F432236
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 392 | 244 | 392 | 278 |
Family's Representative Sequence
| Representative Sequence | 3300005337|Ga0070682_100269135|Ga0070682_1002691352 |
| Length | 300 |
| Sequence | MKLGSHDVGLERPFFLIAGPCVIESATLTQEIAGRLREITQRLRIPFVFKASYDKANRSSRASYRGPGLEGGLKVLQEVRKQFGVPVLTDVHEDTPLAEVAAVVDVLQTPAFLCRQTNFIVSAASQGKPVNIKKGQFLSPWEMRNVVDKARSTGNDAILVCERGFSFGYNNLVSDMRSLSIMRETDCPVVFDATHSVQLPGGKGTASGGQREFIPVLARAAVASGVSGLFMETHPEPSKALSDGPNAWPLDRMEPLLITLKQLDEAVKARPLEETLLRASPELLTGFARGRASPLREAKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 137 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 139 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 140 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 141 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 142 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 143 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 144 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 145 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 146 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 149 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 150 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 151 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 155 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 156 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 157 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 158 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 164 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 165 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 169 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 172 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 173 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 174 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 175 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 176 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 177 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 178 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 179 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 180 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 181 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 182 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 183 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 184 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 185 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 186 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 189 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 190 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 191 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 203 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 204 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 205 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 208 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 209 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 210 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 211 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 212 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 240 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 241 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 242 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 243 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.96 |
| Metatranscriptomes | 2.04 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.28 |
| Nodule | 0 |
| Rhizoplane | 4.08 |
| Rhizosphere | 90.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2581737 | 2162886007 | Bacteria | 1938 |
| 2 | JGI25406J46586_10004938 | 3300003203 | Bacteria | 6194 |
| 3 | Ga0065704_10001819 | 3300005289 | Bacteria | 12043 |
| 4 | Ga0065707_10083189 | 3300005295 | Bacteria | 10076 |
| 5 | Ga0070658_10045812 | 3300005327 | Bacteria | 3537 |
| 6 | Ga0070658_10459953 | 3300005327 | Bacteria | 1097 |
| 7 | Ga0070676_10039971 | 3300005328 | Bacteria | 2714 |
| 8 | Ga0070683_100038299 | 3300005329 | Bacteria | 4394 |
| 9 | Ga0070690_100014489 | 3300005330 | Bacteria | 4678 |
| 10 | Ga0070690_100045953 | 3300005330 | Bacteria | 2776 |
| 11 | Ga0070670_100175666 | 3300005331 | Bacteria | 1859 |
| 12 | Ga0070677_10075904 | 3300005333 | Bacteria | 1426 |
| 13 | Ga0070666_10004512 | 3300005335 | Bacteria | 8484 |
| 14 | Ga0070666_10063356 | 3300005335 | Bacteria | 2506 |
| 15 | Ga0070680_100042941 | 3300005336 | Bacteria | 3670 |
| 16 | Ga0070680_100045046 | 3300005336 | Bacteria | 3585 |
| 17 | Ga0070680_100192095 | 3300005336 | Bacteria | 1720 |
| 18 | Ga0070682_100269135 | 3300005337 | Bacteria | 1237 |
| 19 | Ga0068868_100003680 | 3300005338 | Bacteria | 10710 |
| 20 | Ga0068868_100075678 | 3300005338 | Bacteria | 2691 |
| 21 | Ga0070668_100023812 | 3300005347 | Bacteria | 4635 |
| 22 | Ga0070669_100037541 | 3300005353 | Bacteria | 3514 |
| 23 | Ga0070675_100021095 | 3300005354 | Bacteria | 5202 |
| 24 | Ga0070671_100009266 | 3300005355 | Bacteria | 7909 |
| 25 | Ga0070671_100060269 | 3300005355 | Bacteria | 3160 |
| 26 | Ga0070674_100021852 | 3300005356 | Bacteria | 4117 |
| 27 | Ga0070673_100055271 | 3300005364 | Bacteria | 3127 |
| 28 | Ga0070667_100000068 | 3300005367 | Bacteria | 127663 |
| 29 | Ga0070667_100003283 | 3300005367 | Bacteria | 13816 |
| 30 | Ga0070667_100027990 | 3300005367 | Bacteria | 4690 |
| 31 | Ga0070709_10012650 | 3300005434 | Bacteria | 4727 |
| 32 | Ga0070709_10174699 | 3300005434 | Bacteria | 1504 |
| 33 | Ga0070713_100000837 | 3300005436 | Bacteria | 19662 |
| 34 | Ga0070713_100106649 | 3300005436 | Bacteria | 2436 |
| 35 | Ga0070711_100000311 | 3300005439 | Bacteria | 25257 |
| 36 | Ga0070678_100005775 | 3300005456 | Bacteria | 7198 |
| 37 | Ga0070662_100011141 | 3300005457 | Bacteria | 5923 |
| 38 | Ga0070681_10004492 | 3300005458 | Bacteria | 13307 |
| 39 | Ga0070681_10082236 | 3300005458 | Bacteria | 3175 |
| 40 | Ga0070681_10086684 | 3300005458 | Bacteria | 3084 |
| 41 | Ga0070681_10105802 | 3300005458 | Bacteria | 2756 |
| 42 | Ga0070681_10371575 | 3300005458 | Bacteria | 1340 |
| 43 | Ga0070707_100428808 | 3300005468 | Bacteria | 1283 |
| 44 | Ga0070699_100129987 | 3300005518 | Bacteria | 2220 |
| 45 | Ga0070679_100007158 | 3300005530 | Bacteria | 10412 |
| 46 | Ga0070679_100072577 | 3300005530 | Bacteria | 3434 |
| 47 | Ga0070679_100140989 | 3300005530 | Bacteria | 2390 |
| 48 | Ga0070684_100199307 | 3300005535 | Bacteria | 1823 |
| 49 | Ga0068853_100176870 | 3300005539 | Bacteria | 1933 |
| 50 | Ga0070672_100019844 | 3300005543 | Bacteria | 4890 |
| 51 | Ga0070686_100191625 | 3300005544 | Bacteria | 1459 |
