F432369

General Info

Members Datasets Scaffolds Average Seq Length
392 292 392 168

Family's Representative Sequence

Representative Sequence 3300041407|Ga0439447_084325|Ga0439447_084325_46_663
Length 205
Sequence LLHRRATEGKAARRARQECLFVLLTARIAPNPIPPTPTIPPMTDPIHHVLFICTGNSARSIIAEGLTNHLGRSRFKAFSAGSQPKGAVHPLAAATLRTLHVPDADYRSKSWDEFAKDGAPKMDFVITVCDQAAGEVCPFWPGQPVTAHWGLPDPAAVEGSDEEKKRAFMDAAVTLKRRIEFMLSLPLDKLEHMAIQHEVREIGKR

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
3 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
4 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
146 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
149 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
166 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
167 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
168 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
169 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
170 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
175 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
176 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
177 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
178 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
179 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
180 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
206 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
250 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
273 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
274 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
275 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
276 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
277 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
278 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
279 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
280 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
281 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
282 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
283 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
284 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
285 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
286 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
287 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
288 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
289 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.97
Nodule 0
Rhizoplane 6.12
Rhizosphere 78.57
Stem 0
Stem Tuber 0
Unclassified 4.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1000001 3300003354 Bacteria 782301
2 JGI25161J50226_1000001 3300003374 Bacteria 655036
3 Ga0055539_1000002 3300003752 Bacteria 999437
4 Ga0055533_1000004 3300003756 Bacteria 999437
5 Ga0055525_1000002 3300003759 Bacteria 999437
6 Ga0055541_1000002 3300003841 Bacteria 896405
7 Ga0055543_1000089 3300004625 Bacteria 79924
8 Ga0065165_1000008 3300005262 Bacteria 334429
9 Ga0065712_10150090 3300005290 Bacteria 1377
10 Ga0070666_10004034 3300005335 Bacteria 8911
11 Ga0070666_10177151 3300005335 Bacteria 1495
12 Ga0070680_100014468 3300005336 Bacteria 6171
13 Ga0068868_100261786 3300005338 Bacteria 1459
14 Ga0070668_100004268 3300005347 Bacteria 10602
15 Ga0070669_100003992 3300005353 Bacteria 10670
16 Ga0070669_100011862 3300005353 Bacteria 6182
17 Ga0070671_100000037 3300005355 Bacteria 95248
18 Ga0070671_100000437 3300005355 Bacteria 28930
19 Ga0070667_100000057 3300005367 Bacteria 150501
20 Ga0070709_10001233 3300005434 Bacteria 14031
21 Ga0070700_100290134 3300005441 Bacteria 1190
22 Ga0070678_100084344 3300005456 Bacteria 2418
23 Ga0070678_100102208 3300005456 Bacteria 2224
24 Ga0070681_10001191 3300005458 Bacteria 22543
25 Ga0070699_100346854 3300005518 Bacteria 1337
26 Ga0070679_100015079 3300005530 Bacteria 7426
27 Ga0070684_100278969 3300005535 Bacteria 1531
28 Ga0070695_100000689 3300005545 Bacteria 18054
29 Ga0068855_100000526 3300005563 Bacteria 46919
30 Ga0068855_100600808 3300005563 Bacteria 1186
31 Ga0070664_101094918 3300005564 Bacteria 750
32 Ga0068857_100018242 3300005577 Bacteria 6155
33 Ga0068856_100982874 3300005614 Bacteria 862
34 Ga0068859_100685880 3300005617 Bacteria 1115
35 Ga0068864_100106534 3300005618 Bacteria 2493
36 Ga0068866_10224401 3300005718 Bacteria 1135
37 Ga0068861_100038327 3300005719 Bacteria 3568
38 Ga0068863_100023089 3300005841 Bacteria 5944
39 Ga0068863_100450084 3300005841 Bacteria 1264
40 Ga0068863_101129855 3300005841 Bacteria 788
41 Ga0068858_100427813 3300005842 Bacteria 1274
42 Ga0068860_100324883 3300005843 Bacteria 1510
43 Ga0081455_10044582 3300005937 Bacteria 3867
44 Ga0081539_10003022 3300005985 Bacteria 21833
45 Ga0075368_10231315 3300006042 Bacteria 787
46 Ga0075364_10092149 3300006051 Bacteria 2011
47 Ga0075364_10519093 3300006051 Unclassified 814
48 Ga0070715_10159991 3300006163 Bacteria 1112
49 Ga0070712_100109025 3300006175 Bacteria 2062
50 Ga0075367_10017944 3300006178 Bacteria 3895
51 Ga0097621_100136771 3300006237 Bacteria 2090
52 Ga0075370_10093786 3300006353 Bacteria 1733
53 Ga0068871_100100566 3300006358 Bacteria 2422
54 Ga0075428_100007165 3300006844 Bacteria 12352
55 Ga0075431_100059658 3300006847 Bacteria 3937
56 Ga0075433_10000505 3300006852 Bacteria 25439
57 Ga0075433_10332237 3300006852 Bacteria 1344
58 Ga0075434_100651971 3300006871 Bacteria 1071
59 Ga0075434_102015592 3300006871 Bacteria 582
60 Ga0075429_100007786 3300006880 Bacteria 9304
61 Ga0075436_100000120 3300006914 Bacteria 46291
62 Ga0097620_100685881 3300006931 Bacteria 1115
63 Ga0075435_100001032 3300007076 Bacteria 17630
64 Ga0099795_10014494 3300007788 Bacteria 2446
65 Ga0105250_10253280 3300009092 Bacteria 753
66 Ga0105240_10042856 3300009093 Bacteria 5765
67 Ga0105240_10182374 3300009093 Bacteria 2476
68 Ga0111539_10046319 3300009094 Bacteria 5201
69 Ga0111539_10053101 3300009094 Bacteria 4824
