F432264

General Info

Members Datasets Scaffolds Average Seq Length
392 256 784 428

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100156720|Ga0068856_1001567202
Length 473
Sequence MAQTTTPQRLAAASERIGGPAGVLTDDQVRAFVQEQLAGADLDGRSVCVLVPDGTRSCPTPLLLGAVHEALHGRVSRLTVLVALGTHSKMGETELSRHLGYPAGGFAERYPDATVLNHEWWDPHTFASVGTIGADRIAELSEGRFHQAVEVRLNRAVVEHDVTLVVGPVFPHEVVGFSGGNKYFFPGVSSQEVINVSHWLGALITSASIIGTRGTTPVRALIDEAVALVPGDKLAFCVVVKSGSRALHSVAFGDPAAAWAAAADVAAEAHVRYLDAPVRRVLSMIPGMYHDIWTAAKGFYKVEPVVADGGQVVLYAPHVAEISSTHPEINEIGYHCRDYFVKQWDRFRVVPWGVLAHSTHLRGAGTYDETTGEERLRVTVTLATGIPQDRVRRVNLDYLDPAEVDPEAWAADPDTMVVPHAGEDLFRLRAGDQRHQRPPATAGRLHHTRRVTSHPVDGHGGTPDASPTGHGHP

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
154 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
155 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
156 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
159 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
243 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
244 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
248 2687453737 Frankia sp. BMG5.36 Isolate Nodule
249 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
250 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
251 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
252 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
253 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
254 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
255 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
256 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.19
Metatranscriptomes 0.51
Isolates 2.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0.77
Rhizoplane 6.38
Rhizosphere 86.99
Stem 0
Stem Tuber 0
Unclassified 1.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100156720 3300005614 Bacteria 2287
2 JGI24737J22298_10007145 3300001990 Bacteria 3781
3 JGI25406J46586_10002952 3300003203 Bacteria 8019
4 JGI25407J50210_10000545 3300003373 Bacteria 7580
5 JGI25407J50210_10008854 3300003373 Bacteria 2543
6 Ga0070658_10000175 3300005327 Bacteria 56109
7 Ga0070658_10052804 3300005327 Bacteria 3297
8 Ga0070683_100000800 3300005329 Bacteria 23282
9 Ga0070683_100064815 3300005329 Bacteria 3401
10 Ga0068869_100007626 3300005334 Bacteria 6928
11 Ga0068869_100008108 3300005334 Bacteria 6756
12 Ga0070680_100000975 3300005336 Bacteria 20283
13 Ga0070680_100002685 3300005336 Bacteria 13187
14 Ga0070680_100045113 3300005336 Unclassified 3583
15 Ga0070680_100121273 3300005336 Bacteria 2183
16 Ga0070682_100010341 3300005337 Bacteria 5293
17 Ga0068868_100014129 3300005338 Bacteria 5878
18 Ga0068868_100153870 3300005338 Bacteria 1895
19 Ga0070691_10015820 3300005341 Bacteria 3467
20 Ga0070661_100216489 3300005344 Unclassified 1468
21 Ga0070692_10001892 3300005345 Bacteria 7894
22 Ga0070668_100000773 3300005347 Bacteria 22048
23 Ga0070668_100071149 3300005347 Bacteria 2709
24 Ga0070675_100005945 3300005354 Bacteria 9349
25 Ga0070671_100001999 3300005355 Bacteria 15652
26 Ga0070688_100087494 3300005365 Bacteria 2029
27 Ga0070709_10015842 3300005434 Bacteria 4293
28 Ga0070700_100166791 3300005441 Bacteria 1521
29 Ga0070663_100011455 3300005455 Bacteria 5569
30 Ga0070662_100030656 3300005457 Bacteria 3766
31 Ga0070681_10000217 3300005458 Bacteria 45094
32 Ga0070681_10000925 3300005458 Bacteria 24771
33 Ga0070681_10073182 3300005458 Bacteria 3389
34 Ga0070685_10065303 3300005466 Bacteria 2141
35 Ga0070698_100184340 3300005471 Bacteria 2025
36 Ga0070679_100000210 3300005530 Bacteria 47766
37 Ga0070679_100002189 3300005530 Bacteria 17645
38 Ga0070679_100011151 3300005530 Bacteria 8560
39 Ga0070679_100044432 3300005530 Bacteria 4426
40 Ga0070684_100000512 3300005535 Bacteria 26647
41 Ga0070684_100013710 3300005535 Bacteria 6541
42 Ga0070684_100023543 3300005535 Bacteria 5154
43 Ga0070684_100039096 3300005535 Bacteria 4080
44 Ga0068853_100027692 3300005539 Bacteria 4763