| 52 | Ga0070665_100000697 | 3300005548 | Bacteria | 44802 |
| 53 | Ga0070665_100006033 | 3300005548 | Bacteria | 12380 |
| 54 | Ga0070665_100015281 | 3300005548 | Bacteria | 7707 |
| 55 | Ga0068855_100046131 | 3300005563 | Bacteria | 5152 |
| 56 | Ga0068855_100201950 | 3300005563 | Bacteria | 2237 |
| 57 | Ga0068855_100223878 | 3300005563 | Bacteria | 2108 |
| 58 | Ga0068855_100268023 | 3300005563 | Bacteria | 1900 |
| 59 | Ga0068854_100059252 | 3300005578 | Bacteria | 2766 |
| 60 | Ga0068856_100067009 | 3300005614 | Bacteria | 3548 |
| 61 | Ga0068856_100318342 | 3300005614 | Bacteria | 1573 |
| 62 | Ga0068852_100072462 | 3300005616 | Bacteria | 3028 |
| 63 | Ga0068859_100044796 | 3300005617 | Bacteria | 4445 |
| 64 | Ga0068864_100396941 | 3300005618 | Bacteria | 1310 |
| 65 | Ga0068861_100005711 | 3300005719 | Bacteria | 8435 |
| 66 | Ga0068851_10101836 | 3300005834 | Bacteria | 1525 |
| 67 | Ga0068863_100016691 | 3300005841 | Bacteria | 7045 |
| 68 | Ga0068863_100027766 | 3300005841 | Bacteria | 5401 |
| 69 | Ga0068858_100007259 | 3300005842 | Bacteria | 10736 |
| 70 | Ga0068858_100093487 | 3300005842 | Bacteria | 2799 |
| 71 | Ga0068860_100022026 | 3300005843 | Bacteria | 6168 |
| 72 | Ga0068860_100056242 | 3300005843 | Bacteria | 3741 |
| 73 | Ga0068862_100007821 | 3300005844 | Bacteria | 8842 |
| 74 | Ga0081539_10000004 | 3300005985 | Bacteria | 555600 |
| 75 | Ga0070716_100018840 | 3300006173 | Bacteria | 3600 |
| 76 | Ga0070712_100004864 | 3300006175 | Bacteria | 8304 |
| 77 | Ga0070712_100094819 | 3300006175 | Bacteria | 2194 |
| 78 | Ga0075366_10023873 | 3300006195 | Bacteria | 3563 |
| 79 | Ga0097621_100024685 | 3300006237 | Bacteria | 4697 |
| 80 | Ga0097621_100051404 | 3300006237 | Bacteria | 3354 |
| 81 | Ga0097621_100180103 | 3300006237 | Bacteria | 1826 |
| 82 | Ga0068871_100033543 | 3300006358 | Bacteria | 4066 |
| 83 | Ga0075428_100023966 | 3300006844 | Bacteria | 6753 |
| 84 | Ga0075430_100022271 | 3300006846 | Bacteria | 5389 |
| 85 | Ga0075431_100038305 | 3300006847 | Bacteria | 4936 |
| 86 | Ga0068865_100017596 | 3300006881 | Bacteria | 4599 |
| 87 | Ga0097620_100044797 | 3300006931 | Bacteria | 4445 |
| 88 | Ga0105240_10003535 | 3300009093 | Bacteria | 24236 |
| 89 | Ga0105240_10035089 | 3300009093 | Bacteria | 6467 |
| 90 | Ga0105240_10035623 | 3300009093 | Bacteria | 6412 |
| 91 | Ga0105240_10075495 | 3300009093 | Bacteria | 4157 |
| 92 | Ga0105240_10155882 | 3300009093 | Bacteria | 2716 |
| 93 | Ga0105240_10161244 | 3300009093 | Bacteria | 2663 |
| 94 | Ga0105240_10505627 | 3300009093 | Bacteria | 1343 |
| 95 | Ga0111539_10007684 | 3300009094 | Bacteria | 13772 |
| 96 | Ga0105245_10191836 | 3300009098 | Bacteria | 1957 |
| 97 | Ga0105247_10081013 | 3300009101 | Bacteria | 2046 |
| 98 | Ga0114129_10146449 | 3300009147 | Bacteria | 3235 |
| 99 | Ga0105243_10370448 | 3300009148 | Bacteria | 1321 |
| 100 | Ga0105241_10049924 | 3300009174 | Bacteria | 3188 |
| 101 | Ga0105242_10001990 | 3300009176 | Bacteria | 16074 |
| 102 | Ga0105242_10018258 | 3300009176 | Bacteria | 5482 |
| 103 | Ga0105242_10171464 | 3300009176 | Bacteria | 1907 |
| 104 | Ga0105248_10006124 | 3300009177 | Bacteria | 13196 |
| 105 | Ga0105248_10053010 | 3300009177 | Bacteria | 4552 |
| 106 | Ga0105237_10211678 | 3300009545 | Bacteria | 1938 |
| 107 | Ga0105237_10414697 | 3300009545 | Bacteria | 1352 |
| 108 | Ga0105238_10002167 | 3300009551 | Bacteria | 19836 |
| 109 | Ga0105238_10068178 | 3300009551 | Bacteria | 3559 |
| 110 | Ga0105238_10303847 | 3300009551 | Bacteria | 1579 |
| 111 | Ga0105238_10340727 | 3300009551 | Bacteria | 1487 |
| 112 | Ga0105238_10414646 | 3300009551 | Bacteria | 1341 |
| 113 | Ga0105030_107476 | 3300009987 | Bacteria | 929 |
| 114 | Ga0105239_10039150 | 3300010375 | Bacteria | 5194 |
| 115 | Ga0105239_10067733 | 3300010375 | Bacteria | 3922 |
| 116 | Ga0105239_10772253 | 3300010375 | Bacteria | 1100 |
| 117 | Ga0157370_10004311 | 3300013104 | Bacteria | 16348 |
| 118 | Ga0157369_10064073 | 3300013105 | Bacteria | 3959 |
| 119 | Ga0157369_10129511 | 3300013105 | Bacteria | 2674 |
| 120 | Ga0157374_10003025 | 3300013296 | Bacteria | 14090 |
| 121 | Ga0157374_10008461 | 3300013296 | Bacteria | 8798 |
| 122 | Ga0157374_10617729 | 3300013296 | Bacteria | 1094 |
| 123 | Ga0157378_10017897 | 3300013297 | Bacteria | 6220 |
| 124 | Ga0157378_10031781 | 3300013297 | Bacteria | 4663 |
| 125 | Ga0157378_10046063 | 3300013297 | Bacteria | 3877 |
| 126 | Ga0163162_10009016 | 3300013306 | Bacteria | 9697 |
| 127 | Ga0163162_10034120 | 3300013306 | Bacteria | 5062 |
| 128 | Ga0157372_10052964 | 3300013307 | Bacteria | 4521 |
| 129 | Ga0157375_10015518 | 3300013308 | Bacteria | 6821 |
| 130 | Ga0163163_10101457 | 3300014325 | Bacteria | 2900 |
| 131 | Ga0163163_10126029 | 3300014325 | Bacteria | 2599 |
| 132 | Ga0163163_10335894 | 3300014325 | Bacteria | 1566 |
| 133 | Ga0157380_10003144 | 3300014326 | Bacteria | 11267 |
| 134 | Ga0157380_10062123 | 3300014326 | Bacteria | 2991 |
| 135 | Ga0157380_10229970 | 3300014326 | Bacteria | 1665 |
| 136 | Ga0157379_10002563 | 3300014968 | Bacteria | 15248 |
| 137 | Ga0157379_10039845 | 3300014968 | Bacteria | 4192 |
| 138 | Ga0157379_10077741 | 3300014968 | Bacteria | 2971 |
| 139 | Ga0157379_10231950 | 3300014968 | Bacteria | 1673 |
| 140 | Ga0157379_10303226 | 3300014968 | Bacteria | 1456 |
| 141 | Ga0157376_10000400 | 3300014969 | Bacteria | 28297 |
| 142 | Ga0163161_10091437 | 3300017792 | Bacteria | 2252 |
| 143 | Ga0213876_10026429 | 3300021384 | Bacteria | 3061 |
| 144 | Ga0207656_10155417 | 3300025321 | Bacteria | 1085 |
| 145 | Ga0207682_10078364 | 3300025893 | Bacteria | 1412 |
| 146 | Ga0207692_10036363 | 3300025898 | Bacteria | 2400 |
| 147 | Ga0207680_10014471 | 3300025903 | Bacteria | 4085 |
| 148 | Ga0207680_10048539 | 3300025903 | Bacteria | 2523 |
| 149 | Ga0207680_10071238 | 3300025903 | Bacteria | 2154 |
| 150 | Ga0207699_10004969 | 3300025906 | Bacteria | 6360 |
| 151 | Ga0207645_10000328 | 3300025907 | Bacteria | 39622 |
| 152 | Ga0207643_10155583 | 3300025908 | Bacteria | 1373 |
| 153 | Ga0207654_10099383 | 3300025911 | Bacteria | 1790 |
| 154 | Ga0207707_10004603 | 3300025912 | Bacteria | 12114 |
| 155 | Ga0207707_10034444 | 3300025912 | Bacteria | 4431 |
| 156 | Ga0207707_10092523 | 3300025912 | Bacteria | 2642 |
| 157 | Ga0207695_10019870 | 3300025913 | Bacteria | 7718 |
| 158 | Ga0207695_10027990 | 3300025913 | Bacteria | 6264 |
| 159 | Ga0207695_10046321 | 3300025913 | Bacteria | 4610 |
| 160 | Ga0207695_10046530 | 3300025913 | Bacteria | 4599 |
| 161 | Ga0207695_10067027 | 3300025913 | Bacteria | 3684 |
| 162 | Ga0207695_10148399 | 3300025913 | Bacteria | 2286 |