70 Ga0105245_10035809 3300009098 Bacteria 4406
71 Ga0105247_10019748 3300009101 Bacteria 4047
72 Ga0105247_10020849 3300009101 Bacteria 3942
73 Ga0114129_10002111 3300009147 Bacteria 27375
74 Ga0105243_11281947 3300009148 Bacteria 749
75 Ga0105242_10237925 3300009176 Bacteria 1635
76 Ga0105248_10006661 3300009177 Bacteria 12674
77 Ga0105248_10420349 3300009177 Bacteria 1505
78 Ga0105237_10073222 3300009545 Bacteria 3418
79 Ga0105249_11042218 3300009553 Bacteria 887
80 Ga0099796_10011258 3300010159 Bacteria 2490
81 Ga0105239_11749690 3300010375 Bacteria 720
82 Ga0157370_10003754 3300013104 Bacteria 17740
83 Ga0157369_10399580 3300013105 Bacteria 1426
84 Ga0157374_10219621 3300013296 Bacteria 1865
85 Ga0157378_10749119 3300013297 Bacteria 1000
86 Ga0157378_10851835 3300013297 Bacteria 940
87 Ga0157372_10372972 3300013307 Bacteria 1663
88 Ga0157375_10026679 3300013308 Bacteria 5389
89 Ga0157375_10361543 3300013308 Bacteria 1618
90 Ga0157375_10663750 3300013308 Bacteria 1198
91 Ga0163163_10076620 3300014325 Bacteria 3339
92 Ga0163163_10593047 3300014325 Bacteria 1171
93 Ga0157380_10108173 3300014326 Bacteria 2330
94 Ga0182008_10000248 3300014497 Bacteria 41927
95 Ga0157379_10064129 3300014968 Bacteria 3284
96 Ga0157379_10217988 3300014968 Bacteria 1729
97 Ga0157379_10975523 3300014968 Bacteria 807
98 Ga0157376_10003054 3300014969 Bacteria 11467
99 Ga0209784_100002 3300025224 Bacteria 1753105
100 Ga0209566_100003 3300025225 Bacteria 1753105
101 Ga0209674_100004 3300025226 Bacteria 1753105
102 Ga0209563_100006 3300025230 Bacteria 1753105
103 Ga0207425_1012080 3300025245 Bacteria 2037
104 Ga0209677_100003 3300025253 Bacteria 1753105
105 Ga0209130_1000003 3300025284 Bacteria 677988
106 Ga0207426_1000011 3300025302 Bacteria 791203
107 Ga0207692_10070712 3300025898 Bacteria 1838
108 Ga0207642_10010092 3300025899 Bacteria 3312
109 Ga0207680_10082905 3300025903 Bacteria 2019
110 Ga0207699_10004288 3300025906 Bacteria 6819
111 Ga0207707_10026137 3300025912 Bacteria 5105
112 Ga0207695_10002462 3300025913 Bacteria 27332
113 Ga0207693_10012690 3300025915 Bacteria 6804
114 Ga0207660_10018785 3300025917 Bacteria 4614
115 Ga0207657_10580324 3300025919 Bacteria 876
116 Ga0207649_10177926 3300025920 Bacteria 1487
117 Ga0207652_10026687 3300025921 Bacteria 4813
118 Ga0207681_10002747 3300025923 Bacteria 11142
119 Ga0207681_10028355 3300025923 Bacteria 3626
120 Ga0207650_10033443 3300025925 Bacteria 3724
121 Ga0207687_10073566 3300025927 Bacteria 2447
122 Ga0207700_10098836 3300025928 Bacteria 2322
123 Ga0207644_10000114 3300025931 Bacteria 59996
124 Ga0207644_10000278 3300025931 Bacteria 33992
125 Ga0207644_10128104 3300025931 Bacteria 1940
126 Ga0207706_10147784 3300025933 Bacteria 2067
127 Ga0207711_10019418 3300025941 Bacteria 5660
128 Ga0207711_10363351 3300025941 Bacteria 1341
129 Ga0207689_10073712 3300025942 Bacteria 2805
130 Ga0207689_10282570 3300025942 Bacteria 1374
131 Ga0207661_11052855 3300025944 Bacteria 749
132 Ga0207679_10274186 3300025945 Bacteria 1444
133 Ga0207667_10000073 3300025949 Bacteria 174391
134 Ga0207667_10000076 3300025949 Bacteria 166704
135 Ga0207667_10000147 3300025949 Bacteria 106918
136 Ga0207667_10021262 3300025949 Bacteria 7192
137 Ga0207667_10126687 3300025949 Bacteria 2630
138 Ga0207667_10400913 3300025949 Bacteria 1397
139 Ga0207651_10069434 3300025960 Bacteria 2488
140 Ga0207651_10221821 3300025960 Bacteria 1529
141 Ga0207712_10887306 3300025961 Bacteria 787
142 Ga0207668_10001103 3300025972 Bacteria 16076
143 Ga0207668_10128276 3300025972 Bacteria 1933
144 Ga0207677_11041700 3300026023 Bacteria 744
145 Ga0207639_10698592 3300026041 Bacteria 941
146 Ga0207678_10301281 3300026067 Bacteria 1378
147 Ga0207708_10179045 3300026075 Bacteria 1683
148 Ga0207702_10382649 3300026078 Bacteria 1353
149 Ga0207702_10685411 3300026078 Bacteria 1009
150 Ga0207641_10012570 3300026088 Bacteria 6939
151 Ga0207641_10060416 3300026088 Bacteria 3231
152 Ga0207676_10046058 3300026095 Bacteria 3373
153 Ga0207676_10589236 3300026095 Bacteria 1067
154 Ga0207674_10047798 3300026116 Bacteria 4384
155 Ga0207675_100026994 3300026118 Bacteria 5346
156 Ga0207675_100446400 3300026118 Bacteria 1281
157 Ga0207683_10086425 3300026121 Bacteria 2788
158 Ga0207683_10129297 3300026121 Bacteria 2271
159 Ga0209813_10069603 3300027866 Bacteria 1141
160 Ga0207428_10001380 3300027907 Bacteria 25677
161 Ga0268266_10193567 3300028379 Bacteria 1858
162 Ga0268265_10060824 3300028380 Bacteria 2896
163 Ga0268264_10711240 3300028381 Bacteria 998
164 Ga0268264_10910639 3300028381 Bacteria 883
165 Ga0307517_10475588 3300028786 Bacteria 641
166 Ga0307515_10000006 3300028794 Bacteria 725810
167 Ga0307515_10330874 3300028794 Bacteria 1182
168 Ga0307515_10333199 3300028794 Bacteria 1175
169 Ga0265338_10077668 3300028800 Bacteria 2806
170 Ga0265338_11009479 3300028800 Bacteria 563
171 Ga0265325_10136438 3300031241 Bacteria 1170
172 Ga0265340_10122264 3300031247 Bacteria 1197
173 Ga0265340_10274380 3300031247 Bacteria 749
174 Ga0265339_10092685 3300031249 Bacteria 1581
175 Ga0265331_10004066 3300031250 Bacteria 9201
176 Ga0265327_10026495 3300031251 Bacteria 3355
177 Ga0307513_10054767 3300031456 Bacteria 4274
178 Ga0307509_10718487 3300031507 Bacteria 665
179 Ga0307408_100232871 3300031548 Bacteria 1509
180 Ga0265313_10000361 3300031595 Bacteria 49331
181 Ga0307508_10188020 3300031616 Bacteria 1667
182 Ga0265314_10305812 3300031711 Bacteria 890
183 Ga0307405_10311831 3300031731 Bacteria 1198
184 Ga0307405_10526461 3300031731 Bacteria 952
185 Ga0307405_10948430 3300031731 Bacteria 731
186 Ga0307410_10854589 3300031852 Bacteria 777
187 Ga0307406_10673211 3300031901 Bacteria 861
188 Ga0307412_10832829 3300031911 Bacteria 803
189 Ga0373948_0017044 3300034817 Bacteria 1350
190 Ga0373938_0009546 3300034957 Bacteria 1761
191 Ga0373926_0026410 3300035083 Bacteria 2031