45 Ga0068853_100035332 3300005539 Bacteria 4245
46 Ga0070672_100166171 3300005543 Bacteria 1833
47 Ga0070696_100008200 3300005546 Bacteria 6991
48 Ga0070693_100006176 3300005547 Bacteria 5804
49 Ga0070665_100129913 3300005548 Bacteria 2521
50 Ga0068855_100083793 3300005563 Bacteria 3693
51 Ga0068857_100009610 3300005577 Bacteria 8403
52 Ga0068857_100016350 3300005577 Bacteria 6500
53 Ga0068857_100041469 3300005577 Bacteria 4082
54 Ga0068854_100034952 3300005578 Bacteria 3515
55 Ga0068856_100001491 3300005614 Bacteria 24484
56 Ga0070702_100003147 3300005615 Bacteria 7315
57 Ga0070702_100033445 3300005615 Bacteria 2827
58 Ga0068852_100001554 3300005616 Bacteria 15598
59 Ga0068852_100030433 3300005616 Bacteria 4443
60 Ga0068852_100047863 3300005616 Bacteria 3651
61 Ga0068859_100092721 3300005617 Bacteria 3072
62 Ga0068859_100126508 3300005617 Bacteria 2625
63 Ga0068866_10031273 3300005718 Bacteria 2562
64 Ga0068861_100232967 3300005719 Bacteria 1563
65 Ga0068870_10001395 3300005840 Bacteria 9747
66 Ga0068863_100009181 3300005841 Bacteria 9647
67 Ga0068863_100139834 3300005841 Bacteria 2314
68 Ga0068858_100082565 3300005842 Bacteria 2987
69 Ga0068860_100060284 3300005843 Bacteria 3606
70 Ga0068860_100064997 3300005843 Bacteria 3465
71 Ga0068862_100006824 3300005844 Bacteria 9466
72 Ga0081455_10006458 3300005937 Bacteria 12564
73 Ga0081455_10135662 3300005937 Bacteria 1918
74 Ga0081538_10000478 3300005981 Bacteria 44979
75 Ga0081538_10001070 3300005981 Bacteria 29102
76 Ga0081538_10008238 3300005981 Bacteria 8883
77 Ga0081540_1016951 3300005983 Bacteria 4532
78 Ga0081539_10000419 3300005985 Bacteria 90362
79 Ga0081539_10001776 3300005985 Bacteria 34326
80 Ga0081539_10003681 3300005985 Bacteria 18365
81 Ga0070712_100023950 3300006175 Bacteria 4039
82 Ga0068871_100011700 3300006358 Bacteria 6443
83 Ga0075428_100186046 3300006844 Bacteria 2247
84 Ga0075430_100088413 3300006846 Bacteria 2593
85 Ga0075431_100059879 3300006847 Bacteria 3929
86 Ga0075431_100313072 3300006847 Bacteria 1584
87 Ga0075433_10076566 3300006852 Bacteria 2946
88 Ga0075429_100027545 3300006880 Bacteria 4933
89 Ga0075429_100066674 3300006880 Bacteria 3134
90 Ga0068865_100104416 3300006881 Bacteria 2080
91 Ga0075436_100017663 3300006914 Bacteria 4883
92 Ga0097620_100092721 3300006931 Bacteria 3072
93 Ga0097620_100126501 3300006931 Bacteria 2625
94 Ga0105240_10024748 3300009093 Bacteria 7907
95 Ga0111539_10073979 3300009094 Bacteria 4016
96 Ga0111539_10334138 3300009094 Bacteria 1764
97 Ga0105245_10003757 3300009098 Bacteria 13515
98 Ga0105245_10104164 3300009098 Bacteria 2630
99 Ga0105247_10047275 3300009101 Bacteria 2642
100 Ga0114129_10007810 3300009147 Bacteria 15218
101 Ga0105243_10038615 3300009148 Bacteria 3719
102 Ga0105241_10000274 3300009174 Bacteria 38434
103 Ga0105237_10028102 3300009545 Bacteria 5731
104 Ga0105238_10001362 3300009551 Bacteria 24547
105 Ga0105238_10254873 3300009551 Bacteria 1734
106 Ga0105239_10006978 3300010375 Bacteria 13013
107 Ga0105239_10016957 3300010375 Bacteria 8051
108 Ga0157371_10015691 3300013102 Bacteria 5671
109 Ga0157370_10013885 3300013104 Bacteria 8271
110 Ga0157370_10049626 3300013104 Bacteria 4016
111 Ga0157369_10015100 3300013105 Bacteria 8715
112 Ga0157369_10245186 3300013105 Bacteria 1871
113 Ga0157374_10326128 3300013296 Bacteria 1522
114 Ga0163162_10160564 3300013306 Bacteria 2369
115 Ga0157372_10003114 3300013307 Bacteria 17883
116 Ga0157372_10055468 3300013307 Bacteria 4426
117 Ga0163163_10013235 3300014325 Bacteria 7545
118 Ga0206354_11161181 3300020081 Bacteria 3341
119 Ga0224712_10075537 3300022467 Bacteria 1379
120 Ga0207697_10002960 3300025315 Bacteria 8574
121 Ga0207688_10001008 3300025901 Bacteria 14344
122 Ga0207688_10023798 3300025901 Bacteria 3357
123 Ga0207647_10018587 3300025904 Bacteria 4696
124 Ga0207647_10036360 3300025904 Bacteria 3129
125 Ga0207699_10019418 3300025906 Bacteria 3624
126 Ga0207643_10000333 3300025908 Bacteria 32287