| 163 | Ga0207695_10265249 | 3300025913 | Bacteria | 1614 |
| 164 | Ga0207695_10321300 | 3300025913 | Bacteria | 1437 |
| 165 | Ga0207671_10025320 | 3300025914 | Bacteria | 4457 |
| 166 | Ga0207671_10059443 | 3300025914 | Bacteria | 2834 |
| 167 | Ga0207693_10000462 | 3300025915 | Bacteria | 37190 |
| 168 | Ga0207693_10154989 | 3300025915 | Bacteria | 1802 |
| 169 | Ga0207663_10058791 | 3300025916 | Bacteria | 2428 |
| 170 | Ga0207660_10003894 | 3300025917 | Bacteria | 9727 |
| 171 | Ga0207660_10107441 | 3300025917 | Bacteria | 2094 |
| 172 | Ga0207660_10277379 | 3300025917 | Bacteria | 1329 |
| 173 | Ga0207652_10033769 | 3300025921 | Bacteria | 4309 |
| 174 | Ga0207694_10006259 | 3300025924 | Bacteria | 9089 |
| 175 | Ga0207694_10016134 | 3300025924 | Bacteria | 5637 |
| 176 | Ga0207694_10042880 | 3300025924 | Bacteria | 3491 |
| 177 | Ga0207694_10086640 | 3300025924 | Bacteria | 2466 |
| 178 | Ga0207694_10291891 | 3300025924 | Bacteria | 1341 |
| 179 | Ga0207694_10350463 | 3300025924 | Bacteria | 1222 |
| 180 | Ga0207687_10220634 | 3300025927 | Bacteria | 1493 |
| 181 | Ga0207700_10023287 | 3300025928 | Bacteria | 4266 |
| 182 | Ga0207700_10123203 | 3300025928 | Bacteria | 2105 |
| 183 | Ga0207700_10135503 | 3300025928 | Bacteria | 2017 |
| 184 | Ga0207644_10132680 | 3300025931 | Bacteria | 1909 |
| 185 | Ga0207706_10000476 | 3300025933 | Bacteria | 42949 |
| 186 | Ga0207686_10103693 | 3300025934 | Bacteria | 1904 |
| 187 | Ga0207709_10258366 | 3300025935 | Bacteria | 1276 |
| 188 | Ga0207704_10178006 | 3300025938 | Bacteria | 1533 |
| 189 | Ga0207665_10039754 | 3300025939 | Bacteria | 3136 |
| 190 | Ga0207691_10000632 | 3300025940 | Bacteria | 34796 |
| 191 | Ga0207691_10170805 | 3300025940 | Bacteria | 1904 |
| 192 | Ga0207711_10043186 | 3300025941 | Bacteria | 3844 |
| 193 | Ga0207711_10066646 | 3300025941 | Bacteria | 3114 |
| 194 | Ga0207661_10413930 | 3300025944 | Bacteria | 1224 |
| 195 | Ga0207667_10000859 | 3300025949 | Bacteria | 39082 |
| 196 | Ga0207667_10195662 | 3300025949 | Bacteria | 2074 |
| 197 | Ga0207651_10078361 | 3300025960 | Bacteria | 2370 |
| 198 | Ga0207712_10116355 | 3300025961 | Bacteria | 2014 |
| 199 | Ga0207668_10046217 | 3300025972 | Bacteria | 2974 |
| 200 | Ga0207658_10000325 | 3300025986 | Bacteria | 48105 |
| 201 | Ga0207658_10007697 | 3300025986 | Bacteria | 7336 |
| 202 | Ga0207658_10368306 | 3300025986 | Bacteria | 1255 |
| 203 | Ga0207677_10050859 | 3300026023 | Bacteria | 2806 |
| 204 | Ga0207677_10146147 | 3300026023 | Bacteria | 1817 |
| 205 | Ga0207703_10000663 | 3300026035 | Bacteria | 34425 |
| 206 | Ga0207703_10022060 | 3300026035 | Bacteria | 4989 |
| 207 | Ga0207703_10056609 | 3300026035 | Bacteria | 3194 |
| 208 | Ga0207702_10198005 | 3300026078 | Bacteria | 1860 |
| 209 | Ga0207702_10212113 | 3300026078 | Bacteria | 1801 |
| 210 | Ga0207641_10009947 | 3300026088 | Bacteria | 7827 |
| 211 | Ga0207648_10000334 | 3300026089 | Bacteria | 51629 |
| 212 | Ga0207676_10354375 | 3300026095 | Bacteria | 1358 |
| 213 | Ga0207676_10417725 | 3300026095 | Bacteria | 1257 |
| 214 | Ga0207674_10290989 | 3300026116 | Bacteria | 1582 |
| 215 | Ga0207675_100000130 | 3300026118 | Bacteria | 63098 |
| 216 | Ga0207683_10016700 | 3300026121 | Bacteria | 6246 |
| 217 | Ga0209999_1013918 | 3300027543 | Bacteria | 1458 |
| 218 | Ga0209982_1003044 | 3300027552 | Bacteria | 2373 |
| 219 | Ga0209983_1000042 | 3300027665 | Bacteria | 17996 |
| 220 | Ga0209998_10000179 | 3300027717 | Bacteria | 23068 |
| 221 | Ga0209974_10006986 | 3300027876 | Bacteria | 3908 |
| 222 | Ga0207428_10215614 | 3300027907 | Bacteria | 1441 |
| 223 | Ga0268266_10000834 | 3300028379 | Bacteria | 40263 |
| 224 | Ga0268266_10151126 | 3300028379 | Bacteria | 2093 |
| 225 | Ga0268265_10052172 | 3300028380 | Bacteria | 3091 |
| 226 | Ga0268265_10126145 | 3300028380 | Bacteria | 2118 |
| 227 | Ga0268264_10000057 | 3300028381 | Bacteria | 309824 |
| 228 | Ga0268264_10000165 | 3300028381 | Bacteria | 147648 |
| 229 | Ga0268264_10029410 | 3300028381 | Bacteria | 4499 |
| 230 | Ga0268264_10042280 | 3300028381 | Bacteria | 3772 |
| 231 | Ga0265334_10011614 | 3300028573 | Bacteria | 3704 |
| 232 | Ga0307515_10001344 | 3300028794 | Bacteria | 55675 |
| 233 | Ga0307515_10100996 | 3300028794 | Bacteria | 3487 |
| 234 | Ga0307515_10159820 | 3300028794 | Bacteria | 2305 |
| 235 | Ga0265338_10056287 | 3300028800 | Bacteria | 3489 |
| 236 | Ga0265340_10009378 | 3300031247 | Bacteria | 5257 |
| 237 | Ga0265331_10003538 | 3300031250 | Bacteria | 10028 |
| 238 | Ga0307509_10000013 | 3300031507 | Bacteria | 283027 |
| 239 | Ga0265313_10114437 | 3300031595 | Bacteria | 1183 |
| 240 | Ga0316575_10024763 | 3300031665 | Bacteria | 2325 |
| 241 | Ga0316579_10009069 | 3300031691 | Bacteria | 4173 |
| 242 | Ga0316579_10075152 | 3300031691 | Bacteria | 1605 |
| 243 | Ga0316576_10001053 | 3300031727 | Bacteria | 14312 |
| 244 | Ga0316576_10010217 | 3300031727 | Bacteria | 6088 |
| 245 | Ga0316576_10010704 | 3300031727 | Bacteria | 5974 |
| 246 | Ga0316578_10274712 | 3300031728 | Bacteria | 1009 |
| 247 | Ga0307516_10038616 | 3300031730 | Bacteria | 4763 |
| 248 | Ga0307405_10115797 | 3300031731 | Bacteria | 1824 |
| 249 | Ga0307405_10440676 | 3300031731 | Bacteria | 1030 |
| 250 | Ga0316577_10004130 | 3300031733 | Bacteria | 7454 |
| 251 | Ga0316577_10020033 | 3300031733 | Bacteria | 3706 |
| 252 | Ga0307410_10046860 | 3300031852 | Bacteria | 2886 |
| 253 | Ga0307410_10272478 | 3300031852 | Bacteria | 1324 |
| 254 | Ga0307406_10109301 | 3300031901 | Bacteria | 1900 |
| 255 | Ga0307412_10045788 | 3300031911 | Bacteria | 2862 |
| 256 | Ga0307409_100183615 | 3300031995 | Bacteria | 1854 |
| 257 | Ga0307416_100283273 | 3300032002 | Bacteria | 1636 |
| 258 | Ga0307411_10187143 | 3300032005 | Bacteria | 1577 |
| 259 | Ga0307411_10195749 | 3300032005 | Bacteria | 1547 |
| 260 | Ga0307415_100040511 | 3300032126 | Bacteria | 3086 |
| 261 | Ga0307415_100115831 | 3300032126 | Bacteria | 1998 |
| 262 | Ga0316585_10025264 | 3300032137 | Bacteria | 1841 |
| 263 | Ga0316585_10098832 | 3300032137 | Bacteria | 956 |
| 264 | Ga0316580_10007402 | 3300032139 | Bacteria | 3269 |
| 265 | Ga0316593_10001327 | 3300032168 | Bacteria | 5402 |
| 266 | Ga0316593_10001575 | 3300032168 | Bacteria | 5082 |
| 267 | Ga0316593_10002241 | 3300032168 | Bacteria | 4527 |
| 268 | Ga0316593_10004559 | 3300032168 | Bacteria | 3570 |
| 269 | Ga0316593_10012909 | 3300032168 | Bacteria | 2462 |
| 270 | Ga0316587_1010243 | 3300033529 | Bacteria | 1498 |
| 271 | Ga0316596_1001513 | 3300033541 | Bacteria | 4720 |
| 272 | Ga0316596_1039626 | 3300033541 | Bacteria | 1236 |