192 Ga0373940_0014812 3300035088 Bacteria 1908
193 Ga0373944_0030692 3300035089 Bacteria 1613
194 Ga0373936_0422539 3300035113 Bacteria 614
195 Ga0373939_0001939 3300035114 Bacteria 4949
196 Ga0373941_0004123 3300035115 Bacteria 3335
197 Ga0373954_0001843 3300035118 Bacteria 8750
198 Ga0373956_0026287 3300035119 Bacteria 2520
199 Ga0373960_0066717 3300035121 Bacteria 1103
200 Ga0373946_0279286 3300035171 Bacteria 821
201 Ga0373955_0000397 3300035172 Bacteria 18441
202 Ga0316574_0153715 3300035398 Bacteria 1483
203 Ga0373931_0000352 3300035691 Bacteria 18923
204 Ga0373935_0213293 3300035692 Bacteria 1339
205 Ga0373935_0299992 3300035692 Bacteria 1135
206 Ga0373933_0079566 3300035724 Bacteria 2007
207 Ga0373937_0003633 3300036401 Bacteria 13011
208 Ga0373937_0938567 3300036401 Bacteria 814
209 Ga0373925_0006800 3300037068 Bacteria 8379
210 Ga0373925_0123825 3300037068 Bacteria 2009
211 Ga0395905_0028160 3300037471 Bacteria 5296
212 Ga0400490_56350 3300038726 Bacteria 5054
213 Ga0400483_070253 3300039062 Bacteria 8171
214 Ga0439439_0002925 3300041406 Bacteria 3711
215 Ga0439447_067328 3300041407 Bacteria 836
216 Ga0439447_084325 3300041407 Bacteria 732
217 Ga0439466_0067379 3300041411 Bacteria 1145
218 Ga0451789_0024300 3300041443 Bacteria 1316
219 Ga0451807_0276400 3300041486 Bacteria 825
220 Ga0451807_1172539 3300041486 Bacteria 847
221 Ga0451849_0841318 3300041505 Bacteria 773
222 Ga0451853_1236297 3300041512 Bacteria 939
223 Ga0439442_056661 3300042002 Bacteria 829
224 Ga0439449_0001784 3300042007 Bacteria 8469
225 Ga0439462_0020995 3300042015 Bacteria 1705
226 Ga0450911_000086 3300042115 Bacteria 37180
227 Ga0450897_008164 3300042128 Bacteria 968
228 Ga0450898_001488 3300042134 Bacteria 3099
229 Ga0450906_052530 3300042145 Bacteria 721
230 Ga0439434_0016624 3300042435 Bacteria 2199
231 Ga0439464_0075993 3300042439 Bacteria 998
232 Ga0451577_0001619 3300042876 Bacteria 29289
233 Ga0451577_0173759 3300042876 Bacteria 1941
234 Ga0451577_0343930 3300042876 Bacteria 1353
235 Ga0466966_0005135 3300044684 Bacteria 8601
236 Ga0453684_0238957 3300044712 Bacteria 2092
237 Ga0451576_0015604 3300045051 Bacteria 8410
238 Ga0495627_204332 3300046453 Bacteria 544
239 Ga0495592_0081828 3300046454 Bacteria 2334
240 Ga0495592_0378402 3300046454 Bacteria 901
241 Ga0495651_0071701 3300046462 Bacteria 2633
242 Ga0495653_0182072 3300046463 Bacteria 1441
243 Ga0495580_0061746 3300046472 Bacteria 2630
244 Ga0495580_0428043 3300046472 Bacteria 890
245 Ga0495648_0003031 3300046524 Bacteria 15038
246 Ga0495648_0099290 3300046524 Bacteria 1611
247 Ga0495587_0022597 3300046536 Bacteria 3872
248 Ga0495667_0018847 3300046559 Bacteria 4660
249 Ga0495634_0509543 3300046642 Bacteria 705
250 Ga0495635_0283228 3300046663 Bacteria 1113
251 Ga0495659_0274428 3300046664 Bacteria 707
252 Ga0495657_0007421 3300046675 Bacteria 8472
253 Ga0495600_0099423 3300046809 Bacteria 1896
254 Ga0495604_0115169 3300047317 Bacteria 1954
255 Ga0495604_0194584 3300047317 Bacteria 1411
256 Ga0495672_0093856 3300047320 Bacteria 1642
257 Ga0495676_0297572 3300047321 Bacteria 1089
258 Ga0495680_0304614 3300047322 Bacteria 1118
259 Ga0495683_0031312 3300047323 Bacteria 2711
260 Ga0495687_033784 3300047443 Bacteria 2316
261 Ga0495673_0032523 3300047469 Bacteria 2430
262 Ga0495684_0366647 3300047471 Bacteria 1019
263 Ga0495602_0010148 3300048088 Bacteria 9778
264 Ga0495602_0231969 3300048088 Bacteria 1386
265 Ga0496100_0068233 3300048903 Bacteria 2364
266 Ga0496100_0432750 3300048903 Unclassified 1006
267 Ga0496101_0597833 3300048904 Bacteria 872
268 Ga0496101_0685722 3300048904 Bacteria 809
269 Ga0496103_0175992 3300048906 Bacteria 1375
270 Ga0496104_0085608 3300048907 Bacteria 3008
271 Ga0496104_0166052 3300048907 Bacteria 2117
272 Ga0496107_0079803 3300048910 Bacteria 2386
273 Ga0496107_0565521 3300048910 Unclassified 842
274 Ga0496107_1113992 3300048910 Bacteria 570
275 Ga0496108_0141867 3300048911 Bacteria 2070
276 Ga0496109_0218394 3300048912 Bacteria 1793
277 Ga0496110_0106734 3300048913 Bacteria 2513
278 Ga0496110_0167836 3300048913 Bacteria 1991
279 Ga0496112_0149547 3300048915 Bacteria 2303
280 Ga0496112_0592506 3300048915 Bacteria 1041
281 Ga0496114_0207081 3300048917 Bacteria 1719
282 Ga0496114_0520939 3300048917 Bacteria 1051
283 Ga0496115_0015857 3300048918 Bacteria 5724
284 Ga0496115_0056287 3300048918 Bacteria 3160
285 Ga0496115_0159105 3300048918 Bacteria 1866
286 Ga0496118_0013550 3300048921 Bacteria 7699
287 Ga0496119_0218600 3300048922 Bacteria 976
288 Ga0496124_0067315 3300048927 Bacteria 2981
289 Ga0496125_0096087 3300048928 Bacteria 2201
290 Ga0496125_0284192 3300048928 Bacteria 1023
291 Ga0496126_0281025 3300048929 Bacteria 1379
292 Ga0495682_0024844 3300049460 Bacteria 2231
293 Ga0495682_0243644 3300049460 Bacteria 636
294 Ga0501031_0000028 3300049568 Bacteria 82323
295 Ga0501031_0015553 3300049568 Bacteria 4939
296 Ga0501032_0000448 3300049569 Bacteria 33621
297 Ga0501032_0031482 3300049569 Bacteria 3636
298 Ga0501033_0004114 3300049570 Bacteria 11730
299 Ga0501034_0000215 3300049571 Bacteria 110067
300 Ga0501034_0009598 3300049571 Bacteria 10124
301 Ga0501036_0000044 3300049572 Bacteria 78673
302 Ga0501037_0000192 3300049573 Bacteria 56437
303 Ga0501037_0001190 3300049573 Bacteria 19229
304 Ga0501038_0000071 3300049574 Bacteria 83962
305 Ga0501038_0000171 3300049574 Bacteria 55320
306 Ga0501038_0036050 3300049574 Bacteria 4341
307 Ga0501039_0000363 3300049575 Bacteria 32442
308 Ga0501039_0002922 3300049575 Bacteria 12789
309 Ga0501040_0013194 3300049576 Bacteria 5434
310 Ga0501041_0037672 3300049577 Bacteria 2931
311 Ga0501043_0000134 3300049579 Bacteria 68845
312 Ga0501043_0001158 3300049579 Bacteria 23194
313 Ga0501043_0027139 3300049579 Bacteria 4495
314 Ga0501043_0027881 3300049579 Bacteria 4433
315 Ga0501043_0838811 3300049579 Bacteria 663
