F432281

General Info

Members Datasets Scaffolds Average Seq Length
392 221 784 163

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100813517|Ga0075434_1008135171
Length 182
Sequence MESRVKLFGHAVHPILIVFPLGLLATAVIFDVISILTGVGGWSEIAFWMIAAGIIGGLAAAIFGLIDWLAIPSDTRAKVIGLWHGLGNVVVIGLFIVSWLLRASAPADPGTLAYVLSFVGAGLALVTGWLGGELVERLGVGVDDGAHLNAPSSLLNRPASESVAGGHRVITGNPEHRGRHAT

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
79 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
146 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
147 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
198 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
199 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.66
Metatranscriptomes 4.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.28
Rhizosphere 98.21
Stem 0
Stem Tuber 0
Unclassified 26.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100813517 3300006871 Unclassified 950
2 Ga0006778J45830_1022534 3300003162 Unclassified 578
3 Ga0006777J48905_1017312 3300003308 Bacteria 674
4 Ga0006777J48905_1023828 3300003308 Unclassified 641
5 Ga0007429J51699_1119074 3300003579 Unclassified 546
6 Ga0032354_1015092 3300003693 Bacteria 663
7 Ga0006780_1003651 3300003735 Bacteria 616
8 Ga0058860_11546644 3300004801 Viruses 627
9 Ga0070658_10100741 3300005327 Bacteria 2388
10 Ga0070676_10005571 3300005328 Bacteria 6704
11 Ga0070683_100019198 3300005329 Bacteria 6071
12 Ga0070683_100635314 3300005329 Unclassified 1022
13 Ga0070690_100798444 3300005330 Bacteria 732
14 Ga0070670_100017044 3300005331 Bacteria 6235
15 Ga0070670_100160868 3300005331 Bacteria 1946
16 Ga0070670_100590998 3300005331 Bacteria 993
17 Ga0068869_100214461 3300005334 Unclassified 1523
18 Ga0068869_101402479 3300005334 Unclassified 618
19 Ga0070666_10000296 3300005335 Bacteria 32381
20 Ga0070680_100002902 3300005336 Bacteria 12739
21 Ga0070680_100067405 3300005336 Bacteria 2935
22 Ga0070680_100075313 3300005336 Unclassified 2778
23 Ga0070682_100086518 3300005337 Unclassified 2041
24 Ga0070682_100114003 3300005337 Bacteria 1806
25 Ga0068868_100219008 3300005338 Unclassified 1593
26 Ga0070660_100021314 3300005339 Bacteria 4777
27 Ga0070660_100042503 3300005339 Bacteria 3469
28 Ga0070689_100078898 3300005340 Bacteria 2582
29 Ga0070691_10066349 3300005341 Bacteria 1744
30 Ga0070661_100001979 3300005344 Bacteria 14166
31 Ga0070661_100041917 3300005344 Bacteria 3340
32 Ga0070669_100065061 3300005353 Unclassified 2686
33 Ga0070675_100069428 3300005354 Bacteria 2919
34 Ga0070671_100832445 3300005355 Unclassified 804
35 Ga0070673_100450934 3300005364 Bacteria 1157
36 Ga0070709_10020295 3300005434 Bacteria 3853
37 Ga0070709_10819989 3300005434 Bacteria 731
38 Ga0070714_100429411 3300005435 Bacteria 1252
39 Ga0070700_100060292 3300005441 Bacteria 2391
40 Ga0070700_100937544 3300005441 Bacteria 707
41 Ga0070694_100545636 3300005444 Bacteria 928
42 Ga0070708_101189752 3300005445 Bacteria 713
43 Ga0070663_100197921 3300005455 Bacteria 1567
44 Ga0070681_10000788 3300005458 Bacteria 26423
45 Ga0070681_10002080 3300005458 Bacteria 18169
46 Ga0070681_10202731 3300005458 Bacteria 1902
47 Ga0070681_10222666 3300005458 Bacteria 1802
48 Ga0070681_10604494 3300005458 Unclassified 1011
49 Ga0070679_100004447 3300005530 Bacteria 12949
50 Ga0070679_100004702 3300005530 Bacteria 12591
51 Ga0070679_100031271 3300005530 Bacteria 5257
52 Ga0070679_101233328 3300005530 Unclassified 693
53 Ga0070684_100004504 3300005535 Bacteria 10608
54 Ga0070697_100298783 3300005536 Bacteria 1384
55 Ga0068853_101824995 3300005539 Bacteria 589
56 Ga0070672_100024454 3300005543 Bacteria 4465
57 Ga0068855_100085599 3300005563 Bacteria 3647
58 Ga0070664_100017876 3300005564 Bacteria 5822
59 Ga0070664_100096122 3300005564 Bacteria 2570
60 Ga0068857_100007789 3300005577 Bacteria 9233