| 273 | Ga0373954_0119860 | 3300035118 | Bacteria | 1277 |
| 274 | Ga0373954_0135007 | 3300035118 | Bacteria | 1202 |
| 275 | Ga0373955_0037553 | 3300035172 | Bacteria | 2576 |
| 276 | Ga0316574_0007383 | 3300035398 | Bacteria | 6025 |
| 277 | Ga0316574_0235024 | 3300035398 | Bacteria | 1172 |
| 278 | Ga0373927_0023860 | 3300035695 | Bacteria | 4002 |
| 279 | Ga0373927_0184050 | 3300035695 | Bacteria | 1370 |
| 280 | Ga0373933_0036152 | 3300035724 | Bacteria | 2889 |
| 281 | Ga0373947_0029991 | 3300035725 | Bacteria | 3193 |
| 282 | Ga0373937_0026022 | 3300036401 | Bacteria | 5286 |
| 283 | Ga0316582_0010241 | 3300036647 | Bacteria | 5125 |
| 284 | Ga0316582_0034781 | 3300036647 | Bacteria | 3106 |
| 285 | Ga0316582_0231935 | 3300036647 | Bacteria | 1264 |
| 286 | Ga0316584_0002382 | 3300036712 | Bacteria | 11867 |
| 287 | Ga0316584_0003101 | 3300036712 | Bacteria | 10726 |
| 288 | Ga0316584_0033419 | 3300036712 | Bacteria | 3810 |
| 289 | Ga0316584_0048932 | 3300036712 | Bacteria | 3159 |
| 290 | Ga0316584_0113485 | 3300036712 | Bacteria | 2027 |
| 291 | Ga0316584_0465631 | 3300036712 | Bacteria | 892 |
| 292 | Ga0373925_0042640 | 3300037068 | Bacteria | 3366 |
| 293 | Ga0316581_0020961 | 3300037588 | Bacteria | 1917 |
| 294 | Ga0400490_00276 | 3300038726 | Bacteria | 11616 |
| 295 | Ga0400490_13166 | 3300038726 | Bacteria | 2743 |
| 296 | Ga0400488_49585 | 3300038741 | Bacteria | 20652 |
| 297 | Ga0400486_22372 | 3300038742 | Bacteria | 1389 |
| 298 | Ga0400487_27515 | 3300039110 | Bacteria | 45618 |
| 299 | Ga0436365_0156147 | 3300039437 | Bacteria | 1405 |
| 300 | Ga0436365_1144419 | 3300039437 | Bacteria | 9133 |
| 301 | Ga0436365_1654024 | 3300039437 | Bacteria | 1528 |
| 302 | Ga0436360_0347015 | 3300039438 | Bacteria | 4104 |
| 303 | Ga0436363_1191658 | 3300039450 | Bacteria | 7321 |
| 304 | Ga0436363_1690332 | 3300039450 | Bacteria | 1425 |
| 305 | Ga0436363_1702804 | 3300039450 | Bacteria | 8666 |
| 306 | Ga0439446_0004602 | 3300042156 | Bacteria | 3501 |
| 307 | Ga0439435_0000998 | 3300042436 | Bacteria | 4956 |
| 308 | Ga0439435_0077042 | 3300042436 | Bacteria | 996 |
| 309 | Ga0439444_0006073 | 3300042437 | Bacteria | 1812 |
| 310 | Ga0451577_0015507 | 3300042876 | Bacteria | 7088 |
| 311 | Ga0451577_0081549 | 3300042876 | Bacteria | 2885 |
| 312 | Ga0466969_0014779 | 3300044656 | Bacteria | 4101 |
| 313 | Ga0466969_0043304 | 3300044656 | Bacteria | 2244 |
| 314 | Ga0466966_0005277 | 3300044684 | Bacteria | 8493 |
| 315 | Ga0466964_0000540 | 3300044706 | Bacteria | 11854 |
| 316 | Ga0453684_0043231 | 3300044712 | Bacteria | 6059 |
| 317 | Ga0453684_0048320 | 3300044712 | Bacteria | 5629 |
| 318 | Ga0453684_0459249 | 3300044712 | Bacteria | 1416 |
| 319 | Ga0466957_0076854 | 3300044842 | Bacteria | 2074 |
| 320 | Ga0466959_0015193 | 3300045049 | Bacteria | 5607 |
| 321 | Ga0466959_0100972 | 3300045049 | Bacteria | 2065 |
| 322 | Ga0451576_0028243 | 3300045051 | Bacteria | 6012 |
| 323 | Ga0466967_0172127 | 3300045976 | Bacteria | 2038 |
| 324 | Ga0495580_0001636 | 3300046472 | Bacteria | 19707 |
| 325 | Ga0495583_0114948 | 3300046506 | Bacteria | 1137 |
| 326 | Ga0495630_0033201 | 3300046517 | Bacteria | 3849 |
| 327 | Ga0495640_0156661 | 3300046533 | Bacteria | 1462 |
| 328 | Ga0495599_0038253 | 3300046678 | Bacteria | 3015 |
| 329 | Ga0495646_0188868 | 3300046680 | Bacteria | 1127 |
| 330 | Ga0495604_0154996 | 3300047317 | Bacteria | 1624 |
| 331 | Ga0495602_0021748 | 3300048088 | Bacteria | 6302 |
| 332 | Ga0496100_0035122 | 3300048903 | Bacteria | 3151 |
| 333 | Ga0496100_0204456 | 3300048903 | Bacteria | 1441 |
| 334 | Ga0496101_0014901 | 3300048904 | Bacteria | 5231 |
| 335 | Ga0496102_0017776 | 3300048905 | Bacteria | 6234 |
| 336 | Ga0496104_0002130 | 3300048907 | Bacteria | 17171 |
| 337 | Ga0496105_0039471 | 3300048908 | Bacteria | 3891 |
| 338 | Ga0496105_0065355 | 3300048908 | Bacteria | 3002 |
| 339 | Ga0496107_0016316 | 3300048910 | Bacteria | 5213 |
| 340 | Ga0496108_0039878 | 3300048911 | Bacteria | 3914 |
| 341 | Ga0496109_0042638 | 3300048912 | Bacteria | 4111 |
| 342 | Ga0496109_0109526 | 3300048912 | Bacteria | 2567 |
| 343 | Ga0496110_0011315 | 3300048913 | Bacteria | 7297 |
| 344 | Ga0496110_0141473 | 3300048913 | Bacteria | 2175 |
| 345 | Ga0496111_0002909 | 3300048914 | Bacteria | 10462 |
| 346 | Ga0496114_0069026 | 3300048917 | Bacteria | 2967 |
| 347 | Ga0496115_0010179 | 3300048918 | Bacteria | 7018 |
| 348 | Ga0496121_0387522 | 3300048924 | Bacteria | 920 |
| 349 | Ga0501032_0076987 | 3300049569 | Bacteria | 2221 |
| 350 | Ga0501033_0003546 | 3300049570 | Bacteria | 12763 |
| 351 | Ga0501034_0020412 | 3300049571 | Bacteria | 6764 |
| 352 | Ga0501036_0083525 | 3300049572 | Bacteria | 2700 |
| 353 | Ga0501037_0002476 | 3300049573 | Bacteria | 13336 |
| 354 | Ga0501038_0000828 | 3300049574 | Bacteria | 27543 |
| 355 | Ga0501038_0021026 | 3300049574 | Bacteria | 5863 |
| 356 | Ga0501039_0161315 | 3300049575 | Bacteria | 1762 |
| 357 | Ga0501046_0175879 | 3300049580 | Bacteria | 1603 |
| 358 | Ga0501047_0093220 | 3300049581 | Bacteria | 2891 |
| 359 | Ga0501047_0337423 | 3300049581 | Bacteria | 1345 |
| 360 | Ga0501067_0000436 | 3300049583 | Bacteria | 22842 |
| 361 | Ga0501067_0049245 | 3300049583 | Bacteria | 2335 |
| 362 | Ga0501068_0089279 | 3300049584 | Bacteria | 1900 |
| 363 | Ga0501071_0000729 | 3300049587 | Bacteria | 17355 |
| 364 | Ga0501072_0047682 | 3300049588 | Bacteria | 3374 |
| 365 | Ga0501073_0003248 | 3300049589 | Bacteria | 12199 |
| 366 | Ga0501073_0009519 | 3300049589 | Bacteria | 7171 |
| 367 | Ga0501073_0283683 | 3300049589 | Bacteria | 1143 |
| 368 | Ga0501074_0035030 | 3300049590 | Bacteria | 3638 |
| 369 | Ga0501075_0021687 | 3300049591 | Bacteria | 4685 |
| 370 | Ga0501075_0352275 | 3300049591 | Bacteria | 1122 |
| 371 | Ga0501076_0176980 | 3300049592 | Bacteria | 1739 |
| 372 | Ga0501077_0024080 | 3300049593 | Bacteria | 3863 |
| 373 | Ga0501080_0005463 | 3300049742 | Bacteria | 11342 |
| 374 | Ga0501080_0014481 | 3300049742 | Bacteria | 7264 |
| 375 | Ga0501080_0037717 | 3300049742 | Bacteria | 4513 |
| 376 | Ga0501083_0019407 | 3300049744 | Bacteria | 4737 |
| 377 | Ga0501083_0137168 | 3300049744 | Bacteria | 1603 |
| 378 | Ga0501035_0059897 | 3300049822 | Bacteria | 3391 |
| 379 | Ga0501044_0001571 | 3300049823 | Bacteria | 26728 |
| 380 | nmdc:mga05p37_285769_c1 | 3300050507 | Bacteria | 1965 |
| 381 | nmdc:mga09592_23527_c1 | 3300050508 | Bacteria | 5089 |
| 382 | nmdc:mga06r32_121613_c1 | 3300050510 | Bacteria | 2576 |
| 383 | nmdc:mga06r32_52980_c1 | 3300050510 | Bacteria | 3887 |
| 384 | nmdc:mga08y16_214405_c1 | 3300050511 | Bacteria | 1994 |
| 385 | nmdc:mga0a205_463914_c1 | 3300050515 | Bacteria | 1126 |