316 Ga0501046_0135971 3300049580 Bacteria 1862
317 Ga0501046_0245111 3300049580 Bacteria 1321
318 Ga0501047_0003412 3300049581 Bacteria 15040
319 Ga0501047_0007851 3300049581 Bacteria 10054
320 Ga0501048_0430428 3300049582 Bacteria 944
321 Ga0501068_0002048 3300049584 Bacteria 10758
322 Ga0501069_0102702 3300049585 Bacteria 1624
323 Ga0501069_0368661 3300049585 Bacteria 848
324 Ga0501070_0044959 3300049586 Bacteria 3673
325 Ga0501071_0022436 3300049587 Bacteria 4401
326 Ga0501073_0008419 3300049589 Bacteria 7650
327 Ga0501074_0044833 3300049590 Bacteria 3200
328 Ga0501074_0107735 3300049590 Bacteria 1995
329 Ga0501075_0077918 3300049591 Bacteria 2508
330 Ga0501076_0327795 3300049592 Bacteria 1256
331 Ga0501077_0200055 3300049593 Bacteria 1269
332 Ga0501249_000753 3300049679 Bacteria 7282
333 Ga0501225_0001323 3300049705 Bacteria 7697
334 Ga0501079_0081220 3300049741 Bacteria 2506
335 Ga0501079_0083002 3300049741 Bacteria 2479
336 Ga0501080_0012220 3300049742 Bacteria 7869
337 Ga0501080_0022602 3300049742 Bacteria 5826
338 Ga0501080_0136595 3300049742 Bacteria 2269
339 Ga0501080_0345544 3300049742 Bacteria 1344
340 Ga0501081_0055213 3300049743 Bacteria 2744
341 Ga0501081_0142018 3300049743 Bacteria 1721
342 Ga0501083_0230642 3300049744 Bacteria 1206
343 Ga0501035_0000186 3300049822 Bacteria 75905
344 Ga0501044_0000068 3300049823 Bacteria 126642
345 Ga0501044_0000194 3300049823 Bacteria 76727
346 Ga0501044_0049206 3300049823 Bacteria 4352
347 Ga0501045_0091958 3300049824 Bacteria 2243
348 nmdc:mga00v17_13949_c1 3300050491 Bacteria 4473
349 nmdc:mga06z11_56900_c1 3300050494 Bacteria 2024
350 nmdc:mga06z11_62928_c1 3300050494 Bacteria 1940
351 nmdc:mga05p37_623_c1 3300050507 Bacteria 39191
352 nmdc:mga05p37_7214_c1 3300050507 Bacteria 13113
353 nmdc:mga09592_2087_c1 3300050508 Bacteria 16121
354 nmdc:mga06r32_215562_c1 3300050510 Bacteria 1907
355 nmdc:mga06r32_56517_c1 3300050510 Bacteria 3767
356 nmdc:mga08y16_1215668_c1 3300050511 Unclassified 724
357 nmdc:mga08y16_13891_c1 3300050511 Bacteria 8473
358 nmdc:mga08y16_27142_c1 3300050511 Bacteria 6034
359 nmdc:mga0n895_1141_c1 3300050512 Bacteria 19437
360 nmdc:mga0n895_1987817_c1 3300050512 Bacteria 539
361 nmdc:mga0rr50_718_c1 3300050513 Bacteria 17843
362 nmdc:mga08x19_84_c1 3300050514 Bacteria 83898
363 nmdc:mga0a205_3213_c1 3300050515 Bacteria 14525
364 nmdc:mga0a205_497719_c1 3300050515 Bacteria 1076
365 Ga0495601_0021788 3300053077 Bacteria 3927
366 Ga0495612_0096262 3300053078 Bacteria 1257
367 Ga0495612_0200121 3300053078 Bacteria 881
368 Ga0495595_0001665 3300053084 Bacteria 8694
369 Ga0495619_0049386 3300053085 Bacteria 2774
370 Ga0500646_0010840 3300053090 Bacteria 2340
371 Ga0500583_0257446 3300053092 Bacteria 861
372 Ga0500651_0000389 3300053093 Bacteria 23997
373 Ga0500566_0000806 3300053094 Bacteria 17838
374 Ga0500640_019681 3300053095 Bacteria 2892
375 Ga0500572_000300 3300053111 Bacteria 17529
376 Ga0500595_071370 3300053119 Bacteria 1030
377 Ga0500608_005951 3300053122 Bacteria 4910
378 Ga0500559_0015867 3300053136 Bacteria 3180
379 Ga0500568_0303654 3300053139 Bacteria 579
380 Ga0500600_0279443 3300053149 Bacteria 729
381 Ga0500603_000147 3300053150 Bacteria 17079
382 Ga0500622_0000227 3300053156 Bacteria 58653
383 Ga0500630_036118 3300053159 Bacteria 2419
384 Ga0500634_0008772 3300053161 Bacteria 5072
385 Ga0500639_000430 3300053163 Bacteria 20905
386 Ga0500596_002406 3300053735 Bacteria 3690
387 Ga0500601_005965 3300053737 Bacteria 1342
388 Ga0501084_0078250 3300054114 Bacteria 2772
389 Ga0501082_0389772 3300060353 Bacteria 1215
390 Ga0501082_0719080 3300060353 Bacteria 874
391 Ga0530510_0103254 3300061734 Bacteria 2085
392 Ga0530510_0606662 3300061734 Bacteria 832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014969 Ga0157376_10003054 Ga0157376_100030546 161
2 3300048903 Ga0496100_0432750 Ga0496100_0432750_338_892 161
3 3300048910 Ga0496107_0565521 Ga0496107_0565521_110_664 161
4 3300048918 Ga0496115_0015857 Ga0496115_0015857_3672_4226 161
5 3300005355 Ga0070671_100000037 Ga0070671_10000003763 162
6 3300005564 Ga0070664_101094918 Ga0070664_1010949181 162
7 3300005719 Ga0068861_100038327 Ga0068861_1000383273 162
8 3300006042 Ga0075368_10231315 Ga0075368_102313151 162
9 3300006051 Ga0075364_10092149 Ga0075364_100921491 162
10 3300006178 Ga0075367_10017944 Ga0075367_100179444 162
11 3300006353 Ga0075370_10093786 Ga0075370_100937863 162
12 3300025931 Ga0207644_10000114 Ga0207644_1000011433 162
13 3300025942 Ga0207689_10282570 Ga0207689_102825702 162
14 3300026041 Ga0207639_10698592 Ga0207639_106985922 162
15 3300026118 Ga0207675_100026994 Ga0207675_1000269946 162
16 3300027866 Ga0209813_10069603 Ga0209813_100696032 162
17 3300050491 nmdc:mga00v17_13949_c1 nmdc:mga00v17_13949_c1_889_1383 162
18 3300050494 nmdc:mga06z11_56900_c1 nmdc:mga06z11_56900_c1_130_624 162
19 3300050494 nmdc:mga06z11_62928_c1 nmdc:mga06z11_62928_c1_929_1423 162
20 3300005577 Ga0068857_100018242 Ga0068857_1000182424 163
21 3300025945 Ga0207679_10274186 Ga0207679_102741862 163
22 3300026116 Ga0207674_10047798 Ga0207674_100477984 163
23 3300049579 Ga0501043_0027881 Ga0501043_0027881_482_982 163
24 3300049586 Ga0501070_0044959 Ga0501070_0044959_3124_3624 163
25 3300049742 Ga0501080_0345544 Ga0501080_0345544_425_925 163
26 3300005338 Ga0068868_100261786 Ga0068868_1002617862 164
27 3300005355 Ga0070671_100000437 Ga0070671_1000004375 164
28 3300005456 Ga0070678_100084344 Ga0070678_1000843442 164
29 3300005618 Ga0068864_100106534 Ga0068864_1001065344 164
30 3300005841 Ga0068863_100023089 Ga0068863_1000230894 164
31 3300005841 Ga0068863_101129855 Ga0068863_1011298552 164
32 3300006358 Ga0068871_100100566 Ga0068871_1001005665 164
33 3300006844 Ga0075428_100007165 Ga0075428_1000071658 164
34 3300006852 Ga0075433_10332237 Ga0075433_103322372 164
35 3300006871 Ga0075434_100651971 Ga0075434_1006519712 164