127 Ga0207705_10000389 3300025909 Bacteria 38900
128 Ga0207707_10000023 3300025912 Bacteria 183706
129 Ga0207707_10001108 3300025912 Bacteria 25593
130 Ga0207707_10288529 3300025912 Bacteria 1420
131 Ga0207695_10004795 3300025913 Bacteria 18302
132 Ga0207660_10002082 3300025917 Bacteria 13255
133 Ga0207660_10003502 3300025917 Bacteria 10224
134 Ga0207657_10218654 3300025919 Bacteria 1527
135 Ga0207652_10000348 3300025921 Bacteria 47962
136 Ga0207652_10001647 3300025921 Bacteria 19598
137 Ga0207652_10211279 3300025921 Bacteria 1747
138 Ga0207694_10000893 3300025924 Bacteria 26464
139 Ga0207650_10010913 3300025925 Bacteria 6244
140 Ga0207659_10028109 3300025926 Bacteria 3818
141 Ga0207659_10028481 3300025926 Bacteria 3797
142 Ga0207687_10112274 3300025927 Bacteria 2025
143 Ga0207706_10006943 3300025933 Bacteria 10471
144 Ga0207706_10053648 3300025933 Bacteria 3558
145 Ga0207709_10037013 3300025935 Bacteria 2897
146 Ga0207709_10093412 3300025935 Bacteria 1972
147 Ga0207670_10120968 3300025936 Bacteria 1903
148 Ga0207691_10159115 3300025940 Bacteria 1982
149 Ga0207711_10027001 3300025941 Unclassified 4820
150 Ga0207689_10002391 3300025942 Bacteria 17506
151 Ga0207689_10023981 3300025942 Bacteria 5118
152 Ga0207661_10005109 3300025944 Bacteria 9214
153 Ga0207661_10144940 3300025944 Bacteria 2048
154 Ga0207679_10140409 3300025945 Bacteria 1952
155 Ga0207679_10163823 3300025945 Bacteria 1823
156 Ga0207667_10001907 3300025949 Bacteria 26176
157 Ga0207667_10154578 3300025949 Bacteria 2361
158 Ga0207651_10011764 3300025960 Bacteria 4912
159 Ga0207668_10081684 3300025972 Bacteria 2345
160 Ga0207640_10022547 3300025981 Bacteria 3771
161 Ga0207640_10054859 3300025981 Bacteria 2607
162 Ga0207677_10058376 3300026023 Bacteria 2656
163 Ga0207677_10153855 3300026023 Bacteria 1778
164 Ga0207678_10001322 3300026067 Bacteria 22883
165 Ga0207678_10003240 3300026067 Bacteria 14700
166 Ga0207678_10005490 3300026067 Bacteria 11334
167 Ga0207678_10069418 3300026067 Bacteria 3021
168 Ga0207708_10013988 3300026075 Bacteria 5994
169 Ga0207708_10019506 3300026075 Bacteria 5112
170 Ga0207702_10004657 3300026078 Bacteria 12115
171 Ga0207702_10008009 3300026078 Bacteria 8950
172 Ga0207702_10125041 3300026078 Bacteria 2307
173 Ga0207674_10000042 3300026116 Bacteria 126790
174 Ga0207674_10116930 3300026116 Bacteria 2637
175 Ga0207674_10128758 3300026116 Bacteria 2496
176 Ga0207674_10157789 3300026116 Bacteria 2224
177 Ga0207675_100005334 3300026118 Bacteria 12351
178 Ga0207675_100192499 3300026118 Bacteria 1956
179 Ga0207675_100207098 3300026118 Bacteria 1885
180 Ga0207683_10003493 3300026121 Bacteria 13713
181 Ga0207698_10000863 3300026142 Bacteria 17608
182 Ga0207428_10020441 3300027907 Bacteria 5624
183 Ga0268266_10098811 3300028379 Bacteria 2569
184 Ga0268265_10089533 3300028380 Bacteria 2455
185 Ga0268264_10104157 3300028381 Bacteria 2472
186 Ga0307517_10100570 3300028786 Bacteria 2282
187 Ga0307515_10002279 3300028794 Bacteria 42018
188 Ga0307515_10109306 3300028794 Bacteria 3248
189 Ga0307512_10006512 3300030522 Bacteria 11813
190 Ga0307512_10019535 3300030522 Bacteria 6164
191 Ga0265327_10000322 3300031251 Bacteria 91392
192 Ga0307513_10109828 3300031456 Bacteria 2755
193 Ga0307509_10040259 3300031507 Bacteria 5084
194 Ga0307509_10156291 3300031507 Bacteria 2186
195 Ga0307508_10006159 3300031616 Bacteria 11316
196 Ga0307508_10045567 3300031616 Bacteria 3918
197 Ga0307508_10049255 3300031616 Bacteria 3752
198 Ga0316576_10168980 3300031727 Bacteria 1650
199 Ga0307516_10000147 3300031730 Bacteria 86945
200 Ga0307516_10021411 3300031730 Bacteria 6652
201 Ga0307410_10166386 3300031852 Bacteria 1657
202 Ga0307409_100170977 3300031995 Bacteria 1913
203 Ga0307409_100213155 3300031995 Bacteria 1737
204 Ga0307416_100077756 3300032002 Bacteria 2788
205 Ga0307415_100110163 3300032126 Bacteria 2041
206 Ga0307415_100121522 3300032126 Bacteria 1959
207 Ga0373944_0001770 3300035089 Bacteria 5453