61 Ga0068857_100018697 3300005577 Bacteria 6083
62 Ga0068857_100058666 3300005577 Bacteria 3418
63 Ga0068857_100095898 3300005577 Bacteria 2658
64 Ga0068854_100367275 3300005578 Unclassified 1182
65 Ga0068856_100048584 3300005614 Bacteria 4182
66 Ga0068856_100787955 3300005614 Bacteria 970
67 Ga0068852_100575904 3300005616 Unclassified 1128
68 Ga0068852_101297264 3300005616 Unclassified 750
69 Ga0068852_101494134 3300005616 Unclassified 698
70 Ga0068864_100788581 3300005618 Bacteria 933
71 Ga0068851_10031281 3300005834 Unclassified 2643
72 Ga0068870_10511199 3300005840 Bacteria 802
73 Ga0068858_100163144 3300005842 Bacteria 2099
74 Ga0068860_100351056 3300005843 Bacteria 1452
75 Ga0081538_10145295 3300005981 Bacteria 1085
76 Ga0081539_10051956 3300005985 Bacteria 2306
77 Ga0097621_100005283 3300006237 Bacteria 9091
78 Ga0097621_100171622 3300006237 Bacteria 1870
79 Ga0097621_100764054 3300006237 Unclassified 893
80 Ga0068871_100140226 3300006358 Bacteria 2055
81 Ga0075428_100079170 3300006844 Bacteria 3587
82 Ga0075428_100096757 3300006844 Unclassified 3218
83 Ga0075428_100200049 3300006844 Bacteria 2160
84 Ga0075431_100041725 3300006847 Unclassified 4732
85 Ga0075433_10055928 3300006852 Unclassified 3446
86 Ga0075433_10132891 3300006852 Unclassified 2211
87 Ga0075433_10436959 3300006852 Bacteria 1154
88 Ga0075434_100009299 3300006871 Bacteria 9157
89 Ga0075429_100660353 3300006880 Unclassified 916
90 Ga0075429_101386879 3300006880 Bacteria 612
91 Ga0068865_100004900 3300006881 Bacteria 8092
92 Ga0068865_100688666 3300006881 Bacteria 872
93 Ga0075435_100145713 3300007076 Unclassified 1989
94 Ga0075435_100183325 3300007076 Bacteria 1770
95 Ga0075435_100758645 3300007076 Unclassified 844
96 Ga0105240_10552378 3300009093 Bacteria 1274
97 Ga0111539_10014203 3300009094 Bacteria 9946
98 Ga0111539_10023066 3300009094 Bacteria 7643
99 Ga0111539_10116162 3300009094 Unclassified 3138
100 Ga0111539_10501311 3300009094 Unclassified 1414
101 Ga0105245_10002891 3300009098 Bacteria 15419
102 Ga0114129_10029192 3300009147 Bacteria 7812
103 Ga0114129_10123536 3300009147 Bacteria 3560
104 Ga0114129_10554775 3300009147 Unclassified 1493
105 Ga0105241_10002440 3300009174 Bacteria 13948
106 Ga0105241_10006883 3300009174 Bacteria 8367
107 Ga0105241_10613543 3300009174 Bacteria 984
108 Ga0105237_10114918 3300009545 Bacteria 2684
109 Ga0105238_10000854 3300009551 Bacteria 31404
110 Ga0105239_10285555 3300010375 Bacteria 1858
111 Ga0154014_109623 3300013052 Bacteria 701
112 Ga0157371_10098236 3300013102 Bacteria 2076
113 Ga0157371_10883982 3300013102 Bacteria 677
114 Ga0157370_10172978 3300013104 Bacteria 2007
115 Ga0157370_10280151 3300013104 Unclassified 1541
116 Ga0157370_11061383 3300013104 Unclassified 732
117 Ga0157369_10305810 3300013105 Unclassified 1654
118 Ga0157369_10573078 3300013105 Bacteria 1166
119 Ga0157374_10028158 3300013296 Bacteria 5074
120 Ga0157378_10008746 3300013297 Bacteria 8814
121 Ga0157372_10072726 3300013307 Bacteria 3875
122 Ga0157372_10077696 3300013307 Bacteria 3750
123 Ga0157372_10121098 3300013307 Bacteria 3005
124 Ga0157372_10163014 3300013307 Unclassified 2577
125 Ga0157372_10261887 3300013307 Bacteria 2008
126 Ga0157372_10428770 3300013307 Bacteria 1541
127 Ga0163163_10108781 3300014325 Bacteria 2799
128 Ga0163163_10371955 3300014325 Bacteria 1486
129 Ga0157380_11975621 3300014326 Unclassified 645
130 Ga0197907_11054272 3300020069 Unclassified 660
131 Ga0197907_11265178 3300020069 Unclassified 1342
132 Ga0206349_1357002 3300020075 Bacteria 691
133 Ga0206355_1285187 3300020076 Bacteria 701
134 Ga0206351_10191829 3300020077 Unclassified 1625
135 Ga0206352_10027153 3300020078 Bacteria 675
136 Ga0154015_1244462 3300020610 Unclassified 2577
137 Ga0224712_10078212 3300022467 Unclassified 1359
138 Ga0207656_10004946 3300025321 Unclassified 4681
139 Ga0207680_10002319 3300025903 Bacteria 8858