36 3300006880 Ga0075429_100007786 Ga0075429_1000077867 164
37 3300009094 Ga0111539_10046319 Ga0111539_100463196 164
38 3300009177 Ga0105248_10006661 Ga0105248_100066614 164
39 3300013296 Ga0157374_10219621 Ga0157374_102196213 164
40 3300013297 Ga0157378_10749119 Ga0157378_107491191 164
41 3300013308 Ga0157375_10361543 Ga0157375_103615432 164
42 3300014968 Ga0157379_10975523 Ga0157379_109755231 164
43 3300025925 Ga0207650_10033443 Ga0207650_100334432 164
44 3300025931 Ga0207644_10000278 Ga0207644_1000027819 164
45 3300025941 Ga0207711_10019418 Ga0207711_100194184 164
46 3300025960 Ga0207651_10069434 Ga0207651_100694344 164
47 3300026023 Ga0207677_11041700 Ga0207677_110417002 164
48 3300026088 Ga0207641_10012570 Ga0207641_100125704 164
49 3300026095 Ga0207676_10046058 Ga0207676_100460586 164
50 3300026121 Ga0207683_10086425 Ga0207683_100864255 164
51 3300027907 Ga0207428_10001380 Ga0207428_1000138020 164
52 3300028786 Ga0307517_10475588 Ga0307517_104755881 164
53 3300028794 Ga0307515_10000006 Ga0307515_1000000664 164
54 3300031247 Ga0265340_10274380 Ga0265340_102743802 164
55 3300031456 Ga0307513_10054767 Ga0307513_100547674 164
56 3300031507 Ga0307509_10718487 Ga0307509_107184871 164
57 3300031711 Ga0265314_10305812 Ga0265314_103058122 164
58 3300031731 Ga0307405_10311831 Ga0307405_103118312 164
59 3300031731 Ga0307405_10526461 Ga0307405_105264612 164
60 3300031911 Ga0307412_10832829 Ga0307412_108328292 164
61 3300034817 Ga0373948_0017044 Ga0373948_0017044_306_800 164
62 3300034957 Ga0373938_0009546 Ga0373938_0009546_949_1443 164
63 3300035088 Ga0373940_0014812 Ga0373940_0014812_1214_1708 164
64 3300035089 Ga0373944_0030692 Ga0373944_0030692_821_1315 164
65 3300035113 Ga0373936_0422539 Ga0373936_0422539_16_510 164
66 3300035114 Ga0373939_0001939 Ga0373939_0001939_1540_2034 164
67 3300035115 Ga0373941_0004123 Ga0373941_0004123_1030_1524 164
68 3300035121 Ga0373960_0066717 Ga0373960_0066717_569_1063 164
69 3300035171 Ga0373946_0279286 Ga0373946_0279286_149_643 164
70 3300035691 Ga0373931_0000352 Ga0373931_0000352_3095_3589 164
71 3300037068 Ga0373925_0006800 Ga0373925_0006800_3769_4263 164
72 3300041407 Ga0439447_067328 Ga0439447_067328_15_509 164
73 3300041407 Ga0439447_084325 Ga0439447_084325_46_663 164
74 3300041411 Ga0439466_0067379 Ga0439466_0067379_503_997 164
75 3300041486 Ga0451807_0276400 Ga0451807_0276400_82_576 164
76 3300041486 Ga0451807_1172539 Ga0451807_1172539_36_530 164
77 3300041512 Ga0451853_1236297 Ga0451853_1236297_385_879 164
78 3300042015 Ga0439462_0020995 Ga0439462_0020995_599_1093 164
79 3300042145 Ga0450906_052530 Ga0450906_052530_65_559 164
80 3300042435 Ga0439434_0016624 Ga0439434_0016624_1065_1559 164
81 3300042439 Ga0439464_0075993 Ga0439464_0075993_340_834 164
82 3300045051 Ga0451576_0015604 Ga0451576_0015604_1335_1829 164
83 3300046453 Ga0495627_204332 Ga0495627_204332_14_508 164
84 3300048904 Ga0496101_0685722 Ga0496101_0685722_175_669 164
85 3300048910 Ga0496107_1113992 Ga0496107_1113992_66_560 164
86 3300048913 Ga0496110_0167836 Ga0496110_0167836_918_1412 164
87 3300048915 Ga0496112_0592506 Ga0496112_0592506_476_970 164
88 3300049568 Ga0501031_0015553 Ga0501031_0015553_224_718 164
89 3300049569 Ga0501032_0031482 Ga0501032_0031482_1862_2356 164
90 3300049570 Ga0501033_0004114 Ga0501033_0004114_1651_2145 164
91 3300049571 Ga0501034_0000215 Ga0501034_0000215_52200_52694 164
92 3300049571 Ga0501034_0009598 Ga0501034_0009598_1457_1957 164
93 3300049572 Ga0501036_0000044 Ga0501036_0000044_67941_68435 164
94 3300049573 Ga0501037_0001190 Ga0501037_0001190_10642_11136 164
95 3300049574 Ga0501038_0000071 Ga0501038_0000071_15370_15864 164
96 3300049575 Ga0501039_0002922 Ga0501039_0002922_11016_11510 164
97 3300049576 Ga0501040_0013194 Ga0501040_0013194_2380_2874 164
98 3300049579 Ga0501043_0000134 Ga0501043_0000134_68085_68579 164
99 3300049580 Ga0501046_0245111 Ga0501046_0245111_137_631 164
100 3300049581 Ga0501047_0003412 Ga0501047_0003412_6162_6656 164
101 3300049584 Ga0501068_0002048 Ga0501068_0002048_8883_9377 164
102 3300049585 Ga0501069_0368661 Ga0501069_0368661_177_671 164
103 3300049589 Ga0501073_0008419 Ga0501073_0008419_1108_1602 164
104 3300049590 Ga0501074_0044833 Ga0501074_0044833_2313_2807 164
105 3300049592 Ga0501076_0327795 Ga0501076_0327795_610_1110 164
106 3300049679 Ga0501249_000753 Ga0501249_000753_5870_6364 164
107 3300049705 Ga0501225_0001323 Ga0501225_0001323_5926_6420 164
108 3300049741 Ga0501079_0083002 Ga0501079_0083002_562_1062 164
109 3300049742 Ga0501080_0012220 Ga0501080_0012220_5806_6300 164
110 3300049743 Ga0501081_0142018 Ga0501081_0142018_1094_1594 164
111 3300049823 Ga0501044_0000194 Ga0501044_0000194_8237_8731 164
112 3300049824 Ga0501045_0091958 Ga0501045_0091958_1226_1720 164
113 3300050507 nmdc:mga05p37_623_c1 nmdc:mga05p37_623_c1_36317_36811 164
114 3300050508 nmdc:mga09592_2087_c1 nmdc:mga09592_2087_c1_4122_4616 164
115 3300050510 nmdc:mga06r32_215562_c1 nmdc:mga06r32_215562_c1_1204_1698 164
116 3300050511 nmdc:mga08y16_13891_c1 nmdc:mga08y16_13891_c1_4001_4495 164
117 3300050512 nmdc:mga0n895_1987817_c1 nmdc:mga0n895_1987817_c1_16_513 164
118 3300050515 nmdc:mga0a205_497719_c1 nmdc:mga0a205_497719_c1_281_775 164
119 3300053090 Ga0500646_0010840 Ga0500646_0010840_1360_1854 164
120 3300053092 Ga0500583_0257446 Ga0500583_0257446_108_602 164
121 3300053093 Ga0500651_0000389 Ga0500651_0000389_18289_18783 164
122 3300053149 Ga0500600_0279443 Ga0500600_0279443_181_675 164
123 3300053156 Ga0500622_0000227 Ga0500622_0000227_50387_50920 164
124 3300054114 Ga0501084_0078250 Ga0501084_0078250_134_628 164
125 3300060353 Ga0501082_0719080 Ga0501082_0719080_122_616 164
126 3300061734 Ga0530510_0606662 Ga0530510_0606662_192_692 164
127 3300005290 Ga0065712_10150090 Ga0065712_101500901 165
128 3300005335 Ga0070666_10177151 Ga0070666_101771512 165
129 3300005353 Ga0070669_100003992 Ga0070669_1000039926 165