| 386 | Ga0500646_0035919 | 3300053090 | Bacteria | 1379 |
| 387 | Ga0500556_0000152 | 3300053104 | Bacteria | 57878 |
| 388 | Ga0500616_0000032 | 3300053153 | Bacteria | 403673 |
| 389 | Ga0500622_0003563 | 3300053156 | Bacteria | 10287 |
| 390 | Ga0501082_0012681 | 3300060353 | Bacteria | 7243 |
| 391 | Ga0501082_0026289 | 3300060353 | Bacteria | 5015 |
| 392 | Ga0466962_0006324 | 3300061719 | Bacteria | 5682 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036712 | Ga0316584_0465631 | Ga0316584_0465631_11_742 | 238 |
| 2 | 3300049744 | Ga0501083_0019407 | Ga0501083_0019407_18_788 | 243 |
| 3 | 3300037068 | Ga0373925_0042640 | Ga0373925_0042640_2606_3352 | 245 |
| 4 | 3300049589 | Ga0501073_0283683 | Ga0501073_0283683_360_1109 | 247 |
| 5 | 3300042436 | Ga0439435_0077042 | Ga0439435_0077042_188_958 | 255 |
| 6 | 3300039450 | Ga0436363_1690332 | Ga0436363_1690332_542_1375 | 256 |
| 7 | 3300032168 | Ga0316593_10012909 | Ga0316593_100129092 | 262 |
| 8 | 3300049569 | Ga0501032_0076987 | Ga0501032_0076987_1085_1918 | 264 |
| 9 | 3300049570 | Ga0501033_0003546 | Ga0501033_0003546_10365_11198 | 264 |
| 10 | 3300049571 | Ga0501034_0020412 | Ga0501034_0020412_4780_5613 | 264 |
| 11 | 3300049572 | Ga0501036_0083525 | Ga0501036_0083525_282_1115 | 264 |
| 12 | 3300049573 | Ga0501037_0002476 | Ga0501037_0002476_8130_8963 | 264 |
| 13 | 3300049574 | Ga0501038_0021026 | Ga0501038_0021026_4958_5791 | 264 |
| 14 | 3300049575 | Ga0501039_0161315 | Ga0501039_0161315_845_1678 | 264 |
| 15 | 3300049580 | Ga0501046_0175879 | Ga0501046_0175879_702_1535 | 264 |
| 16 | 3300049581 | Ga0501047_0093220 | Ga0501047_0093220_1201_2034 | 264 |
| 17 | 3300049583 | Ga0501067_0049245 | Ga0501067_0049245_122_955 | 264 |
| 18 | 3300049589 | Ga0501073_0009519 | Ga0501073_0009519_4616_5449 | 264 |
| 19 | 3300049590 | Ga0501074_0035030 | Ga0501074_0035030_1512_2345 | 264 |
| 20 | 3300049742 | Ga0501080_0014481 | Ga0501080_0014481_3182_4015 | 264 |
| 21 | 3300049822 | Ga0501035_0059897 | Ga0501035_0059897_2004_2837 | 264 |
| 22 | 3300049823 | Ga0501044_0001571 | Ga0501044_0001571_3995_4828 | 264 |
| 23 | 3300060353 | Ga0501082_0026289 | Ga0501082_0026289_80_913 | 264 |
| 24 | 3300028794 | Ga0307515_10001344 | Ga0307515_100013443 | 267 |
| 25 | 3300053090 | Ga0500646_0035919 | Ga0500646_0035919_374_1180 | 267 |
| 26 | 3300053156 | Ga0500622_0003563 | Ga0500622_0003563_7082_7888 | 267 |
| 27 | 3300005327 | Ga0070658_10459953 | Ga0070658_104599532 | 271 |
| 28 | 3300009093 | Ga0105240_10505627 | Ga0105240_105056272 | 271 |
| 29 | 3300025913 | Ga0207695_10321300 | Ga0207695_103213002 | 271 |
| 30 | 3300035695 | Ga0373927_0023860 | Ga0373927_0023860_1892_2710 | 271 |
| 31 | 3300031730 | Ga0307516_10038616 | Ga0307516_100386164 | 272 |
| 32 | 3300005434 | Ga0070709_10174699 | Ga0070709_101746992 | 274 |
| 33 | 3300014326 | Ga0157380_10229970 | Ga0157380_102299702 | 274 |
| 34 | 3300005436 | Ga0070713_100106649 | Ga0070713_1001066492 | 275 |
| 35 | 3300005548 | Ga0070665_100000697 | Ga0070665_1000006977 | 275 |
| 36 | 3300009093 | Ga0105240_10161244 | Ga0105240_101612442 | 275 |
| 37 | 3300009545 | Ga0105237_10414697 | Ga0105237_104146972 | 275 |
| 38 | 3300010375 | Ga0105239_10772253 | Ga0105239_107722532 | 275 |
| 39 | 3300014968 | Ga0157379_10077741 | Ga0157379_100777412 | 275 |
| 40 | 3300025913 | Ga0207695_10148399 | Ga0207695_101483992 | 275 |
| 41 | 3300028379 | Ga0268266_10000834 | Ga0268266_1000083422 | 275 |
| 42 | 2162886007 | SwRhRL2b_contig_2581737 | SwRhRL2b_0339.00005140 | 276 |
| 43 | 3300003203 | JGI25406J46586_10004938 | JGI25406J46586_100049383 | 276 |
| 44 | 3300005289 | Ga0065704_10001819 | Ga0065704_1000181912 | 276 |
| 45 | 3300005295 | Ga0065707_10083189 | Ga0065707_100831897 | 276 |
| 46 | 3300005327 | Ga0070658_10045812 | Ga0070658_100458122 | 276 |
| 47 | 3300005328 | Ga0070676_10039971 | Ga0070676_100399711 | 276 |
| 48 | 3300005329 | Ga0070683_100038299 | Ga0070683_1000382994 | 276 |
| 49 | 3300005330 | Ga0070690_100014489 | Ga0070690_1000144893 | 276 |
| 50 | 3300005330 | Ga0070690_100045953 | Ga0070690_1000459532 | 276 |
| 51 | 3300005331 | Ga0070670_100175666 | Ga0070670_1001756662 | 276 |
| 52 | 3300005333 | Ga0070677_10075904 | Ga0070677_100759042 | 276 |
| 53 | 3300005335 | Ga0070666_10004512 | Ga0070666_100045123 | 276 |
| 54 | 3300005335 | Ga0070666_10063356 | Ga0070666_100633562 | 276 |
| 55 | 3300005336 | Ga0070680_100042941 | Ga0070680_1000429413 | 276 |
| 56 | 3300005336 | Ga0070680_100045046 | Ga0070680_1000450463 | 276 |
| 57 | 3300005336 | Ga0070680_100192095 | Ga0070680_1001920952 | 276 |
| 58 | 3300005337 | Ga0070682_100269135 | Ga0070682_1002691352 | 276 |
| 59 | 3300005338 | Ga0068868_100003680 | Ga0068868_1000036803 | 276 |
| 60 | 3300005338 | Ga0068868_100075678 | Ga0068868_1000756782 | 276 |
| 61 | 3300005347 | Ga0070668_100023812 | Ga0070668_1000238124 | 276 |
| 62 | 3300005353 | Ga0070669_100037541 | Ga0070669_1000375415 | 276 |
| 63 | 3300005354 | Ga0070675_100021095 | Ga0070675_1000210953 | 276 |
| 64 | 3300005355 | Ga0070671_100009266 | Ga0070671_1000092663 | 276 |
| 65 | 3300005355 | Ga0070671_100060269 | Ga0070671_1000602692 | 276 |
| 66 | 3300005356 | Ga0070674_100021852 | Ga0070674_1000218523 | 276 |
| 67 | 3300005364 | Ga0070673_100055271 | Ga0070673_1000552714 | 276 |
| 68 | 3300005367 | Ga0070667_100000068 | Ga0070667_100000068111 | 276 |
| 69 | 3300005367 | Ga0070667_100003283 | Ga0070667_1000032835 | 276 |
| 70 | 3300005367 | Ga0070667_100027990 | Ga0070667_1000279904 | 276 |
| 71 | 3300005434 | Ga0070709_10012650 | Ga0070709_100126502 | 276 |
| 72 | 3300005436 | Ga0070713_100000837 | Ga0070713_10000083712 | 276 |
| 73 | 3300005439 | Ga0070711_100000311 | Ga0070711_1000003113 | 276 |
| 74 | 3300005456 | Ga0070678_100005775 | Ga0070678_1000057753 | 276 |
| 75 | 3300005457 | Ga0070662_100011141 | Ga0070662_1000111416 | 276 |
| 76 | 3300005458 | Ga0070681_10004492 | Ga0070681_100044922 | 276 |
| 77 | 3300005458 | Ga0070681_10082236 | Ga0070681_100822362 | 276 |
| 78 | 3300005458 | Ga0070681_10086684 | Ga0070681_100866842 | 276 |
| 79 | 3300005458 | Ga0070681_10105802 | Ga0070681_101058023 | 276 |
| 80 | 3300005458 | Ga0070681_10371575 | Ga0070681_103715752 | 276 |
| 81 | 3300005468 | Ga0070707_100428808 | Ga0070707_1004288082 | 276 |
| 82 | 3300005518 | Ga0070699_100129987 | Ga0070699_1001299872 | 276 |
| 83 | 3300005530 | Ga0070679_100007158 | Ga0070679_1000071582 | 276 |
| 84 | 3300005530 | Ga0070679_100072577 | Ga0070679_1000725773 | 276 |
| 85 | 3300005530 | Ga0070679_100140989 | Ga0070679_1001409892 | 276 |
| 86 | 3300005535 | Ga0070684_100199307 | Ga0070684_1001993072 | 276 |