140 Ga0207680_10248020 3300025903 Bacteria 1229
141 Ga0207680_10907861 3300025903 Bacteria 631
142 Ga0207699_10004320 3300025906 Bacteria 6796
143 Ga0207645_10006165 3300025907 Bacteria 8608
144 Ga0207645_10378176 3300025907 Bacteria 950
145 Ga0207705_10152261 3300025909 Bacteria 1733
146 Ga0207654_10013536 3300025911 Bacteria 4197
147 Ga0207707_10043322 3300025912 Unclassified 3926
148 Ga0207707_10058476 3300025912 Bacteria 3355
149 Ga0207707_10147377 3300025912 Bacteria 2058
150 Ga0207707_10288947 3300025912 Unclassified 1419
151 Ga0207707_10409837 3300025912 Bacteria 1163
152 Ga0207695_10036921 3300025913 Bacteria 5276
153 Ga0207671_10012551 3300025914 Bacteria 6804
154 Ga0207660_10000851 3300025917 Bacteria 20109
155 Ga0207660_10010530 3300025917 Bacteria 6004
156 Ga0207660_10049321 3300025917 Unclassified 2983
157 Ga0207657_10006566 3300025919 Bacteria 12045
158 Ga0207657_10043923 3300025919 Bacteria 3933
159 Ga0207649_10006468 3300025920 Bacteria 6363
160 Ga0207649_10017169 3300025920 Bacteria 4099
161 Ga0207652_10010749 3300025921 Bacteria 7371
162 Ga0207652_10044573 3300025921 Unclassified 3779
163 Ga0207694_10001849 3300025924 Bacteria 17623
164 Ga0207650_10009287 3300025925 Bacteria 6720
165 Ga0207650_10552253 3300025925 Bacteria 966
166 Ga0207687_10001503 3300025927 Bacteria 15965
167 Ga0207700_10014634 3300025928 Bacteria 5147
168 Ga0207644_10148943 3300025931 Bacteria 1809
169 Ga0207644_10374730 3300025931 Bacteria 1160
170 Ga0207690_10012362 3300025932 Bacteria 5107
171 Ga0207709_10438406 3300025935 Bacteria 1007
172 Ga0207704_10002805 3300025938 Bacteria 7864
173 Ga0207704_10140831 3300025938 Bacteria 1687
174 Ga0207704_11258570 3300025938 Bacteria 632
175 Ga0207665_10116729 3300025939 Bacteria 1881
176 Ga0207691_10011722 3300025940 Bacteria 8418
177 Ga0207689_10384743 3300025942 Unclassified 1168
178 Ga0207689_11121106 3300025942 Unclassified 663
179 Ga0207661_10097559 3300025944 Unclassified 2461
180 Ga0207661_10150925 3300025944 Unclassified 2008
181 Ga0207679_10001636 3300025945 Bacteria 13965
182 Ga0207667_10181531 3300025949 Bacteria 2161
183 Ga0207667_11368525 3300025949 Bacteria 682
184 Ga0207712_11016266 3300025961 Bacteria 736
185 Ga0207640_10115292 3300025981 Bacteria 1913
186 Ga0207640_10137489 3300025981 Unclassified 1776
187 Ga0207640_10157536 3300025981 Bacteria 1676
188 Ga0207677_10057537 3300026023 Bacteria 2670
189 Ga0207677_10076783 3300026023 Bacteria 2380
190 Ga0207678_10001679 3300026067 Bacteria 20319
191 Ga0207702_10115655 3300026078 Bacteria 2392
192 Ga0207702_10222170 3300026078 Bacteria 1760
193 Ga0207702_10441388 3300026078 Bacteria 1261
194 Ga0207702_10476782 3300026078 Unclassified 1214
195 Ga0207702_10768160 3300026078 Bacteria 952
196 Ga0207676_10190121 3300026095 Bacteria 1806
197 Ga0207676_10700134 3300026095 Unclassified 981
198 Ga0207674_10000996 3300026116 Bacteria 36967
199 Ga0207674_10019930 3300026116 Bacteria 7257
200 Ga0207698_12158201 3300026142 Unclassified 570
201 Ga0207428_10016872 3300027907 Bacteria 6275
202 Ga0207428_10159910 3300027907 Unclassified 1711
203 Ga0207428_10322930 3300027907 Unclassified 1140
204 Ga0268265_10038991 3300028380 Bacteria 3498
205 Ga0307408_100006586 3300031548 Bacteria 7703
206 Ga0307408_100008881 3300031548 Bacteria 6640
207 Ga0307408_100026263 3300031548 Bacteria 3998
208 Ga0307408_100161262 3300031548 Unclassified 1781
209 Ga0307408_100428078 3300031548 Bacteria 1143
210 Ga0307405_10020948 3300031731 Bacteria 3665
211 Ga0307405_10190274 3300031731 Bacteria 1482
212 Ga0307413_10004730 3300031824 Bacteria 5976
213 Ga0307413_10413827 3300031824 Bacteria 1060
214 Ga0307413_10544237 3300031824 Bacteria 940
215 Ga0307410_10001160 3300031852 Bacteria 11600
216 Ga0307410_10008230 3300031852 Bacteria 5770
217 Ga0307410_10042000 3300031852 Bacteria 3019