130 3300005434 Ga0070709_10001233 Ga0070709_100012339 165
131 3300005441 Ga0070700_100290134 Ga0070700_1002901342 165
132 3300005456 Ga0070678_100102208 Ga0070678_1001022084 165
133 3300005518 Ga0070699_100346854 Ga0070699_1003468542 165
134 3300005545 Ga0070695_100000689 Ga0070695_10000068911 165
135 3300005617 Ga0068859_100685880 Ga0068859_1006858802 165
136 3300005718 Ga0068866_10224401 Ga0068866_102244011 165
137 3300005841 Ga0068863_100450084 Ga0068863_1004500842 165
138 3300005842 Ga0068858_100427813 Ga0068858_1004278132 165
139 3300005843 Ga0068860_100324883 Ga0068860_1003248833 165
140 3300005985 Ga0081539_10003022 Ga0081539_1000302219 165
141 3300006163 Ga0070715_10159991 Ga0070715_101599912 165
142 3300006175 Ga0070712_100109025 Ga0070712_1001090252 165
143 3300006237 Ga0097621_100136771 Ga0097621_1001367713 165
144 3300006847 Ga0075431_100059658 Ga0075431_1000596586 165
145 3300006931 Ga0097620_100685881 Ga0097620_1006858812 165
146 3300009094 Ga0111539_10053101 Ga0111539_100531012 165
147 3300009098 Ga0105245_10035809 Ga0105245_100358094 165
148 3300009101 Ga0105247_10020849 Ga0105247_100208496 165
149 3300009148 Ga0105243_11281947 Ga0105243_112819472 165
150 3300009176 Ga0105242_10237925 Ga0105242_102379253 165
151 3300009177 Ga0105248_10420349 Ga0105248_104203491 165
152 3300009545 Ga0105237_10073222 Ga0105237_100732226 165
153 3300010375 Ga0105239_11749690 Ga0105239_117496901 165
154 3300013297 Ga0157378_10851835 Ga0157378_108518352 165
155 3300013308 Ga0157375_10026679 Ga0157375_100266795 165
156 3300014325 Ga0163163_10076620 Ga0163163_100766204 165
157 3300014497 Ga0182008_10000248 Ga0182008_1000024859 165
158 3300014968 Ga0157379_10064129 Ga0157379_100641294 165
159 3300025245 Ga0207425_1012080 Ga0207425_10120803 165
160 3300025898 Ga0207692_10070712 Ga0207692_100707124 165
161 3300025899 Ga0207642_10010092 Ga0207642_100100924 165
162 3300025906 Ga0207699_10004288 Ga0207699_100042882 165
163 3300025912 Ga0207707_10026137 Ga0207707_100261374 165
164 3300025915 Ga0207693_10012690 Ga0207693_100126902 165
165 3300025923 Ga0207681_10002747 Ga0207681_100027479 165
166 3300025927 Ga0207687_10073566 Ga0207687_100735663 165
167 3300025928 Ga0207700_10098836 Ga0207700_100988364 165
168 3300025931 Ga0207644_10128104 Ga0207644_101281043 165
169 3300025941 Ga0207711_10363351 Ga0207711_103633512 165
170 3300025942 Ga0207689_10073712 Ga0207689_100737123 165
171 3300025949 Ga0207667_10400913 Ga0207667_104009132 165
172 3300025960 Ga0207651_10221821 Ga0207651_102218212 165
173 3300025972 Ga0207668_10128276 Ga0207668_101282763 165
174 3300026078 Ga0207702_10382649 Ga0207702_103826492 165
175 3300026088 Ga0207641_10060416 Ga0207641_100604165 165
176 3300026095 Ga0207676_10589236 Ga0207676_105892362 165
177 3300026121 Ga0207683_10129297 Ga0207683_101292973 165
178 3300028379 Ga0268266_10193567 Ga0268266_101935672 165
179 3300028381 Ga0268264_10711240 Ga0268264_107112402 165
180 3300028381 Ga0268264_10910639 Ga0268264_109106392 165
181 3300028794 Ga0307515_10330874 Ga0307515_103308742 165
182 3300031548 Ga0307408_100232871 Ga0307408_1002328712 165
183 3300031731 Ga0307405_10948430 Ga0307405_109484301 165
184 3300031901 Ga0307406_10673211 Ga0307406_106732112 165
185 3300036401 Ga0373937_0938567 Ga0373937_0938567_154_651 165
186 3300041406 Ga0439439_0002925 Ga0439439_0002925_1438_1935 165
187 3300042002 Ga0439442_056661 Ga0439442_056661_289_786 165
188 3300042007 Ga0439449_0001784 Ga0439449_0001784_7036_7533 165
189 3300042115 Ga0450911_000086 Ga0450911_000086_35824_36321 165
190 3300042128 Ga0450897_008164 Ga0450897_008164_414_911 165
191 3300042134 Ga0450898_001488 Ga0450898_001488_1272_1769 165
192 3300046454 Ga0495592_0081828 Ga0495592_0081828_1700_2203 165
193 3300046472 Ga0495580_0428043 Ga0495580_0428043_163_660 165
194 3300046642 Ga0495634_0509543 Ga0495634_0509543_16_513 165
195 3300047317 Ga0495604_0194584 Ga0495604_0194584_840_1343 165
196 3300048088 Ga0495602_0231969 Ga0495602_0231969_238_735 165
197 3300048903 Ga0496100_0068233 Ga0496100_0068233_771_1268 165
198 3300048904 Ga0496101_0597833 Ga0496101_0597833_49_546 165
199 3300048906 Ga0496103_0175992 Ga0496103_0175992_718_1215 165
200 3300048907 Ga0496104_0085608 Ga0496104_0085608_1227_1724 165
201 3300048907 Ga0496104_0166052 Ga0496104_0166052_354_851 165
202 3300048910 Ga0496107_0079803 Ga0496107_0079803_298_795 165
203 3300048911 Ga0496108_0141867 Ga0496108_0141867_1180_1677 165
204 3300048912 Ga0496109_0218394 Ga0496109_0218394_627_1124 165
205 3300048913 Ga0496110_0106734 Ga0496110_0106734_319_816 165
206 3300048915 Ga0496112_0149547 Ga0496112_0149547_713_1210 165
207 3300048917 Ga0496114_0207081 Ga0496114_0207081_596_1093 165
208 3300048917 Ga0496114_0520939 Ga0496114_0520939_491_988 165
209 3300048918 Ga0496115_0056287 Ga0496115_0056287_2520_3017 165
210 3300048918 Ga0496115_0159105 Ga0496115_0159105_1086_1583 165
211 3300048927 Ga0496124_0067315 Ga0496124_0067315_369_866 165
212 3300048929 Ga0496126_0281025 Ga0496126_0281025_181_678 165
213 3300049568 Ga0501031_0000028 Ga0501031_0000028_40473_40976 165
214 3300049569 Ga0501032_0000448 Ga0501032_0000448_402_905 165
215 3300049573 Ga0501037_0000192 Ga0501037_0000192_2766_3269 165
216 3300049574 Ga0501038_0000171 Ga0501038_0000171_41361_41864 165
217 3300049574 Ga0501038_0036050 Ga0501038_0036050_2533_3030 165
218 3300049575 Ga0501039_0000363 Ga0501039_0000363_26647_27150 165
219 3300049579 Ga0501043_0001158 Ga0501043_0001158_2267_2770 165
220 3300049579 Ga0501043_0027139 Ga0501043_0027139_3085_3582 165
221 3300049581 Ga0501047_0007851 Ga0501047_0007851_476_979 165
222 3300049822 Ga0501035_0000186 Ga0501035_0000186_24755_25258 165
223 3300049823 Ga0501044_0000068 Ga0501044_0000068_18160_18657 165
224 3300049823 Ga0501044_0049206 Ga0501044_0049206_2442_2945 165
225 3300050510 nmdc:mga06r32_56517_c1 nmdc:mga06r32_56517_c1_2885_3388 165