208 Ga0373936_0000202 3300035113 Bacteria 19842
209 Ga0373941_0006337 3300035115 Bacteria 2845
210 Ga0373945_0004421 3300035116 Bacteria 4464
211 Ga0373943_0001736 3300035170 Bacteria 9884
212 Ga0373946_0000989 3300035171 Bacteria 9737
213 Ga0373955_0107329 3300035172 Bacteria 1611
214 Ga0373942_0000014 3300035207 Bacteria 33319
215 Ga0373962_0002717 3300035242 Bacteria 4211
216 Ga0316574_0011606 3300035398 Bacteria 5015
217 Ga0373924_0005895 3300035410 Bacteria 4368
218 Ga0373935_0000231 3300035692 Bacteria 27343
219 Ga0373927_0001479 3300035695 Bacteria 17689
220 Ga0373933_0026968 3300035724 Bacteria 3305
221 Ga0373947_0001759 3300035725 Bacteria 13258
222 Ga0373937_0038551 3300036401 Bacteria 4354
223 Ga0373925_0001520 3300037068 Bacteria 19817
224 Ga0395899_0093712 3300037312 Bacteria 2174
225 Ga0395899_0130583 3300037312 Bacteria 1794
226 Ga0395900_0068218 3300037418 Bacteria 3654
227 Ga0395898_0126917 3300037466 Bacteria 2444
228 Ga0395901_0083259 3300038443 Bacteria 3344
229 Ga0395901_0084324 3300038443 Bacteria 3321
230 Ga0395901_0169356 3300038443 Bacteria 2292
231 Ga0439443_002921 3300042003 Bacteria 2102
232 Ga0439448_0000223 3300042005 Bacteria 12042
233 Ga0439450_000037 3300042008 Bacteria 11042
234 Ga0439463_000437 3300042016 Bacteria 11648
235 Ga0439463_001974 3300042016 Bacteria 5336
236 Ga0439463_014917 3300042016 Bacteria 1919
237 Ga0450900_000061 3300042136 Bacteria 5248
238 Ga0439464_0000697 3300042439 Bacteria 7277
239 Ga0439460_0000610 3300042461 Bacteria 7893
240 Ga0450916_005117 3300042530 Bacteria 1506
241 Ga0439440_0000040 3300042993 Bacteria 16382
242 Ga0466969_0086745 3300044656 Bacteria 1487
243 Ga0466961_0094884 3300044693 Bacteria 1882
244 Ga0466961_0140259 3300044693 Bacteria 1513
245 Ga0466963_0067140 3300044694 Bacteria 2406
246 Ga0453684_0000147 3300044712 Bacteria 308490
247 Ga0453684_0006191 3300044712 Bacteria 22950
248 Ga0453684_0044560 3300044712 Bacteria 5933
249 Ga0453684_0099289 3300044712 Bacteria 3566
250 Ga0466970_0034102 3300044765 Bacteria 2693
251 Ga0466957_0052455 3300044842 Bacteria 2483
252 Ga0466960_0005175 3300044901 Bacteria 5156
253 Ga0466960_0012204 3300044901 Bacteria 3619
254 Ga0466967_0004806 3300045976 Bacteria 9206
255 Ga0495641_0001649 3300046461 Bacteria 18728
256 Ga0495651_0002048 3300046462 Bacteria 15581
257 Ga0495653_0000977 3300046463 Bacteria 21977
258 Ga0495650_0010943 3300046471 Bacteria 5019
259 Ga0495582_0133072 3300046473 Bacteria 1406
260 Ga0495662_0020156 3300046476 Bacteria 3226
261 Ga0495664_0002708 3300046477 Bacteria 9525
262 Ga0495652_0009189 3300046529 Bacteria 8987
263 Ga0495665_0042480 3300046531 Bacteria 2420
264 Ga0495665_0067275 3300046531 Bacteria 1890
265 Ga0495587_0013904 3300046536 Bacteria 5054
266 Ga0495667_0009904 3300046559 Bacteria 6455
267 Ga0495667_0011374 3300046559 Bacteria 6024
268 Ga0495634_0026725 3300046642 Bacteria 4026
269 Ga0495634_0065940 3300046642 Unclassified 2398
270 Ga0495635_0004986 3300046663 Bacteria 9241
271 Ga0495635_0162298 3300046663 Bacteria 1521
272 Ga0495657_0001849 3300046675 Bacteria 18034
273 Ga0495657_0006416 3300046675 Bacteria 9206
274 Ga0495657_0166960 3300046675 Bacteria 1358
275 Ga0495599_0010528 3300046678 Bacteria 5659
276 Ga0495623_0013056 3300046679 Bacteria 5381
277 Ga0495658_0018691 3300046683 Unclassified 3607
278 Ga0495624_0002565 3300046690 Bacteria 13747
279 Ga0495600_0025350 3300046809 Bacteria 3822
280 Ga0495581_0001123 3300047315 Bacteria 14648
281 Ga0495674_0004918 3300047319 Bacteria 12849
282 Ga0495674_0079872 3300047319 Bacteria 2808
283 Ga0495676_0014627 3300047321 Bacteria 7018
284 Ga0495680_0001601 3300047322 Bacteria 24136
285 Ga0495680_0009112 3300047322 Bacteria 8957
286 Ga0495680_0127254 3300047322 Bacteria 1875
287 Ga0495675_0068350 3300047444 Bacteria 2244
288 Ga0495684_0005884 3300047471 Bacteria 9527
289 Ga0495684_0118832 3300047471 Unclassified 1992
290 Ga0495593_0058364 3300047673 Bacteria 2024