218 Ga0307410_10162243 3300031852 Bacteria 1676
219 Ga0307410_10327012 3300031852 Unclassified 1218
220 Ga0307410_10334875 3300031852 Bacteria 1205
221 Ga0307410_10600412 3300031852 Bacteria 918
222 Ga0307410_10666518 3300031852 Unclassified 874
223 Ga0307406_10010453 3300031901 Bacteria 5235
224 Ga0307406_10153792 3300031901 Bacteria 1644
225 Ga0307406_10999932 3300031901 Unclassified 717
226 Ga0307406_11190790 3300031901 Unclassified 661
227 Ga0307407_10000322 3300031903 Bacteria 14238
228 Ga0307407_10048508 3300031903 Bacteria 2417
229 Ga0307412_10049585 3300031911 Bacteria 2767
230 Ga0307412_10153548 3300031911 Bacteria 1702
231 Ga0307412_10243067 3300031911 Bacteria 1393
232 Ga0307409_100006965 3300031995 Bacteria 6715
233 Ga0307409_100013547 3300031995 Bacteria 5255
234 Ga0307409_100021935 3300031995 Bacteria 4391
235 Ga0307409_100033115 3300031995 Unclassified 3756
236 Ga0307409_100344346 3300031995 Bacteria 1404
237 Ga0307409_100394420 3300031995 Unclassified 1320
238 Ga0307416_100010102 3300032002 Bacteria 6218
239 Ga0307416_100122909 3300032002 Unclassified 2318
240 Ga0307416_100231443 3300032002 Bacteria 1782
241 Ga0307416_100417298 3300032002 Bacteria 1385
242 Ga0307416_100440623 3300032002 Bacteria 1353
243 Ga0307416_100467510 3300032002 Unclassified 1318
244 Ga0307416_100641189 3300032002 Unclassified 1146
245 Ga0307414_10013959 3300032004 Bacteria 4798
246 Ga0307414_10094940 3300032004 Bacteria 2227
247 Ga0307414_10149183 3300032004 Bacteria 1842
248 Ga0307411_10004792 3300032005 Bacteria 6552
249 Ga0307411_10037180 3300032005 Bacteria 3058
250 Ga0307411_10040417 3300032005 Unclassified 2959
251 Ga0307411_10065675 3300032005 Unclassified 2434
252 Ga0307411_10258423 3300032005 Bacteria 1374
253 Ga0307411_10294287 3300032005 Bacteria 1299
254 Ga0307411_10330532 3300032005 Unclassified 1235
255 Ga0307411_11588033 3300032005 Bacteria 603
256 Ga0307415_100003415 3300032126 Bacteria 8078
257 Ga0307415_100005014 3300032126 Bacteria 6969
258 Ga0307415_100061676 3300032126 Bacteria 2597
259 Ga0307415_100066491 3300032126 Bacteria 2516
260 Ga0373949_0000204 3300035090 Bacteria 22840
261 Ga0373923_0115746 3300035111 Bacteria 1194
262 Ga0373945_0272798 3300035116 Unclassified 719
263 Ga0373953_0366739 3300035117 Unclassified 632
264 Ga0373946_0449539 3300035171 Bacteria 656
265 Ga0373935_0422110 3300035692 Bacteria 960
266 Ga0373927_0216704 3300035695 Bacteria 1258
267 Ga0373927_0491337 3300035695 Unclassified 811
268 Ga0373933_0627175 3300035724 Unclassified 706
269 Ga0373947_0086469 3300035725 Unclassified 1949
270 Ga0373947_0869582 3300035725 Unclassified 615
271 Ga0373937_0058913 3300036401 Bacteria 3528
272 Ga0373925_0831500 3300037068 Unclassified 761
273 Ga0395905_0777679 3300037471 Unclassified 860
274 Ga0436363_0456872 3300039450 Bacteria 674
275 Ga0439439_0035676 3300041406 Bacteria 1278
276 Ga0439461_0087187 3300041410 Unclassified 744
277 Ga0451789_0447351 3300041443 Unclassified 944
278 Ga0451577_0006432 3300042876 Bacteria 11719
279 Ga0451577_0571655 3300042876 Bacteria 1026
280 Ga0466969_0008917 3300044656 Bacteria 5320
281 Ga0453683_0082577 3300044673 Bacteria 2014
282 Ga0466961_0490973 3300044693 Bacteria 742
283 Ga0466963_0069942 3300044694 Bacteria 2360
284 Ga0453684_0062453 3300044712 Bacteria 4771
285 Ga0453684_0218320 3300044712 Bacteria 2210
286 Ga0453684_0557194 3300044712 Unclassified 1262
287 Ga0453684_0562564 3300044712 Bacteria 1254
288 Ga0453684_1056754 3300044712 Bacteria 860
289 Ga0466959_0011359 3300045049 Bacteria 6397
290 Ga0466959_0350695 3300045049 Unclassified 1006
291 Ga0451576_0178437 3300045051 Bacteria 2217
292 Ga0451576_0404815 3300045051 Bacteria 1431
293 Ga0451576_1236181 3300045051 Bacteria 779
294 Ga0451576_2196173 3300045051 Bacteria 567
295 Ga0466958_0584464 3300045836 Unclassified 726
296 Ga0466967_0066523 3300045976 Bacteria 3212