226 3300050511 nmdc:mga08y16_1215668_c1 nmdc:mga08y16_1215668_c1_109_606 165
227 3300050511 nmdc:mga08y16_27142_c1 nmdc:mga08y16_27142_c1_3255_3758 165
228 3300053078 Ga0495612_0200121 Ga0495612_0200121_374_871 165
229 3300005937 Ga0081455_10044582 Ga0081455_100445823 166
230 3300006051 Ga0075364_10519093 Ga0075364_105190932 166
231 3300046524 Ga0495648_0099290 Ga0495648_0099290_1000_1500 166
232 3300047320 Ga0495672_0093856 Ga0495672_0093856_156_656 166
233 3300047323 Ga0495683_0031312 Ga0495683_0031312_1513_2013 166
234 3300047443 Ga0495687_033784 Ga0495687_033784_929_1429 166
235 3300047469 Ga0495673_0032523 Ga0495673_0032523_1268_1768 166
236 3300049460 Ga0495682_0024844 Ga0495682_0024844_1139_1639 166
237 3300049460 Ga0495682_0243644 Ga0495682_0243644_106_606 166
238 3300003752 Ga0055539_1000002 Ga0055539_1000002308 167
239 3300003756 Ga0055533_1000004 Ga0055533_1000004308 167
240 3300003759 Ga0055525_1000002 Ga0055525_1000002308 167
241 3300003841 Ga0055541_1000002 Ga0055541_1000002535 167
242 3300005347 Ga0070668_100004268 Ga0070668_1000042688 167
243 3300005353 Ga0070669_100011862 Ga0070669_1000118627 167
244 3300005563 Ga0068855_100000526 Ga0068855_1000005265 167
245 3300006871 Ga0075434_102015592 Ga0075434_1020155921 167
246 3300013308 Ga0157375_10663750 Ga0157375_106637501 167
247 3300014326 Ga0157380_10108173 Ga0157380_101081734 167
248 3300025224 Ga0209784_100002 Ga0209784_100002539 167
249 3300025225 Ga0209566_100003 Ga0209566_100003539 167
250 3300025226 Ga0209674_100004 Ga0209674_100004539 167
251 3300025230 Ga0209563_100006 Ga0209563_100006539 167
252 3300025253 Ga0209677_100003 Ga0209677_100003539 167
253 3300025923 Ga0207681_10028355 Ga0207681_100283553 167
254 3300025949 Ga0207667_10000073 Ga0207667_1000007377 167
255 3300025949 Ga0207667_10000076 Ga0207667_1000007671 167
256 3300025949 Ga0207667_10000147 Ga0207667_1000014710 167
257 3300025972 Ga0207668_10001103 Ga0207668_1000110314 167
258 3300026118 Ga0207675_100446400 Ga0207675_1004464002 167
259 3300028380 Ga0268265_10060824 Ga0268265_100608241 167
260 3300031251 Ga0265327_10026495 Ga0265327_100264955 167
261 3300028800 Ga0265338_11009479 Ga0265338_110094791 168
262 3300031241 Ga0265325_10136438 Ga0265325_101364382 168
263 3300031247 Ga0265340_10122264 Ga0265340_101222642 168
264 3300031249 Ga0265339_10092685 Ga0265339_100926851 168
265 3300031250 Ga0265331_10004066 Ga0265331_100040663 168
266 3300031595 Ga0265313_10000361 Ga0265313_1000036149 168
267 3300042876 Ga0451577_0343930 Ga0451577_0343930_229_735 168
268 3300048921 Ga0496118_0013550 Ga0496118_0013550_108_614 168
269 3300048922 Ga0496119_0218600 Ga0496119_0218600_197_703 168
270 3300048928 Ga0496125_0096087 Ga0496125_0096087_1177_1683 168
271 3300053161 Ga0500634_0008772 Ga0500634_0008772_4295_4801 168
272 3300025920 Ga0207649_10177926 Ga0207649_101779262 169
273 3300025933 Ga0207706_10147784 Ga0207706_101477841 169
274 3300025944 Ga0207661_11052855 Ga0207661_110528552 169
275 3300026067 Ga0207678_10301281 Ga0207678_103012812 169
276 3300026075 Ga0207708_10179045 Ga0207708_101790453 169
277 3300042876 Ga0451577_0001619 Ga0451577_0001619_21979_22488 169
278 3300047321 Ga0495676_0297572 Ga0495676_0297572_118_627 169
279 3300049577 Ga0501041_0037672 Ga0501041_0037672_1738_2256 169
280 3300049579 Ga0501043_0838811 Ga0501043_0838811_103_621 169
281 3300049580 Ga0501046_0135971 Ga0501046_0135971_939_1457 169
282 3300049587 Ga0501071_0022436 Ga0501071_0022436_616_1134 169
283 3300049591 Ga0501075_0077918 Ga0501075_0077918_831_1349 169
284 3300049593 Ga0501077_0200055 Ga0501077_0200055_569_1087 169
285 3300049741 Ga0501079_0081220 Ga0501079_0081220_829_1347 169
286 3300049742 Ga0501080_0022602 Ga0501080_0022602_284_802 169
287 3300049743 Ga0501081_0055213 Ga0501081_0055213_1461_1979 169
288 3300060353 Ga0501082_0389772 Ga0501082_0389772_527_1045 169
289 3300061734 Ga0530510_0103254 Ga0530510_0103254_1180_1698 169
290 3300005335 Ga0070666_10004034 Ga0070666_100040345 170
291 3300005336 Ga0070680_100014468 Ga0070680_1000144689 170
292 3300005367 Ga0070667_100000057 Ga0070667_100000057145 170
293 3300005458 Ga0070681_10001191 Ga0070681_100011917 170
294 3300005530 Ga0070679_100015079 Ga0070679_1000150792 170
295 3300005614 Ga0068856_100982874 Ga0068856_1009828741 170
296 3300007788 Ga0099795_10014494 Ga0099795_100144942 170
297 3300009092 Ga0105250_10253280 Ga0105250_102532802 170
298 3300009101 Ga0105247_10019748 Ga0105247_100197485 170
299 3300009553 Ga0105249_11042218 Ga0105249_110422182 170
300 3300010159 Ga0099796_10011258 Ga0099796_100112583 170
301 3300013104 Ga0157370_10003754 Ga0157370_1000375415 170
302 3300013307 Ga0157372_10372972 Ga0157372_103729722 170
303 3300014325 Ga0163163_10593047 Ga0163163_105930472 170
304 3300014968 Ga0157379_10217988 Ga0157379_102179882 170
305 3300025903 Ga0207680_10082905 Ga0207680_100829053 170
306 3300025917 Ga0207660_10018785 Ga0207660_100187855 170
307 3300025919 Ga0207657_10580324 Ga0207657_105803241 170
308 3300025921 Ga0207652_10026687 Ga0207652_100266876 170
309 3300025949 Ga0207667_10021262 Ga0207667_100212625 170
310 3300025961 Ga0207712_10887306 Ga0207712_108873062 170
311 3300026078 Ga0207702_10685411 Ga0207702_106854112 170
312 3300031852 Ga0307410_10854589 Ga0307410_108545892 170
313 3300035083 Ga0373926_0026410 Ga0373926_0026410_866_1378 170
314 3300037068 Ga0373925_0123825 Ga0373925_0123825_111_623 170
315 3300041505 Ga0451849_0841318 Ga0451849_0841318_144_674 170
316 3300046472 Ga0495580_0061746 Ga0495580_0061746_1518_2030 170
317 3300046664 Ga0495659_0274428 Ga0495659_0274428_15_527 170
318 3300049585 Ga0501069_0102702 Ga0501069_0102702_415_927 170
319 3300049590 Ga0501074_0107735 Ga0501074_0107735_1165_1677 170
320 3300049742 Ga0501080_0136595 Ga0501080_0136595_706_1218 170
321 3300053139 Ga0500568_0303654 Ga0500568_0303654_15_527 170