| 87 | 3300005539 | Ga0068853_100176870 | Ga0068853_1001768702 | 276 |
| 88 | 3300005543 | Ga0070672_100019844 | Ga0070672_1000198444 | 276 |
| 89 | 3300005544 | Ga0070686_100191625 | Ga0070686_1001916252 | 276 |
| 90 | 3300005548 | Ga0070665_100006033 | Ga0070665_1000060331 | 276 |
| 91 | 3300005548 | Ga0070665_100015281 | Ga0070665_1000152816 | 276 |
| 92 | 3300005563 | Ga0068855_100046131 | Ga0068855_1000461313 | 276 |
| 93 | 3300005563 | Ga0068855_100201950 | Ga0068855_1002019502 | 276 |
| 94 | 3300005563 | Ga0068855_100223878 | Ga0068855_1002238782 | 276 |
| 95 | 3300005563 | Ga0068855_100268023 | Ga0068855_1002680232 | 276 |
| 96 | 3300005578 | Ga0068854_100059252 | Ga0068854_1000592522 | 276 |
| 97 | 3300005614 | Ga0068856_100067009 | Ga0068856_1000670093 | 276 |
| 98 | 3300005614 | Ga0068856_100318342 | Ga0068856_1003183422 | 276 |
| 99 | 3300005616 | Ga0068852_100072462 | Ga0068852_1000724622 | 276 |
| 100 | 3300005617 | Ga0068859_100044796 | Ga0068859_1000447964 | 276 |
| 101 | 3300005618 | Ga0068864_100396941 | Ga0068864_1003969412 | 276 |
| 102 | 3300005719 | Ga0068861_100005711 | Ga0068861_1000057113 | 276 |
| 103 | 3300005834 | Ga0068851_10101836 | Ga0068851_101018362 | 276 |
| 104 | 3300005841 | Ga0068863_100016691 | Ga0068863_1000166913 | 276 |
| 105 | 3300005841 | Ga0068863_100027766 | Ga0068863_1000277667 | 276 |
| 106 | 3300005842 | Ga0068858_100007259 | Ga0068858_1000072594 | 276 |
| 107 | 3300005842 | Ga0068858_100093487 | Ga0068858_1000934872 | 276 |
| 108 | 3300005843 | Ga0068860_100022026 | Ga0068860_1000220265 | 276 |
| 109 | 3300005843 | Ga0068860_100056242 | Ga0068860_1000562422 | 276 |
| 110 | 3300005844 | Ga0068862_100007821 | Ga0068862_1000078214 | 276 |
| 111 | 3300005985 | Ga0081539_10000004 | Ga0081539_10000004265 | 276 |
| 112 | 3300006173 | Ga0070716_100018840 | Ga0070716_1000188403 | 276 |
| 113 | 3300006175 | Ga0070712_100004864 | Ga0070712_1000048642 | 276 |
| 114 | 3300006175 | Ga0070712_100094819 | Ga0070712_1000948192 | 276 |
| 115 | 3300006195 | Ga0075366_10023873 | Ga0075366_100238732 | 276 |
| 116 | 3300006237 | Ga0097621_100024685 | Ga0097621_1000246855 | 276 |
| 117 | 3300006237 | Ga0097621_100051404 | Ga0097621_1000514042 | 276 |
| 118 | 3300006237 | Ga0097621_100180103 | Ga0097621_1001801032 | 276 |
| 119 | 3300006358 | Ga0068871_100033543 | Ga0068871_1000335432 | 276 |
| 120 | 3300006844 | Ga0075428_100023966 | Ga0075428_1000239662 | 276 |
| 121 | 3300006846 | Ga0075430_100022271 | Ga0075430_1000222712 | 276 |
| 122 | 3300006847 | Ga0075431_100038305 | Ga0075431_1000383052 | 276 |
| 123 | 3300006881 | Ga0068865_100017596 | Ga0068865_1000175963 | 276 |
| 124 | 3300006931 | Ga0097620_100044797 | Ga0097620_1000447974 | 276 |
| 125 | 3300009093 | Ga0105240_10003535 | Ga0105240_100035352 | 276 |
| 126 | 3300009093 | Ga0105240_10035089 | Ga0105240_100350892 | 276 |
| 127 | 3300009093 | Ga0105240_10035623 | Ga0105240_100356232 | 276 |
| 128 | 3300009093 | Ga0105240_10075495 | Ga0105240_100754952 | 276 |
| 129 | 3300009093 | Ga0105240_10155882 | Ga0105240_101558822 | 276 |
| 130 | 3300009094 | Ga0111539_10007684 | Ga0111539_100076845 | 276 |
| 131 | 3300009098 | Ga0105245_10191836 | Ga0105245_101918362 | 276 |
| 132 | 3300009101 | Ga0105247_10081013 | Ga0105247_100810132 | 276 |
| 133 | 3300009147 | Ga0114129_10146449 | Ga0114129_101464492 | 276 |
| 134 | 3300009148 | Ga0105243_10370448 | Ga0105243_103704482 | 276 |
| 135 | 3300009174 | Ga0105241_10049924 | Ga0105241_100499242 | 276 |
| 136 | 3300009176 | Ga0105242_10001990 | Ga0105242_1000199012 | 276 |
| 137 | 3300009176 | Ga0105242_10018258 | Ga0105242_100182584 | 276 |
| 138 | 3300009176 | Ga0105242_10171464 | Ga0105242_101714642 | 276 |
| 139 | 3300009177 | Ga0105248_10006124 | Ga0105248_100061246 | 276 |
| 140 | 3300009177 | Ga0105248_10053010 | Ga0105248_100530105 | 276 |
| 141 | 3300009545 | Ga0105237_10211678 | Ga0105237_102116781 | 276 |
| 142 | 3300009551 | Ga0105238_10002167 | Ga0105238_1000216711 | 276 |
| 143 | 3300009551 | Ga0105238_10068178 | Ga0105238_100681783 | 276 |
| 144 | 3300009551 | Ga0105238_10303847 | Ga0105238_103038472 | 276 |
| 145 | 3300009551 | Ga0105238_10340727 | Ga0105238_103407272 | 276 |
| 146 | 3300009551 | Ga0105238_10414646 | Ga0105238_104146462 | 276 |
| 147 | 3300009987 | Ga0105030_107476 | Ga0105030_1074761 | 276 |
| 148 | 3300010375 | Ga0105239_10039150 | Ga0105239_100391503 | 276 |
| 149 | 3300010375 | Ga0105239_10067733 | Ga0105239_100677332 | 276 |
| 150 | 3300013104 | Ga0157370_10004311 | Ga0157370_100043113 | 276 |
| 151 | 3300013105 | Ga0157369_10064073 | Ga0157369_100640732 | 276 |
| 152 | 3300013105 | Ga0157369_10129511 | Ga0157369_101295112 | 276 |
| 153 | 3300013296 | Ga0157374_10003025 | Ga0157374_100030257 | 276 |
| 154 | 3300013296 | Ga0157374_10008461 | Ga0157374_100084619 | 276 |
| 155 | 3300013296 | Ga0157374_10617729 | Ga0157374_106177291 | 276 |
| 156 | 3300013297 | Ga0157378_10017897 | Ga0157378_100178977 | 276 |
| 157 | 3300013297 | Ga0157378_10031781 | Ga0157378_100317813 | 276 |
| 158 | 3300013297 | Ga0157378_10046063 | Ga0157378_100460635 | 276 |
| 159 | 3300013306 | Ga0163162_10009016 | Ga0163162_100090169 | 276 |
| 160 | 3300013306 | Ga0163162_10034120 | Ga0163162_100341202 | 276 |
| 161 | 3300013307 | Ga0157372_10052964 | Ga0157372_100529642 | 276 |
| 162 | 3300013308 | Ga0157375_10015518 | Ga0157375_100155183 | 276 |
| 163 | 3300014325 | Ga0163163_10101457 | Ga0163163_101014572 | 276 |
| 164 | 3300014325 | Ga0163163_10126029 | Ga0163163_101260292 | 276 |
| 165 | 3300014325 | Ga0163163_10335894 | Ga0163163_103358942 | 276 |
| 166 | 3300014326 | Ga0157380_10003144 | Ga0157380_1000314411 | 276 |
| 167 | 3300014326 | Ga0157380_10062123 | Ga0157380_100621232 | 276 |
| 168 | 3300014968 | Ga0157379_10002563 | Ga0157379_1000256311 | 276 |
| 169 | 3300014968 | Ga0157379_10039845 | Ga0157379_100398452 | 276 |
| 170 | 3300014968 | Ga0157379_10231950 | Ga0157379_102319502 | 276 |
| 171 | 3300014968 | Ga0157379_10303226 | Ga0157379_103032262 | 276 |
| 172 | 3300014969 | Ga0157376_10000400 | Ga0157376_1000040014 | 276 |
| 173 | 3300017792 | Ga0163161_10091437 | Ga0163161_100914372 | 276 |
| 174 | 3300021384 | Ga0213876_10026429 | Ga0213876_100264292 | 276 |
| 175 | 3300025321 | Ga0207656_10155417 | Ga0207656_101554172 | 276 |
| 176 | 3300025893 | Ga0207682_10078364 | Ga0207682_100783642 | 276 |
| 177 | 3300025898 | Ga0207692_10036363 | Ga0207692_100363632 | 276 |
| 178 | 3300025903 | Ga0207680_10014471 | Ga0207680_100144713 | 276 |
| 179 | 3300025903 | Ga0207680_10048539 | Ga0207680_100485392 | 276 |
| 180 | 3300025903 | Ga0207680_10071238 | Ga0207680_100712382 | 276 |