297 Ga0466967_1502624 3300045976 Bacteria 671
298 Ga0495580_0122628 3300046472 Bacteria 1804
299 Ga0495630_0043615 3300046517 Bacteria 3351
300 Ga0495666_0093328 3300046526 Bacteria 1420
301 Ga0495652_0164766 3300046529 Bacteria 1716
302 Ga0495586_0037577 3300046535 Bacteria 2599
303 Ga0495587_0105025 3300046536 Bacteria 1625
304 Ga0495645_0000244 3300046543 Bacteria 39533
305 Ga0495667_0112527 3300046559 Bacteria 1759
306 Ga0495667_0415623 3300046559 Bacteria 847
307 Ga0495635_0476695 3300046663 Bacteria 823
308 Ga0495588_0174416 3300046674 Bacteria 1137
309 Ga0495599_0082649 3300046678 Bacteria 2006
310 Ga0495658_0229177 3300046683 Bacteria 1165
311 Ga0495649_0239186 3300046694 Bacteria 935
312 Ga0495600_0042449 3300046809 Bacteria 2965
313 Ga0495604_0098072 3300047317 Bacteria 2160
314 Ga0495674_0096150 3300047319 Bacteria 2525
315 Ga0495680_0181899 3300047322 Bacteria 1517
316 Ga0495675_0007049 3300047444 Bacteria 6914
317 Ga0496103_0369307 3300048906 Bacteria 922
318 Ga0496104_0466134 3300048907 Unclassified 1175
319 Ga0496105_0387399 3300048908 Unclassified 1112
320 Ga0496112_0039376 3300048915 Bacteria 4619
321 Ga0501336_024463 3300049552 Unclassified 566
322 Ga0501031_0661054 3300049568 Bacteria 671
323 Ga0501031_0772616 3300049568 Unclassified 616
324 Ga0501033_0328270 3300049570 Bacteria 1074
325 Ga0501034_0047922 3300049571 Unclassified 4313
326 Ga0501034_0797049 3300049571 Bacteria 838
327 Ga0501039_1004020 3300049575 Bacteria 648
328 Ga0501040_0018192 3300049576 Bacteria 4666
329 Ga0501040_0492141 3300049576 Bacteria 884
330 Ga0501040_0868213 3300049576 Bacteria 653
331 Ga0501042_0020728 3300049578 Bacteria 4576
332 Ga0501046_0022007 3300049580 Bacteria 5255
333 Ga0501048_0286840 3300049582 Bacteria 1171
334 Ga0501068_0040868 3300049584 Bacteria 2786
335 Ga0501068_0087302 3300049584 Bacteria 1921
336 Ga0501069_0619337 3300049585 Unclassified 650
337 Ga0501070_0277804 3300049586 Bacteria 1367
338 Ga0501070_1035047 3300049586 Bacteria 635
339 Ga0501071_0099581 3300049587 Bacteria 2142
340 Ga0501071_0322682 3300049587 Bacteria 1173
341 Ga0501071_0782212 3300049587 Bacteria 736
342 Ga0501072_0085824 3300049588 Bacteria 2497
343 Ga0501072_0341682 3300049588 Bacteria 1189
344 Ga0501075_0235452 3300049591 Bacteria 1396
345 Ga0501075_1053874 3300049591 Unclassified 618
346 Ga0501076_0412186 3300049592 Bacteria 1111
347 Ga0501076_0632790 3300049592 Unclassified 883
348 Ga0501077_0081800 3300049593 Bacteria 2046
349 Ga0501077_0684217 3300049593 Bacteria 659
350 Ga0501217_162352 3300049661 Unclassified 675
351 Ga0501223_087070 3300049663 Archaea 631
352 Ga0501238_044705 3300049671 Unclassified 656
353 Ga0501079_0027313 3300049741 Bacteria 4375
354 Ga0501079_0540667 3300049741 Bacteria 916
355 Ga0501080_0027231 3300049742 Bacteria 5317
356 Ga0501080_0080813 3300049742 Bacteria 3021
357 Ga0501081_0632332 3300049743 Bacteria 802
358 Ga0501081_0830715 3300049743 Bacteria 696
359 Ga0501241_031840 3300049758 Unclassified 999
360 Ga0501035_0299137 3300049822 Bacteria 1356
361 Ga0501044_0035695 3300049823 Bacteria 5205
362 Ga0501045_0038532 3300049824 Bacteria 3476
363 nmdc:mga05p37_221162_c1 3300050507 Unclassified 2285
364 nmdc:mga05p37_939589_c1 3300050507 Unclassified 927
365 nmdc:mga09592_205999_c1 3300050508 Bacteria 1704
366 nmdc:mga09592_419990_c1 3300050508 Bacteria 1155
367 nmdc:mga06r32_99862_c1 3300050510 Unclassified 2847
368 nmdc:mga08y16_10684_c1 3300050511 Bacteria 9635
369 nmdc:mga08y16_130541_c1 3300050511 Unclassified 2613
370 nmdc:mga08y16_16133_c1 3300050511 Bacteria 7852
371 nmdc:mga08y16_66114_c1 3300050511 Unclassified 3773
372 nmdc:mga08y16_869339_c1 3300050511 Bacteria 890
373 nmdc:mga0n895_164642_c1 3300050512 Bacteria 2249
374 nmdc:mga0n895_30600_c1 3300050512 Bacteria 5146
375 nmdc:mga0n895_383979_c1 3300050512 Unclassified 1421