291 Ga0496101_0045663 3300048904 Bacteria 3139
292 Ga0496101_0149260 3300048904 Bacteria 1787
293 Ga0496102_0009716 3300048905 Bacteria 8271
294 Ga0496102_0093908 3300048905 Bacteria 2779
295 Ga0496102_0102302 3300048905 Bacteria 2663
296 Ga0496102_0172665 3300048905 Bacteria 2035
297 Ga0496102_0211465 3300048905 Bacteria 1828
298 Ga0496104_0001758 3300048907 Bacteria 18724
299 Ga0496104_0081152 3300048907 Bacteria 3093
300 Ga0496104_0130153 3300048907 Bacteria 2417
301 Ga0496105_0000734 3300048908 Bacteria 22250
302 Ga0496105_0162219 3300048908 Bacteria 1835
303 Ga0496106_0063088 3300048909 Bacteria 2815
304 Ga0496108_0000008 3300048911 Bacteria 294619
305 Ga0496108_0002569 3300048911 Bacteria 14541
306 Ga0496109_0000153 3300048912 Bacteria 67087
307 Ga0496109_0001794 3300048912 Bacteria 17842
308 Ga0496109_0028022 3300048912 Bacteria 5034
309 Ga0496110_0002255 3300048913 Bacteria 14423
310 Ga0496110_0011138 3300048913 Bacteria 7347
311 Ga0496110_0024530 3300048913 Bacteria 5140
312 Ga0496110_0123056 3300048913 Bacteria 2339
313 Ga0496111_0002912 3300048914 Bacteria 10457
314 Ga0496113_0006034 3300048916 Bacteria 7632
315 Ga0496114_0028320 3300048917 Bacteria 4596
316 Ga0496116_0000111 3300048919 Bacteria 182552
317 Ga0496117_0002043 3300048920 Bacteria 26723
318 Ga0496118_0001164 3300048921 Bacteria 40539
319 Ga0496119_0001278 3300048922 Bacteria 31212
320 Ga0496120_0038670 3300048923 Bacteria 2821
321 Ga0496121_0054809 3300048924 Bacteria 3328
322 Ga0496126_0000611 3300048929 Bacteria 67506
323 Ga0501031_0006311 3300049568 Bacteria 7730
324 Ga0501031_0076784 3300049568 Bacteria 2176
325 Ga0501032_0019703 3300049569 Bacteria 4713
326 Ga0501032_0152117 3300049569 Bacteria 1521
327 Ga0501033_0001065 3300049570 Bacteria 25048
328 Ga0501036_0003408 3300049572 Bacteria 12701
329 Ga0501036_0006595 3300049572 Bacteria 9429
330 Ga0501036_0235629 3300049572 Bacteria 1535
331 Ga0501037_0000647 3300049573 Bacteria 26905
332 Ga0501038_0000675 3300049574 Bacteria 30401
333 Ga0501038_0010777 3300049574 Bacteria 8355
334 Ga0501038_0045254 3300049574 Bacteria 3821
335 Ga0501039_0005436 3300049575 Bacteria 9633
336 Ga0501040_0125829 3300049576 Bacteria 1800
337 Ga0501043_0008970 3300049579 Bacteria 7870
338 Ga0501043_0045127 3300049579 Bacteria 3466
339 Ga0501046_0011800 3300049580 Bacteria 7457
340 Ga0501046_0026157 3300049580 Bacteria 4767
341 Ga0501047_0008033 3300049581 Bacteria 9953
342 Ga0501047_0039163 3300049581 Bacteria 4585
343 Ga0501048_0001516 3300049582 Bacteria 17599
344 Ga0501048_0039418 3300049582 Bacteria 3389
345 Ga0501048_0155054 3300049582 Bacteria 1620
346 Ga0501067_0012401 3300049583 Bacteria 4728
347 Ga0501068_0004995 3300049584 Bacteria 7223
348 Ga0501068_0038915 3300049584 Bacteria 2850
349 Ga0501069_0003893 3300049585 Bacteria 7695
350 Ga0501069_0052820 3300049585 Bacteria 2264
351 Ga0501070_0012090 3300049586 Bacteria 7285
352 Ga0501071_0002250 3300049587 Bacteria 11619
353 Ga0501072_0008394 3300049588 Bacteria 7841
354 Ga0501072_0123790 3300049588 Bacteria 2060
355 Ga0501073_0037218 3300049589 Bacteria 3456
356 Ga0501074_0002668 3300049590 Bacteria 12490
357 Ga0501074_0005329 3300049590 Bacteria 9246
358 Ga0501080_0004774 3300049742 Bacteria 12086
359 Ga0501080_0105716 3300049742 Bacteria 2610
360 Ga0501083_0030113 3300049744 Bacteria 3730
361 Ga0501035_0017869 3300049822 Bacteria 6541
362 Ga0501044_0014926 3300049823 Bacteria 8375
363 Ga0501044_0019894 3300049823 Bacteria 7170
364 Ga0501044_0143194 3300049823 Bacteria 2378
365 Ga0501044_0210346 3300049823 Bacteria 1899
366 nmdc:mga05p37_155290_c1 3300050507 Bacteria 2797
367 nmdc:mga05p37_1856_c1 3300050507 Bacteria 24601
368 nmdc:mga09592_25081_c1 3300050508 Bacteria 4933
369 nmdc:mga09592_38940_c1 3300050508 Bacteria 3992
370 nmdc:mga0qj67_144005_c1 3300050509 Bacteria 1932
371 nmdc:mga06r32_141548_c1 3300050510 Bacteria 2382
372 nmdc:mga06r32_24579_c1 3300050510 Bacteria 5595
373 nmdc:mga08y16_157192_c1 3300050511 Bacteria 2363
