373957_0000422
614 Ga0373955_0032614
615 Ga0373942_0001710
616 Ga0373961_0001168
617 Ga0373935_0006118
618 Ga0373935_0109933
619 Ga0373927_0003429
620 Ga0373927_0015566
621 Ga0373947_0010969
622 Ga0373937_0030281
623 Ga0373925_0000017
624 Ga0373925_0031659
625 Ga0373925_0048317
626 Ga0436364_0294229
627 Ga0436365_0117976
628 Ga0436365_1191808
629 Ga0436360_0163647
630 Ga0436361_0495466
631 Ga0436362_0691512
632 Ga0439450_000338
633 Ga0439451_007218
634 Ga0439463_000141
635 Ga0439464_0000456
636 Ga0453684_0022283
637 Ga0466960_0005883
638 Ga0451576_0065484
639 Ga0466967_0012275
640 Ga0495592_0024739
641 Ga0495592_0050178
642 Ga0495603_0057376
643 Ga0495629_0001321
644 Ga0495641_0010269
645 Ga0495651_0020165
646 Ga0495651_0073684
647 Ga0495653_0017793
648 Ga0495580_0009935
649 Ga0495582_0010188
650 Ga0495662_0004723
651 Ga0495664_0012264
652 Ga0495664_0016436
653 Ga0495594_0041704
654 Ga0495608_0006164
655 Ga0495608_0006315
656 Ga0495618_0008218
657 Ga0495630_0002765
658 Ga0495630_0051404
659 Ga0495632_0014182
660 Ga0495665_0034349
661 Ga0495640_0011542
662 Ga0495640_0050150
663 Ga0495640_0081801
664 Ga0495586_0022694
665 Ga0495586_0024283
666 Ga0495586_0046513
667 Ga0495587_0015778
668 Ga0495645_0015462
669 Ga0495645_0028132
670 Ga0495667_0011027
671 Ga0495667_0051131
672 Ga0495667_0074774
673 Ga0495656_0014776
674 Ga0495635_0010056
675 Ga0495635_0073934
676 Ga0495657_0025962
677 Ga0495599_0058564
678 Ga0495646_0010773
679 Ga0495647_0027959
680 Ga0495613_0000507
681 Ga0495613_0039507
682 Ga0495624_0012945
683 Ga0495600_0001840
684 Ga0495600_0012872
685 Ga0495581_0004729
686 Ga0495581_0064830
687 Ga0495604_0035386
688 Ga0495674_0001285
689 Ga0495674_0048867
690 Ga0495672_0003529
691 Ga0495676_0055063
692 Ga0495676_0073552
693 Ga0495680_0065402
694 Ga0495680_0084322
695 Ga0495675_0032510
696 Ga0495675_0048412
697 Ga0495684_0000188
698 Ga0495684_0054284
699 Ga0495593_0007308
700 Ga0495602_0051254
701 Ga0496100_0020705
702 Ga0496101_0002362
703 Ga0496104_0012415
704 Ga0496105_0011955
705 Ga0496105_0017419
706 Ga0496106_0096998
707 Ga0496108_0000052
708 Ga0496109_0010954
709 Ga0496109_0081673
710 Ga0496110_0022970
711 Ga0496110_0023300
712 Ga0496112_0052334
713 Ga0496112_0066601
714 Ga0496113_0101224
715 Ga0496114_0011339
716 Ga0496115_0002218
717 Ga0501031_0032125
718 Ga0501036_0001133
719 Ga0501038_0018244
720 Ga0501039_0000576
721 Ga0501041_0000962
722 Ga0501042_0001615
723 Ga0501042_0012039
724 Ga0501043_0049476
725 Ga0501046_0005787
726 Ga0501047_0021197
727 Ga0501048_0006356
728 Ga0501067_0001947
729 Ga0501068_0020944
730 Ga0501069_0015007
731 Ga0501071_0037610
732 Ga0501074_0009716
733 Ga0501075_0000276
734 Ga0501075_0000937
735 Ga0501075_0021553
736 Ga0501076_0000514
737 Ga0501076_0002383
738 Ga0501077_0000261
739 Ga0501077_0002045
740 Ga0501079_0003545
741 Ga0501080_0101021
742 Ga0501081_0001434
743 Ga0501083_0023589
744 Ga0501035_0106049
745 Ga0501045_0000956
746 Ga0501045_0077084
747 nmdc:mga05p37_13269_c1
748 nmdc:mga05p37_135550_c1
749 nmdc:mga05p37_19907_c1
750 nmdc:mga05p37_24186_c1
751 nmdc:mga05p37_36704_c1
752 nmdc:mga09592_25711_c1
753 nmdc:mga09592_5023_c1
754 nmdc:mga09592_79292_c1
755 nmdc:mga0qj67_3038_c1
756 nmdc:mga0qj67_48901_c1
757 nmdc:mga0qj67_5362_c1
758 nmdc:mga0qj67_75_c1
759 nmdc:mga06r32_106078_c1
760 nmdc:mga06r32_15363_c1
761 nmdc:mga06r32_46968_c1
762 nmdc:mga08y16_24128_c1
763 nmdc:mga08y16_37432_c1
764 nmdc:mga0n895_211543_c1
765 nmdc:mga0n895_25871_c1
766 nmdc:mga0n895_33284_c1
767 nmdc:mga0rr50_6064_c1
768 nmdc:mga08x19_25123_c1
769 nmdc:mga0a205_648_c2
770 Ga0495601_0003259
771 Ga0495601_0004953
772 Ga0495601_0017982
773 Ga0495612_0028587
774 Ga0495619_0009932
775 Ga0495619_0102787
776 Ga0500646_0000046
777 Ga0500566_0000517
778 Ga0500555_000650
779 Ga0500616_0000202
780 Ga0501084_0027013
781 Ga0501084_0055254
782 Ga0501084_0083718
783 Ga0590074_002708
784 Ga0501082_0000362
785 Ga0501082_0004074
786 Ga0530510_0004094