| 181 | 3300025906 | Ga0207699_10004969 | Ga0207699_100049697 | 276 |
| 182 | 3300025907 | Ga0207645_10000328 | Ga0207645_1000032829 | 276 |
| 183 | 3300025908 | Ga0207643_10155583 | Ga0207643_101555832 | 276 |
| 184 | 3300025911 | Ga0207654_10099383 | Ga0207654_100993832 | 276 |
| 185 | 3300025912 | Ga0207707_10004603 | Ga0207707_1000460311 | 276 |
| 186 | 3300025912 | Ga0207707_10034444 | Ga0207707_100344442 | 276 |
| 187 | 3300025912 | Ga0207707_10092523 | Ga0207707_100925232 | 276 |
| 188 | 3300025913 | Ga0207695_10019870 | Ga0207695_100198707 | 276 |
| 189 | 3300025913 | Ga0207695_10027990 | Ga0207695_100279902 | 276 |
| 190 | 3300025913 | Ga0207695_10046321 | Ga0207695_100463215 | 276 |
| 191 | 3300025913 | Ga0207695_10046530 | Ga0207695_100465302 | 276 |
| 192 | 3300025913 | Ga0207695_10067027 | Ga0207695_100670272 | 276 |
| 193 | 3300025913 | Ga0207695_10265249 | Ga0207695_102652492 | 276 |
| 194 | 3300025914 | Ga0207671_10025320 | Ga0207671_100253202 | 276 |
| 195 | 3300025914 | Ga0207671_10059443 | Ga0207671_100594432 | 276 |
| 196 | 3300025915 | Ga0207693_10000462 | Ga0207693_1000046212 | 276 |
| 197 | 3300025915 | Ga0207693_10154989 | Ga0207693_101549892 | 276 |
| 198 | 3300025916 | Ga0207663_10058791 | Ga0207663_100587912 | 276 |
| 199 | 3300025917 | Ga0207660_10003894 | Ga0207660_100038949 | 276 |
| 200 | 3300025917 | Ga0207660_10107441 | Ga0207660_101074412 | 276 |
| 201 | 3300025917 | Ga0207660_10277379 | Ga0207660_102773792 | 276 |
| 202 | 3300025921 | Ga0207652_10033769 | Ga0207652_100337693 | 276 |
| 203 | 3300025924 | Ga0207694_10006259 | Ga0207694_1000625910 | 276 |
| 204 | 3300025924 | Ga0207694_10016134 | Ga0207694_100161345 | 276 |
| 205 | 3300025924 | Ga0207694_10042880 | Ga0207694_100428803 | 276 |
| 206 | 3300025924 | Ga0207694_10086640 | Ga0207694_100866402 | 276 |
| 207 | 3300025924 | Ga0207694_10291891 | Ga0207694_102918912 | 276 |
| 208 | 3300025924 | Ga0207694_10350463 | Ga0207694_103504631 | 276 |
| 209 | 3300025927 | Ga0207687_10220634 | Ga0207687_102206342 | 276 |
| 210 | 3300025928 | Ga0207700_10023287 | Ga0207700_100232873 | 276 |
| 211 | 3300025928 | Ga0207700_10123203 | Ga0207700_101232032 | 276 |
| 212 | 3300025928 | Ga0207700_10135503 | Ga0207700_101355032 | 276 |
| 213 | 3300025931 | Ga0207644_10132680 | Ga0207644_101326802 | 276 |
| 214 | 3300025933 | Ga0207706_10000476 | Ga0207706_1000047615 | 276 |
| 215 | 3300025934 | Ga0207686_10103693 | Ga0207686_101036932 | 276 |
| 216 | 3300025935 | Ga0207709_10258366 | Ga0207709_102583662 | 276 |
| 217 | 3300025938 | Ga0207704_10178006 | Ga0207704_101780062 | 276 |
| 218 | 3300025939 | Ga0207665_10039754 | Ga0207665_100397542 | 276 |
| 219 | 3300025940 | Ga0207691_10000632 | Ga0207691_1000063229 | 276 |
| 220 | 3300025940 | Ga0207691_10170805 | Ga0207691_101708052 | 276 |
| 221 | 3300025941 | Ga0207711_10043186 | Ga0207711_100431863 | 276 |
| 222 | 3300025941 | Ga0207711_10066646 | Ga0207711_100666462 | 276 |
| 223 | 3300025944 | Ga0207661_10413930 | Ga0207661_104139301 | 276 |
| 224 | 3300025949 | Ga0207667_10000859 | Ga0207667_100008593 | 276 |
| 225 | 3300025949 | Ga0207667_10195662 | Ga0207667_101956622 | 276 |
| 226 | 3300025960 | Ga0207651_10078361 | Ga0207651_100783612 | 276 |
| 227 | 3300025961 | Ga0207712_10116355 | Ga0207712_101163552 | 276 |
| 228 | 3300025972 | Ga0207668_10046217 | Ga0207668_100462172 | 276 |
| 229 | 3300025986 | Ga0207658_10000325 | Ga0207658_1000032522 | 276 |
| 230 | 3300025986 | Ga0207658_10007697 | Ga0207658_100076978 | 276 |
| 231 | 3300025986 | Ga0207658_10368306 | Ga0207658_103683061 | 276 |
| 232 | 3300026023 | Ga0207677_10050859 | Ga0207677_100508592 | 276 |
| 233 | 3300026023 | Ga0207677_10146147 | Ga0207677_101461472 | 276 |
| 234 | 3300026035 | Ga0207703_10000663 | Ga0207703_1000066323 | 276 |
| 235 | 3300026035 | Ga0207703_10022060 | Ga0207703_100220602 | 276 |
| 236 | 3300026035 | Ga0207703_10056609 | Ga0207703_100566093 | 276 |
| 237 | 3300026078 | Ga0207702_10198005 | Ga0207702_101980052 | 276 |
| 238 | 3300026078 | Ga0207702_10212113 | Ga0207702_102121132 | 276 |
| 239 | 3300026088 | Ga0207641_10009947 | Ga0207641_1000994710 | 276 |
| 240 | 3300026089 | Ga0207648_10000334 | Ga0207648_1000033429 | 276 |
| 241 | 3300026095 | Ga0207676_10354375 | Ga0207676_103543752 | 276 |
| 242 | 3300026095 | Ga0207676_10417725 | Ga0207676_104177252 | 276 |
| 243 | 3300026116 | Ga0207674_10290989 | Ga0207674_102909892 | 276 |
| 244 | 3300026118 | Ga0207675_100000130 | Ga0207675_10000013028 | 276 |
| 245 | 3300026121 | Ga0207683_10016700 | Ga0207683_100167006 | 276 |
| 246 | 3300027543 | Ga0209999_1013918 | Ga0209999_10139182 | 276 |
| 247 | 3300027552 | Ga0209982_1003044 | Ga0209982_10030442 | 276 |
| 248 | 3300027665 | Ga0209983_1000042 | Ga0209983_100004219 | 276 |
| 249 | 3300027717 | Ga0209998_10000179 | Ga0209998_1000017920 | 276 |
| 250 | 3300027876 | Ga0209974_10006986 | Ga0209974_100069863 | 276 |
| 251 | 3300027907 | Ga0207428_10215614 | Ga0207428_102156142 | 276 |
| 252 | 3300028379 | Ga0268266_10151126 | Ga0268266_101511262 | 276 |
| 253 | 3300028380 | Ga0268265_10052172 | Ga0268265_100521722 | 276 |
| 254 | 3300028380 | Ga0268265_10126145 | Ga0268265_101261452 | 276 |
| 255 | 3300028381 | Ga0268264_10000057 | Ga0268264_10000057116 | 276 |
| 256 | 3300028381 | Ga0268264_10000165 | Ga0268264_10000165132 | 276 |
| 257 | 3300028381 | Ga0268264_10029410 | Ga0268264_100294102 | 276 |
| 258 | 3300028381 | Ga0268264_10042280 | Ga0268264_100422802 | 276 |
| 259 | 3300028573 | Ga0265334_10011614 | Ga0265334_100116142 | 276 |
| 260 | 3300028794 | Ga0307515_10100996 | Ga0307515_101009964 | 276 |
| 261 | 3300028794 | Ga0307515_10159820 | Ga0307515_101598202 | 276 |
| 262 | 3300028800 | Ga0265338_10056287 | Ga0265338_100562872 | 276 |
| 263 | 3300031247 | Ga0265340_10009378 | Ga0265340_100093784 | 276 |
| 264 | 3300031250 | Ga0265331_10003538 | Ga0265331_100035386 | 276 |
| 265 | 3300031507 | Ga0307509_10000013 | Ga0307509_1000001391 | 276 |
| 266 | 3300031595 | Ga0265313_10114437 | Ga0265313_101144372 | 276 |
| 267 | 3300031665 | Ga0316575_10024763 | Ga0316575_100247632 | 276 |
| 268 | 3300031691 | Ga0316579_10009069 | Ga0316579_100090692 | 276 |
| 269 | 3300031691 | Ga0316579_10075152 | Ga0316579_100751522 | 276 |
| 270 | 3300031727 | Ga0316576_10001053 | Ga0316576_100010539 | 276 |
| 271 | 3300031727 | Ga0316576_10010217 | Ga0316576_100102178 | 276 |
| 272 | 3300031727 | Ga0316576_10010704 | Ga0316576_100107045 | 276 |
| 273 | 3300031728 | Ga0316578_10274712 | Ga0316578_102747122 | 276 |
| 274 | 3300031731 | Ga0307405_10115797 | Ga0307405_101157972 | 276 |
| 275 | 3300031731 | Ga0307405_10440676 | Ga0307405_104406761 | 276 |