376 nmdc:mga0n895_496447_c1 3300050512 Bacteria 1230
377 nmdc:mga0rr50_225731_c1 3300050513 Bacteria 1548
378 nmdc:mga0rr50_226196_c1 3300050513 Unclassified 1141
379 nmdc:mga0rr50_565020_c1 3300050513 Unclassified 969
380 nmdc:mga08x19_152761_c1 3300050514 Bacteria 1564
381 nmdc:mga0a205_205249_c1 3300050515 Unclassified 1860
382 nmdc:mga0a205_48696_c1 3300050515 Bacteria 4091
383 nmdc:mga0a205_87401_c1 3300050515 Bacteria 3012
384 nmdc:mga0a205_982_c3 3300050515 Bacteria 13822
385 Ga0495612_0055973 3300053078 Bacteria 1627
386 Ga0501084_1308433 3300054114 Bacteria 607
387 Ga0590071_007022 3300059421 Bacteria 2665
388 Ga0590074_086767 3300059423 Unclassified 602
389 Ga0590075_020605 3300059424 Bacteria 1642
390 Ga0501082_0032744 3300060353 Bacteria 4484
391 Ga0501082_1627847 3300060353 Bacteria 564
392 Ga0530510_0273783 3300061734 Bacteria 1260
393 Ga0075434_100813517
394 Ga0006778J45830_1022534
395 Ga0006777J48905_1017312
396 Ga0006777J48905_1023828
397 Ga0007429J51699_1119074
398 Ga0032354_1015092
399 Ga0006780_1003651
400 Ga0058860_11546644
401 Ga0070658_10100741
402 Ga0070676_10005571
403 Ga0070683_100019198
404 Ga0070683_100635314
405 Ga0070690_100798444
406 Ga0070670_100017044
407 Ga0070670_100160868
408 Ga0070670_100590998
409 Ga0068869_100214461
410 Ga0068869_101402479
411 Ga0070666_10000296
412 Ga0070680_100002902
413 Ga0070680_100067405
414 Ga0070680_100075313
415 Ga0070682_100086518
416 Ga0070682_100114003
417 Ga0068868_100219008
418 Ga0070660_100021314
419 Ga0070660_100042503
420 Ga0070689_100078898
421 Ga0070691_10066349
422 Ga0070661_100001979
423 Ga0070661_100041917
424 Ga0070669_100065061
425 Ga0070675_100069428
426 Ga0070671_100832445
427 Ga0070673_100450934
428 Ga0070709_10020295
429 Ga0070709_10819989
430 Ga0070714_100429411
431 Ga0070700_100060292
432 Ga0070700_100937544
433 Ga0070694_100545636
434 Ga0070708_101189752
435 Ga0070663_100197921
436 Ga0070681_10000788
437 Ga0070681_10002080
438 Ga0070681_10202731
439 Ga0070681_10222666
440 Ga0070681_10604494
441 Ga0070679_100004447
442 Ga0070679_100004702
443 Ga0070679_100031271
444 Ga0070679_101233328
445 Ga0070684_100004504
446 Ga0070697_100298783
447 Ga0068853_101824995
448 Ga0070672_100024454
449 Ga0068855_100085599
450 Ga0070664_100017876
451 Ga0070664_100096122
452 Ga0068857_100007789
453 Ga0068857_100018697
454 Ga0068857_100058666
455 Ga0068857_100095898
456 Ga0068854_100367275
457 Ga0068856_100048584
458 Ga0068856_100787955
459 Ga0068852_100575904
460 Ga0068852_101297264
461 Ga0068852_101494134
462 Ga0068864_100788581
463 Ga0068851_10031281
464 Ga0068870_10511199
465 Ga0068858_100163144
466 Ga0068860_100351056
467 Ga0081538_10145295
468 Ga0081539_10051956
469 Ga0097621_100005283
470 Ga0097621_100171622
471 Ga0097621_100764054
472 Ga0068871_100140226
473 Ga0075428_100079170
474 Ga0075428_100096757
475 Ga0075428_100200049
476 Ga0075431_100041725
477 Ga0075433_10055928
478 Ga0075433_10132891
479 Ga0075433_10436959
480 Ga0075434_100009299
481 Ga0075429_100660353
482 Ga0075429_101386879
483 Ga0068865_100004900
484 Ga0068865_100688666
485 Ga0075435_100145713
486 Ga0075435_100183325
487 Ga0075435_100758645
488 Ga0105240_10552378
489 Ga0111539_10014203
490 Ga0111539_10023066
491 Ga0111539_10116162
492 Ga0111539_10501311
493 Ga0105245_10002891
494 Ga0114129_10029192
495 Ga0114129_10123536
496 Ga0114129_10554775
497 Ga0105241_10002440
498 Ga0105241_10006883
499 Ga0105241_10613543
500 Ga0105237_10114918
501 Ga0105238_10000854
502 Ga0105239_10285555
503 Ga0154014_109623
504 Ga0157371_10098236
505 Ga0157371_10883982
506 Ga0157370_10172978
507 Ga0157370_10280151
508 Ga0157370_11061383
509 Ga0157369_10305810
510 Ga0157369_10573078
511 Ga0157374_10028158
512 Ga0157378_10008746
513 Ga0157372_10072726
514 Ga0157372_10077696
515 Ga0157372_10121098
516 Ga0157372_10163014
517 Ga0157372_10261887
518 Ga0157372_10428770