374 nmdc:mga08y16_15747_c1 3300050511 Bacteria 7952
375 nmdc:mga0a205_13622_c1 3300050515 Bacteria 7575
376 nmdc:mga0a205_6997_c1 3300050515 Bacteria 10191
377 Ga0495595_0002204 3300053084 Bacteria 7571
378 Ga0500651_0031925 3300053093 Bacteria 3318
379 Ga0500579_034448 3300053143 Bacteria 3230
380 Ga0501084_0006686 3300054114 Bacteria 9479
381 Ga0501084_0061704 3300054114 Bacteria 3139
382 Ga0466962_0020105 3300061719 Bacteria 3209
383 Ga0530510_0006438 3300061734 Bacteria 8179
384 2689962190 2687453737 Bacteria 11203906
385 2689992623 2687453743 Bacteria 8361025
386 2731907208 2731639228 Bacteria 4187555
387 2753264163 2751185782 Bacteria 11227053
388 2808874030 2808606365 Bacteria 4301966
389 2816427948 2816332119 Bacteria 8120218
390 2819745004 2818991472 Bacteria 10089953
391 2883821876 2883821847 Bacteria 5121194
392 8002785755 8002784119 Bacteria 9788632
393 Ga0068856_100156720
394 JGI24737J22298_10007145
395 JGI25406J46586_10002952
396 JGI25407J50210_10000545
397 JGI25407J50210_10008854
398 Ga0070658_10000175
399 Ga0070658_10052804
400 Ga0070683_100000800
401 Ga0070683_100064815
402 Ga0068869_100007626
403 Ga0068869_100008108
404 Ga0070680_100000975
405 Ga0070680_100002685
406 Ga0070680_100045113
407 Ga0070680_100121273
408 Ga0070682_100010341
409 Ga0068868_100014129
410 Ga0068868_100153870
411 Ga0070691_10015820
412 Ga0070661_100216489
413 Ga0070692_10001892
414 Ga0070668_100000773
415 Ga0070668_100071149
416 Ga0070675_100005945
417 Ga0070671_100001999
418 Ga0070688_100087494
419 Ga0070709_10015842
420 Ga0070700_100166791
421 Ga0070663_100011455
422 Ga0070662_100030656
423 Ga0070681_10000217
424 Ga0070681_10000925
425 Ga0070681_10073182
426 Ga0070685_10065303
427 Ga0070698_100184340
428 Ga0070679_100000210
429 Ga0070679_100002189
430 Ga0070679_100011151
431 Ga0070679_100044432
432 Ga0070684_100000512
433 Ga0070684_100013710
434 Ga0070684_100023543
435 Ga0070684_100039096
436 Ga0068853_100027692
437 Ga0068853_100035332
438 Ga0070672_100166171
439 Ga0070696_100008200
440 Ga0070693_100006176
441 Ga0070665_100129913
442 Ga0068855_100083793
443 Ga0068857_100009610
444 Ga0068857_100016350
445 Ga0068857_100041469
446 Ga0068854_100034952
447 Ga0068856_100001491
448 Ga0070702_100003147
449 Ga0070702_100033445
450 Ga0068852_100001554
451 Ga0068852_100030433
452 Ga0068852_100047863
453 Ga0068859_100092721
454 Ga0068859_100126508
455 Ga0068866_10031273
456 Ga0068861_100232967
457 Ga0068870_10001395
458 Ga0068863_100009181
459 Ga0068863_100139834
460 Ga0068858_100082565
461 Ga0068860_100060284
462 Ga0068860_100064997
463 Ga0068862_100006824
464 Ga0081455_10006458
465 Ga0081455_10135662
466 Ga0081538_10000478
467 Ga0081538_10001070
468 Ga0081538_10008238
469 Ga0081540_1016951
470 Ga0081539_10000419
471 Ga0081539_10001776
472 Ga0081539_10003681
473 Ga0070712_100023950
474 Ga0068871_100011700
475 Ga0075428_100186046
476 Ga0075430_100088413
477 Ga0075431_100059879
478 Ga0075431_100313072
479 Ga0075433_10076566
480 Ga0075429_100027545
481 Ga0075429_100066674
482 Ga0068865_100104416
483 Ga0075436_100017663
484 Ga0097620_100092721
485 Ga0097620_100126501
486 Ga0105240_10024748
487 Ga0111539_10073979
488 Ga0111539_10334138
489 Ga0105245_10003757
490 Ga0105245_10104164
491 Ga0105247_10047275
492 Ga0114129_10007810
493 Ga0105243_10038615
494 Ga0105241_10000274
495 Ga0105237_10028102
496 Ga0105238_10001362
497 Ga0105238_10254873
498 Ga0105239_10006978
499 Ga0105239_10016957
500 Ga0157371_10015691
501 Ga0157370_10013885
502 Ga0157370_10049626
503 Ga0157369_10015100
504 Ga0157369_10245186
505 Ga0157374_10326128
506 Ga0163162_10160564
507 Ga0157372_10003114
508 Ga0157372_10055468
509 Ga0163163_10013235
510 Ga0206354_11161181
511 Ga0224712_10075537
512 Ga0207697_10002960
513 Ga0207688_10001008
514 Ga0207688_10023798
515 Ga0207647_10018587
516 Ga0207647_10036360
517 Ga0207699_10019418
518 Ga0207643_10000333
519 Ga0207705_10000389
520 Ga0207707_10000023