322 3300005563 Ga0068855_100600808 Ga0068855_1006008081 171
323 3300009093 Ga0105240_10182374 Ga0105240_101823743 171
324 3300025949 Ga0207667_10126687 Ga0207667_101266873 171
325 3300028800 Ga0265338_10077668 Ga0265338_100776685 171
326 3300031616 Ga0307508_10188020 Ga0307508_101880204 171
327 3300035118 Ga0373954_0001843 Ga0373954_0001843_4111_4626 171
328 3300035119 Ga0373956_0026287 Ga0373956_0026287_930_1445 171
329 3300035172 Ga0373955_0000397 Ga0373955_0000397_14224_14739 171
330 3300035692 Ga0373935_0213293 Ga0373935_0213293_694_1209 171
331 3300035692 Ga0373935_0299992 Ga0373935_0299992_487_1002 171
332 3300035724 Ga0373933_0079566 Ga0373933_0079566_1134_1649 171
333 3300036401 Ga0373937_0003633 Ga0373937_0003633_6179_6694 171
334 3300042876 Ga0451577_0173759 Ga0451577_0173759_979_1497 171
335 3300044712 Ga0453684_0238957 Ga0453684_0238957_366_884 171
336 3300046454 Ga0495592_0378402 Ga0495592_0378402_237_752 171
337 3300046462 Ga0495651_0071701 Ga0495651_0071701_1193_1708 171
338 3300046463 Ga0495653_0182072 Ga0495653_0182072_383_898 171
339 3300046536 Ga0495587_0022597 Ga0495587_0022597_923_1438 171
340 3300046559 Ga0495667_0018847 Ga0495667_0018847_1037_1552 171
341 3300046663 Ga0495635_0283228 Ga0495635_0283228_584_1099 171
342 3300046675 Ga0495657_0007421 Ga0495657_0007421_5695_6210 171
343 3300046809 Ga0495600_0099423 Ga0495600_0099423_504_1019 171
344 3300047317 Ga0495604_0115169 Ga0495604_0115169_994_1509 171
345 3300047322 Ga0495680_0304614 Ga0495680_0304614_283_798 171
346 3300047471 Ga0495684_0366647 Ga0495684_0366647_82_597 171
347 3300048088 Ga0495602_0010148 Ga0495602_0010148_8007_8522 171
348 3300053077 Ga0495601_0021788 Ga0495601_0021788_1439_1954 171
349 3300053078 Ga0495612_0096262 Ga0495612_0096262_407_922 171
350 3300053084 Ga0495595_0001665 Ga0495595_0001665_4241_4756 171
351 3300053085 Ga0495619_0049386 Ga0495619_0049386_232_747 171
352 3300053119 Ga0500595_071370 Ga0500595_071370_320_844 171
353 3300009093 Ga0105240_10042856 Ga0105240_100428564 172
354 3300025913 Ga0207695_10002462 Ga0207695_1000246230 172
355 3300005535 Ga0070684_100278969 Ga0070684_1002789692 173
356 3300013105 Ga0157369_10399580 Ga0157369_103995802 173
357 3300044684 Ga0466966_0005135 Ga0466966_0005135_8050_8571 173
358 3300028794 Ga0307515_10333199 Ga0307515_103331992 174
359 3300035398 Ga0316574_0153715 Ga0316574_0153715_700_1230 174
360 3300037471 Ga0395905_0028160 Ga0395905_0028160_3160_3699 174
361 3300038726 Ga0400490_56350 Ga0400490_56350_3675_4199 174
362 3300039062 Ga0400483_070253 Ga0400483_070253_378_902 174
363 3300041443 Ga0451789_0024300 Ga0451789_0024300_90_617 174
364 3300046524 Ga0495648_0003031 Ga0495648_0003031_9239_9766 174
365 3300048928 Ga0496125_0284192 Ga0496125_0284192_221_745 174
366 3300049582 Ga0501048_0430428 Ga0501048_0430428_189_725 174
367 3300049744 Ga0501083_0230642 Ga0501083_0230642_77_613 174
368 3300053094 Ga0500566_0000806 Ga0500566_0000806_4532_5071 174
369 3300053095 Ga0500640_019681 Ga0500640_019681_1528_2067 174
370 3300053111 Ga0500572_000300 Ga0500572_000300_2564_3103 174
371 3300053122 Ga0500608_005951 Ga0500608_005951_2362_2901 174
372 3300053136 Ga0500559_0015867 Ga0500559_0015867_1287_1826 174
373 3300053150 Ga0500603_000147 Ga0500603_000147_10657_11196 174
374 3300053159 Ga0500630_036118 Ga0500630_036118_1503_2042 174
375 3300053163 Ga0500639_000430 Ga0500639_000430_14427_14966 174
376 3300053735 Ga0500596_002406 Ga0500596_002406_2552_3091 174
377 3300053737 Ga0500601_005965 Ga0500601_005965_593_1132 174
378 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001284 175
379 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001478 175
380 3300004625 Ga0055543_1000089 Ga0055543_100008943 175
381 3300005262 Ga0065165_1000008 Ga0065165_1000008173 175
382 3300006852 Ga0075433_10000505 Ga0075433_1000050519 175
383 3300006914 Ga0075436_100000120 Ga0075436_10000012010 175
384 3300007076 Ga0075435_100001032 Ga0075435_10000103214 175
385 3300009147 Ga0114129_10002111 Ga0114129_1000211110 175
386 3300025284 Ga0209130_1000003 Ga0209130_1000003491 175
387 3300025302 Ga0207426_1000011 Ga0207426_1000011285 175
388 3300050507 nmdc:mga05p37_7214_c1 nmdc:mga05p37_7214_c1_263_790 175
389 3300050512 nmdc:mga0n895_1141_c1 nmdc:mga0n895_1141_c1_7227_7754 175
390 3300050513 nmdc:mga0rr50_718_c1 nmdc:mga0rr50_718_c1_5681_6208 175
391 3300050514 nmdc:mga08x19_84_c1 nmdc:mga08x19_84_c1_11635_12162 175
392 3300050515 nmdc:mga0a205_3213_c1 nmdc:mga0a205_3213_c1_7227_7754 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

49

180

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9576 7 145
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9365 7 145
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9165 7 145
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9068 7 150
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9035 7 145
ID Description Score Start End Superfamily
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.882 8 143 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8812 7 143 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8739 8 143 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8722 7 150 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8599 7 150 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A6N8SQ89-F1-model_v4 Arsenate reductase ArsC 1 4 92 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A846MWQ8-F1-model_v4 Arsenate reductase (Glutaredoxin) 0.9959 4 169 GO:0008794
GO:0016747
GO:0046685
AF-A0A1P8FIT3-F1-model_v4 Protein-tyrosine-phosphatase 0.9951 4 165 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A1W9YYZ9-F1-model_v4 Protein-tyrosine-phosphatase 0.9949 3 100 GO:0046685
AF-A0A0P9BHB7-F1-model_v4 deleted 0.9947 4 165

Feature Viewer

pLDDT pTM Quality
93.25 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map