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

418

576

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fgk-assembly2.cif.gz_B crystal structure of the abc-cassette e631q mutant of hlyb with bound atp 0.91 347 582
4k8o-assembly1.cif.gz_A-2 crystal structure of the atpase domain of tap1 with atp (d645n, d651a mutant) 0.9092 337 580
3vx4-assembly1.cif.gz_A crystal structure of the nucleotide-binding domain of s. mutans coma, a bifunctional atp-binding cassette transporter involved in the quorum-sensing pathway 0.9074 342 579
2ixf-assembly2.cif.gz_C crystal structure of the atpase domain of tap1 with atp (d645q, q678h mutant) 0.9049 337 581
2ixe-assembly1.cif.gz_A crystal structure of the atpase domain of tap1 with atp (d645n mutant) 0.9006 337 580
ID Description Score Start End Superfamily
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9561 346 412 3.40.50.300
af_Q4CNU9_4_214_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9293 371 573 3.40.50.300
af_P23886_333_572_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9188 347 580 3.40.50.300
af_Q4E5B8_1237_1471_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9186 340 572 3.40.50.300
4k8oA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.913 346 578 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0C9T2B2-F1-model_v4 ABC transporter domain-containing protein 0.922 333 583 GO:0005524
GO:0016020
GO:0016887
GO:0042626
AF-A0A2V9WEH3-F1-model_v4 ABC transporter ATP-binding protein 0.9205 346 578 GO:0005524
GO:0016887
GO:0034040
AF-A0A6P7HDW7-F1-model_v4 Multidrug resistance protein 1B-like 0.9157 345 581 GO:0005524
GO:0016020
GO:0016887
GO:0042626
AF-A0A178U897-F1-model_v4 ABC-type xenobiotic transporter (EC 7.6.2.2) 0.912 335 570 GO:0005524
GO:0016887
AF-M5C5N4-F1-model_v4 ATP-binding cassette, subfamily B (MDR/TAP),member 1 (EC 3.6.1.3) 0.9069 333 580 GO:0005524
GO:0016020
GO:0016887
GO:0042626

Map