521 Ga0207707_10001108
522 Ga0207707_10288529
523 Ga0207695_10004795
524 Ga0207660_10002082
525 Ga0207660_10003502
526 Ga0207657_10218654
527 Ga0207652_10000348
528 Ga0207652_10001647
529 Ga0207652_10211279
530 Ga0207694_10000893
531 Ga0207650_10010913
532 Ga0207659_10028109
533 Ga0207659_10028481
534 Ga0207687_10112274
535 Ga0207706_10006943
536 Ga0207706_10053648
537 Ga0207709_10037013
538 Ga0207709_10093412
539 Ga0207670_10120968
540 Ga0207691_10159115
541 Ga0207711_10027001
542 Ga0207689_10002391
543 Ga0207689_10023981
544 Ga0207661_10005109
545 Ga0207661_10144940
546 Ga0207679_10140409
547 Ga0207679_10163823
548 Ga0207667_10001907
549 Ga0207667_10154578
550 Ga0207651_10011764
551 Ga0207668_10081684
552 Ga0207640_10022547
553 Ga0207640_10054859
554 Ga0207677_10058376
555 Ga0207677_10153855
556 Ga0207678_10001322
557 Ga0207678_10003240
558 Ga0207678_10005490
559 Ga0207678_10069418
560 Ga0207708_10013988
561 Ga0207708_10019506
562 Ga0207702_10004657
563 Ga0207702_10008009
564 Ga0207702_10125041
565 Ga0207674_10000042
566 Ga0207674_10116930
567 Ga0207674_10128758
568 Ga0207674_10157789
569 Ga0207675_100005334
570 Ga0207675_100192499
571 Ga0207675_100207098
572 Ga0207683_10003493
573 Ga0207698_10000863
574 Ga0207428_10020441
575 Ga0268266_10098811
576 Ga0268265_10089533
577 Ga0268264_10104157
578 Ga0307517_10100570
579 Ga0307515_10002279
580 Ga0307515_10109306
581 Ga0307512_10006512
582 Ga0307512_10019535
583 Ga0265327_10000322
584 Ga0307513_10109828
585 Ga0307509_10040259
586 Ga0307509_10156291
587 Ga0307508_10006159
588 Ga0307508_10045567
589 Ga0307508_10049255
590 Ga0316576_10168980
591 Ga0307516_10000147
592 Ga0307516_10021411
593 Ga0307410_10166386
594 Ga0307409_100170977
595 Ga0307409_100213155
596 Ga0307416_100077756
597 Ga0307415_100110163
598 Ga0307415_100121522
599 Ga0373944_0001770
600 Ga0373936_0000202
601 Ga0373941_0006337
602 Ga0373945_0004421
603 Ga0373943_0001736
604 Ga0373946_0000989
605 Ga0373955_0107329
606 Ga0373942_0000014
607 Ga0373962_0002717
608 Ga0316574_0011606
609 Ga0373924_0005895
610 Ga0373935_0000231
611 Ga0373927_0001479
612 Ga0373933_0026968
613 Ga0373947_0001759
614 Ga0373937_0038551
615 Ga0373925_0001520
616 Ga0395899_0093712
617 Ga0395899_0130583
618 Ga0395900_0068218
619 Ga0395898_0126917
620 Ga0395901_0083259
621 Ga0395901_0084324
622 Ga0395901_0169356
623 Ga0439443_002921
624 Ga0439448_0000223
625 Ga0439450_000037
626 Ga0439463_000437
627 Ga0439463_001974
628 Ga0439463_014917
629 Ga0450900_000061
630 Ga0439464_0000697
631 Ga0439460_0000610
632 Ga0450916_005117
633 Ga0439440_0000040
634 Ga0466969_0086745
635 Ga0466961_0094884
636 Ga0466961_0140259
637 Ga0466963_0067140
638 Ga0453684_0000147
639 Ga0453684_0006191
640 Ga0453684_0044560
641 Ga0453684_0099289
642 Ga0466970_0034102
643 Ga0466957_0052455
644 Ga0466960_0005175
645 Ga0466960_0012204
646 Ga0466967_0004806
647 Ga0495641_0001649
648 Ga0495651_0002048
649 Ga0495653_0000977
650 Ga0495650_0010943
651 Ga0495582_0133072
652 Ga0495662_0020156
653 Ga0495664_0002708
654 Ga0495652_0009189
655 Ga0495665_0042480
656 Ga0495665_0067275
657 Ga0495587_0013904
658 Ga0495667_0009904
659 Ga0495667_0011374
660 Ga0495634_0026725
661 Ga0495634_0065940
662 Ga0495635_0004986
663 Ga0495635_0162298
664 Ga0495657_0001849
665 Ga0495657_0006416
666 Ga0495657_0166960
667 Ga0495599_0010528
668 Ga0495623_0013056
669 Ga0495658_0018691
670 Ga0495624_0002565
671 Ga0495600_0025350
672 Ga0495581_0001123
673 Ga0495674_0004918
674 Ga0495674_0079872
675 Ga0495676_0014627
676 Ga0495680_0001601
677 Ga0495680_0009112
678 Ga0495680_0127254
679 Ga0495675_0068350
680 Ga0495684_0005884
681 Ga0495684_0118832
682 Ga0495593_0058364
683 Ga0496101_0045663
684 Ga0496101_0149260
685 Ga0496102_0009716
686 Ga0496102_0093908
687 Ga0496102_0102302
688 Ga0496102_0172665
689 Ga0496102_0211465
690 Ga0496104_0001758
691 Ga0496104_0081152
692 Ga0496104_0130153
693 Ga0496105_0000734
694 Ga0496105_0162219
695 Ga0496106_0063088