519 Ga0163163_10108781
520 Ga0163163_10371955
521 Ga0157380_11975621
522 Ga0197907_11054272
523 Ga0197907_11265178
524 Ga0206349_1357002
525 Ga0206355_1285187
526 Ga0206351_10191829
527 Ga0206352_10027153
528 Ga0154015_1244462
529 Ga0224712_10078212
530 Ga0207656_10004946
531 Ga0207680_10002319
532 Ga0207680_10248020
533 Ga0207680_10907861
534 Ga0207699_10004320
535 Ga0207645_10006165
536 Ga0207645_10378176
537 Ga0207705_10152261
538 Ga0207654_10013536
539 Ga0207707_10043322
540 Ga0207707_10058476
541 Ga0207707_10147377
542 Ga0207707_10288947
543 Ga0207707_10409837
544 Ga0207695_10036921
545 Ga0207671_10012551
546 Ga0207660_10000851
547 Ga0207660_10010530
548 Ga0207660_10049321
549 Ga0207657_10006566
550 Ga0207657_10043923
551 Ga0207649_10006468
552 Ga0207649_10017169
553 Ga0207652_10010749
554 Ga0207652_10044573
555 Ga0207694_10001849
556 Ga0207650_10009287
557 Ga0207650_10552253
558 Ga0207687_10001503
559 Ga0207700_10014634
560 Ga0207644_10148943
561 Ga0207644_10374730
562 Ga0207690_10012362
563 Ga0207709_10438406
564 Ga0207704_10002805
565 Ga0207704_10140831
566 Ga0207704_11258570
567 Ga0207665_10116729
568 Ga0207691_10011722
569 Ga0207689_10384743
570 Ga0207689_11121106
571 Ga0207661_10097559
572 Ga0207661_10150925
573 Ga0207679_10001636
574 Ga0207667_10181531
575 Ga0207667_11368525
576 Ga0207712_11016266
577 Ga0207640_10115292
578 Ga0207640_10137489
579 Ga0207640_10157536
580 Ga0207677_10057537
581 Ga0207677_10076783
582 Ga0207678_10001679
583 Ga0207702_10115655
584 Ga0207702_10222170
585 Ga0207702_10441388
586 Ga0207702_10476782
587 Ga0207702_10768160
588 Ga0207676_10190121
589 Ga0207676_10700134
590 Ga0207674_10000996
591 Ga0207674_10019930
592 Ga0207698_12158201
593 Ga0207428_10016872
594 Ga0207428_10159910
595 Ga0207428_10322930
596 Ga0268265_10038991
597 Ga0307408_100006586
598 Ga0307408_100008881
599 Ga0307408_100026263
600 Ga0307408_100161262
601 Ga0307408_100428078
602 Ga0307405_10020948
603 Ga0307405_10190274
604 Ga0307413_10004730
605 Ga0307413_10413827
606 Ga0307413_10544237
607 Ga0307410_10001160
608 Ga0307410_10008230
609 Ga0307410_10042000
610 Ga0307410_10162243
611 Ga0307410_10327012
612 Ga0307410_10334875
613 Ga0307410_10600412
614 Ga0307410_10666518
615 Ga0307406_10010453
616 Ga0307406_10153792
617 Ga0307406_10999932
618 Ga0307406_11190790
619 Ga0307407_10000322
620 Ga0307407_10048508
621 Ga0307412_10049585
622 Ga0307412_10153548
623 Ga0307412_10243067
624 Ga0307409_100006965
625 Ga0307409_100013547
626 Ga0307409_100021935
627 Ga0307409_100033115
628 Ga0307409_100344346
629 Ga0307409_100394420
630 Ga0307416_100010102
631 Ga0307416_100122909
632 Ga0307416_100231443
633 Ga0307416_100417298
634 Ga0307416_100440623
635 Ga0307416_100467510
636 Ga0307416_100641189
637 Ga0307414_10013959
638 Ga0307414_10094940
639 Ga0307414_10149183
640 Ga0307411_10004792
641 Ga0307411_10037180
642 Ga0307411_10040417
643 Ga0307411_10065675
644 Ga0307411_10258423
645 Ga0307411_10294287
646 Ga0307411_10330532
647 Ga0307411_11588033
648 Ga0307415_100003415
649 Ga0307415_100005014
650 Ga0307415_100061676
651 Ga0307415_100066491
652 Ga0373949_0000204
653 Ga0373923_0115746
654 Ga0373945_0272798
655 Ga0373953_0366739
656 Ga0373946_0449539
657 Ga0373935_0422110
658 Ga0373927_0216704
659 Ga0373927_0491337
660 Ga0373933_0627175
661 Ga0373947_0086469
662 Ga0373947_0869582
663 Ga0373937_0058913
664 Ga0373925_0831500
665 Ga0395905_0777679
666 Ga0436363_0456872
667 Ga0439439_0035676
668 Ga0439461_0087187
669 Ga0451789_0447351
670 Ga0451577_0006432
671 Ga0451577_0571655
672 Ga0466969_0008917
673 Ga0453683_0082577
674 Ga0466961_0490973
675 Ga0466963_0069942
676 Ga0453684_0062453
677 Ga0453684_0218320
678 Ga0453684_0557194
679 Ga0453684_0562564
680 Ga0453684_1056754
681 Ga0466959_0011359
682 Ga0466959_0350695
683 Ga0451576_0178437
684 Ga0451576_0404815
685 Ga0451576_1236181