696 Ga0496108_0000008
697 Ga0496108_0002569
698 Ga0496109_0000153
699 Ga0496109_0001794
700 Ga0496109_0028022
701 Ga0496110_0002255
702 Ga0496110_0011138
703 Ga0496110_0024530
704 Ga0496110_0123056
705 Ga0496111_0002912
706 Ga0496113_0006034
707 Ga0496114_0028320
708 Ga0496116_0000111
709 Ga0496117_0002043
710 Ga0496118_0001164
711 Ga0496119_0001278
712 Ga0496120_0038670
713 Ga0496121_0054809
714 Ga0496126_0000611
715 Ga0501031_0006311
716 Ga0501031_0076784
717 Ga0501032_0019703
718 Ga0501032_0152117
719 Ga0501033_0001065
720 Ga0501036_0003408
721 Ga0501036_0006595
722 Ga0501036_0235629
723 Ga0501037_0000647
724 Ga0501038_0000675
725 Ga0501038_0010777
726 Ga0501038_0045254
727 Ga0501039_0005436
728 Ga0501040_0125829
729 Ga0501043_0008970
730 Ga0501043_0045127
731 Ga0501046_0011800
732 Ga0501046_0026157
733 Ga0501047_0008033
734 Ga0501047_0039163
735 Ga0501048_0001516
736 Ga0501048_0039418
737 Ga0501048_0155054
738 Ga0501067_0012401
739 Ga0501068_0004995
740 Ga0501068_0038915
741 Ga0501069_0003893
742 Ga0501069_0052820
743 Ga0501070_0012090
744 Ga0501071_0002250
745 Ga0501072_0008394
746 Ga0501072_0123790
747 Ga0501073_0037218
748 Ga0501074_0002668
749 Ga0501074_0005329
750 Ga0501080_0004774
751 Ga0501080_0105716
752 Ga0501083_0030113
753 Ga0501035_0017869
754 Ga0501044_0014926
755 Ga0501044_0019894
756 Ga0501044_0143194
757 Ga0501044_0210346
758 nmdc:mga05p37_155290_c1
759 nmdc:mga05p37_1856_c1
760 nmdc:mga09592_25081_c1
761 nmdc:mga09592_38940_c1
762 nmdc:mga0qj67_144005_c1
763 nmdc:mga06r32_141548_c1
764 nmdc:mga06r32_24579_c1
765 nmdc:mga08y16_157192_c1
766 nmdc:mga08y16_15747_c1
767 nmdc:mga0a205_13622_c1
768 nmdc:mga0a205_6997_c1
769 Ga0495595_0002204
770 Ga0500651_0031925
771 Ga0500579_034448
772 Ga0501084_0006686
773 Ga0501084_0061704
774 Ga0466962_0020105
775 Ga0530510_0006438
776 2689962190
777 2689992623
778 2731907208
779 2753264163
780 2808874030
781 2816427948
782 2819745004
783 2883821876
784 8002785755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09861

Lar_N

Lactate racemase N-terminal domain

31

211

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nar-assembly1.cif.gz_A crystal structure of the q9wys3 protein from thermotoga maritima. northeast structural genomics consortium target vr152 0.9215 7 407
4nar-assembly1.cif.gz_A crystal structure of the q9wys3 protein from thermotoga maritima. northeast structural genomics consortium target vr152 0.9042 7 407
8ezf-assembly1.cif.gz_B a tethered niacin-derived pincer complex with a nickel-carbon or sulfite-carbon bond in lactate racemase r98a/r100a variant 0.7758 14 408
2yjg-assembly1.cif.gz_B structure of the lactate racemase apoprotein from thermoanaerobacterium thermosaccharolyticum 0.768 15 405
8ezi-assembly1.cif.gz_B a tethered niacin-derived pincer complex with a nickel-carbon bond in lactate racemase r98a/r100a variant modeled with separated sulfite and npn 0.7636 14 407
ID Description Score Start End Superfamily
4narA02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;LarA, C-terminal domain 0.9134 249 407 3.90.226.30
4narA02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;LarA, C-terminal domain 0.9025 249 407 3.90.226.30
4narA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LarA, N-terminal domain 0.8549 7 247 3.40.50.11440
4narA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LarA, N-terminal domain 0.82 7 247 3.40.50.11440
4ynsA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LarA, N-terminal domain 0.8005 14 247 3.40.50.11440
ID Description Score Start End GO Terms
AF-A0A4R0J3J1-F1-model_v4 DUF2088 domain-containing protein 0.9953 1 407 GO:0050043
AF-A0A4U3LKQ4-F1-model_v4 DUF2088 domain-containing protein 0.9945 20 407 GO:0050043
AF-A0A1S1RLX3-F1-model_v4 deleted 0.9917 7 407
AF-A0A4R0J3J1-F1-model_v4 DUF2088 domain-containing protein 0.9904 1 407 GO:0050043
AF-A0A4U3LKQ4-F1-model_v4 DUF2088 domain-containing protein 0.9894 20 407 GO:0050043

Map