686 Ga0451576_2196173
687 Ga0466958_0584464
688 Ga0466967_0066523
689 Ga0466967_1502624
690 Ga0495580_0122628
691 Ga0495630_0043615
692 Ga0495666_0093328
693 Ga0495652_0164766
694 Ga0495586_0037577
695 Ga0495587_0105025
696 Ga0495645_0000244
697 Ga0495667_0112527
698 Ga0495667_0415623
699 Ga0495635_0476695
700 Ga0495588_0174416
701 Ga0495599_0082649
702 Ga0495658_0229177
703 Ga0495649_0239186
704 Ga0495600_0042449
705 Ga0495604_0098072
706 Ga0495674_0096150
707 Ga0495680_0181899
708 Ga0495675_0007049
709 Ga0496103_0369307
710 Ga0496104_0466134
711 Ga0496105_0387399
712 Ga0496112_0039376
713 Ga0501336_024463
714 Ga0501031_0661054
715 Ga0501031_0772616
716 Ga0501033_0328270
717 Ga0501034_0047922
718 Ga0501034_0797049
719 Ga0501039_1004020
720 Ga0501040_0018192
721 Ga0501040_0492141
722 Ga0501040_0868213
723 Ga0501042_0020728
724 Ga0501046_0022007
725 Ga0501048_0286840
726 Ga0501068_0040868
727 Ga0501068_0087302
728 Ga0501069_0619337
729 Ga0501070_0277804
730 Ga0501070_1035047
731 Ga0501071_0099581
732 Ga0501071_0322682
733 Ga0501071_0782212
734 Ga0501072_0085824
735 Ga0501072_0341682
736 Ga0501075_0235452
737 Ga0501075_1053874
738 Ga0501076_0412186
739 Ga0501076_0632790
740 Ga0501077_0081800
741 Ga0501077_0684217
742 Ga0501217_162352
743 Ga0501223_087070
744 Ga0501238_044705
745 Ga0501079_0027313
746 Ga0501079_0540667
747 Ga0501080_0027231
748 Ga0501080_0080813
749 Ga0501081_0632332
750 Ga0501081_0830715
751 Ga0501241_031840
752 Ga0501035_0299137
753 Ga0501044_0035695
754 Ga0501045_0038532
755 nmdc:mga05p37_221162_c1
756 nmdc:mga05p37_939589_c1
757 nmdc:mga09592_205999_c1
758 nmdc:mga09592_419990_c1
759 nmdc:mga06r32_99862_c1
760 nmdc:mga08y16_10684_c1
761 nmdc:mga08y16_130541_c1
762 nmdc:mga08y16_16133_c1
763 nmdc:mga08y16_66114_c1
764 nmdc:mga08y16_869339_c1
765 nmdc:mga0n895_164642_c1
766 nmdc:mga0n895_30600_c1
767 nmdc:mga0n895_383979_c1
768 nmdc:mga0n895_496447_c1
769 nmdc:mga0rr50_225731_c1
770 nmdc:mga0rr50_226196_c1
771 nmdc:mga0rr50_565020_c1
772 nmdc:mga08x19_152761_c1
773 nmdc:mga0a205_205249_c1
774 nmdc:mga0a205_48696_c1
775 nmdc:mga0a205_87401_c1
776 nmdc:mga0a205_982_c3
777 Ga0495612_0055973
778 Ga0501084_1308433
779 Ga0590071_007022
780 Ga0590074_086767
781 Ga0590075_020605
782 Ga0501082_0032744
783 Ga0501082_1627847
784 Ga0530510_0273783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09990

DUF2231

Predicted membrane protein (DUF2231)

9

144

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f4m-assembly1.cif.gz_B p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.8363 13 62
1f4m-assembly1.cif.gz_A p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.8343 13 62
1f4m-assembly2.cif.gz_C p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.834 13 62
2chp-assembly1.cif.gz_A crystal structure of the dodecameric ferritin mrga from b. subtilis 168 0.8112 13 63
4zlw-assembly1.cif.gz_B crystal structure of the pmftn variant e130a soaked in iron (overnight) 0.7963 12 66
ID Description Score Start End Superfamily
1f4mF00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8394 13 62 1.10.287.230
1f4mB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8363 13 62 1.10.287.230
1f4mA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8343 13 62 1.10.287.230
1f4mC00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.834 13 62 1.10.287.230
af_Q9ZV02_127_216_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8164 17 64 1.20.1280.290
ID Description Score Start End GO Terms
AF-R6R8G6-F1-model_v4 Uncharacterized protein 0.9645 13 63 GO:0016020
AF-A0A5C1QTJ2-F1-model_v4 HEAT repeat domain-containing protein 0.9408 12 63
AF-A0A2V8PNF2-F1-model_v4 DUF2231 domain-containing protein 0.9135 1 84 GO:0016020
AF-A0A075G249-F1-model_v4 Uncharacterized protein 0.9053 12 72
AF-A0A2H6A784-F1-model_v4 Uncharacterized protein 0.9021 12 61 GO:0016020

Map