| 276 | 3300031733 | Ga0316577_10004130 | Ga0316577_100041304 | 276 |
| 277 | 3300031733 | Ga0316577_10020033 | Ga0316577_100200332 | 276 |
| 278 | 3300031852 | Ga0307410_10046860 | Ga0307410_100468602 | 276 |
| 279 | 3300031852 | Ga0307410_10272478 | Ga0307410_102724782 | 276 |
| 280 | 3300031901 | Ga0307406_10109301 | Ga0307406_101093012 | 276 |
| 281 | 3300031911 | Ga0307412_10045788 | Ga0307412_100457882 | 276 |
| 282 | 3300031995 | Ga0307409_100183615 | Ga0307409_1001836152 | 276 |
| 283 | 3300032002 | Ga0307416_100283273 | Ga0307416_1002832732 | 276 |
| 284 | 3300032005 | Ga0307411_10187143 | Ga0307411_101871432 | 276 |
| 285 | 3300032005 | Ga0307411_10195749 | Ga0307411_101957492 | 276 |
| 286 | 3300032126 | Ga0307415_100040511 | Ga0307415_1000405112 | 276 |
| 287 | 3300032126 | Ga0307415_100115831 | Ga0307415_1001158312 | 276 |
| 288 | 3300032137 | Ga0316585_10025264 | Ga0316585_100252641 | 276 |
| 289 | 3300032137 | Ga0316585_10098832 | Ga0316585_100988321 | 276 |
| 290 | 3300032139 | Ga0316580_10007402 | Ga0316580_100074023 | 276 |
| 291 | 3300032168 | Ga0316593_10001327 | Ga0316593_100013278 | 276 |
| 292 | 3300032168 | Ga0316593_10001575 | Ga0316593_100015754 | 276 |
| 293 | 3300032168 | Ga0316593_10002241 | Ga0316593_100022414 | 276 |
| 294 | 3300032168 | Ga0316593_10004559 | Ga0316593_100045594 | 276 |
| 295 | 3300033529 | Ga0316587_1010243 | Ga0316587_10102432 | 276 |
| 296 | 3300033541 | Ga0316596_1001513 | Ga0316596_10015134 | 276 |
| 297 | 3300033541 | Ga0316596_1039626 | Ga0316596_10396262 | 276 |
| 298 | 3300035118 | Ga0373954_0119860 | Ga0373954_0119860_353_1195 | 276 |
| 299 | 3300035118 | Ga0373954_0135007 | Ga0373954_0135007_220_1062 | 276 |
| 300 | 3300035172 | Ga0373955_0037553 | Ga0373955_0037553_88_930 | 276 |
| 301 | 3300035398 | Ga0316574_0007383 | Ga0316574_0007383_4588_5421 | 276 |
| 302 | 3300035398 | Ga0316574_0235024 | Ga0316574_0235024_297_1145 | 276 |
| 303 | 3300035695 | Ga0373927_0184050 | Ga0373927_0184050_131_973 | 276 |
| 304 | 3300035724 | Ga0373933_0036152 | Ga0373933_0036152_1644_2486 | 276 |
| 305 | 3300035725 | Ga0373947_0029991 | Ga0373947_0029991_1102_1944 | 276 |
| 306 | 3300036401 | Ga0373937_0026022 | Ga0373937_0026022_3175_4017 | 276 |
| 307 | 3300036647 | Ga0316582_0010241 | Ga0316582_0010241_2180_3013 | 276 |
| 308 | 3300036647 | Ga0316582_0034781 | Ga0316582_0034781_1672_2505 | 276 |
| 309 | 3300036647 | Ga0316582_0231935 | Ga0316582_0231935_10_843 | 276 |
| 310 | 3300036712 | Ga0316584_0002382 | Ga0316584_0002382_9362_10195 | 276 |
| 311 | 3300036712 | Ga0316584_0003101 | Ga0316584_0003101_4070_4903 | 276 |
| 312 | 3300036712 | Ga0316584_0033419 | Ga0316584_0033419_2197_3030 | 276 |
| 313 | 3300036712 | Ga0316584_0048932 | Ga0316584_0048932_25_864 | 276 |
| 314 | 3300036712 | Ga0316584_0113485 | Ga0316584_0113485_1062_1895 | 276 |
| 315 | 3300037588 | Ga0316581_0020961 | Ga0316581_0020961_228_1061 | 276 |
| 316 | 3300038726 | Ga0400490_00276 | Ga0400490_00276_254_1087 | 276 |
| 317 | 3300038726 | Ga0400490_13166 | Ga0400490_13166_779_1612 | 276 |
| 318 | 3300038741 | Ga0400488_49585 | Ga0400488_49585_3930_4763 | 276 |
| 319 | 3300038742 | Ga0400486_22372 | Ga0400486_22372_311_1150 | 276 |
| 320 | 3300039110 | Ga0400487_27515 | Ga0400487_27515_34298_35143 | 276 |
| 321 | 3300039437 | Ga0436365_0156147 | Ga0436365_0156147_251_1099 | 276 |
| 322 | 3300039437 | Ga0436365_1144419 | Ga0436365_1144419_6832_7665 | 276 |
| 323 | 3300039437 | Ga0436365_1654024 | Ga0436365_1654024_245_1078 | 276 |
| 324 | 3300039438 | Ga0436360_0347015 | Ga0436360_0347015_1883_2716 | 276 |
| 325 | 3300039450 | Ga0436363_1191658 | Ga0436363_1191658_4154_4987 | 276 |
| 326 | 3300039450 | Ga0436363_1702804 | Ga0436363_1702804_6981_7814 | 276 |
| 327 | 3300042156 | Ga0439446_0004602 | Ga0439446_0004602_1717_2550 | 276 |
| 328 | 3300042436 | Ga0439435_0000998 | Ga0439435_0000998_3497_4330 | 276 |
| 329 | 3300042437 | Ga0439444_0006073 | Ga0439444_0006073_247_1080 | 276 |
| 330 | 3300042876 | Ga0451577_0015507 | Ga0451577_0015507_3122_3952 | 276 |
| 331 | 3300042876 | Ga0451577_0081549 | Ga0451577_0081549_1682_2515 | 276 |
| 332 | 3300044656 | Ga0466969_0014779 | Ga0466969_0014779_754_1587 | 276 |
| 333 | 3300044656 | Ga0466969_0043304 | Ga0466969_0043304_25_858 | 276 |
| 334 | 3300044684 | Ga0466966_0005277 | Ga0466966_0005277_6780_7613 | 276 |
| 335 | 3300044706 | Ga0466964_0000540 | Ga0466964_0000540_4443_5276 | 276 |
| 336 | 3300044712 | Ga0453684_0043231 | Ga0453684_0043231_4075_4908 | 276 |
| 337 | 3300044712 | Ga0453684_0048320 | Ga0453684_0048320_2509_3342 | 276 |
| 338 | 3300044712 | Ga0453684_0459249 | Ga0453684_0459249_466_1296 | 276 |
| 339 | 3300044842 | Ga0466957_0076854 | Ga0466957_0076854_921_1754 | 276 |
| 340 | 3300045049 | Ga0466959_0015193 | Ga0466959_0015193_3145_3978 | 276 |
| 341 | 3300045049 | Ga0466959_0100972 | Ga0466959_0100972_1145_1978 | 276 |
| 342 | 3300045051 | Ga0451576_0028243 | Ga0451576_0028243_4987_5820 | 276 |
| 343 | 3300045976 | Ga0466967_0172127 | Ga0466967_0172127_930_1778 | 276 |
| 344 | 3300046472 | Ga0495580_0001636 | Ga0495580_0001636_3564_4406 | 276 |
| 345 | 3300046506 | Ga0495583_0114948 | Ga0495583_0114948_19_852 | 276 |
| 346 | 3300046517 | Ga0495630_0033201 | Ga0495630_0033201_1148_1990 | 276 |
| 347 | 3300046533 | Ga0495640_0156661 | Ga0495640_0156661_473_1315 | 276 |
| 348 | 3300046678 | Ga0495599_0038253 | Ga0495599_0038253_1469_2311 | 276 |
| 349 | 3300046680 | Ga0495646_0188868 | Ga0495646_0188868_189_1031 | 276 |
| 350 | 3300047317 | Ga0495604_0154996 | Ga0495604_0154996_554_1396 | 276 |
| 351 | 3300048088 | Ga0495602_0021748 | Ga0495602_0021748_3810_4652 | 276 |
| 352 | 3300048903 | Ga0496100_0035122 | Ga0496100_0035122_1582_2424 | 276 |
| 353 | 3300048903 | Ga0496100_0204456 | Ga0496100_0204456_441_1274 | 276 |
| 354 | 3300048904 | Ga0496101_0014901 | Ga0496101_0014901_2012_2854 | 276 |
| 355 | 3300048905 | Ga0496102_0017776 | Ga0496102_0017776_2060_2902 | 276 |
| 356 | 3300048907 | Ga0496104_0002130 | Ga0496104_0002130_13487_14320 | 276 |
| 357 | 3300048908 | Ga0496105_0039471 | Ga0496105_0039471_735_1568 | 276 |
| 358 | 3300048908 | Ga0496105_0065355 | Ga0496105_0065355_1423_2265 | 276 |
| 359 | 3300048910 | Ga0496107_0016316 | Ga0496107_0016316_2097_2939 | 276 |
| 360 | 3300048911 | Ga0496108_0039878 | Ga0496108_0039878_1962_2804 | 276 |
| 361 | 3300048912 | Ga0496109_0042638 | Ga0496109_0042638_1598_2440 | 276 |
| 362 | 3300048912 | Ga0496109_0109526 | Ga0496109_0109526_937_1770 | 276 |
| 363 | 3300048913 | Ga0496110_0011315 | Ga0496110_0011315_2248_3081 | 276 |
| 364 | 3300048913 | Ga0496110_0141473 | Ga0496110_0141473_1276_2118 | 276 |
| 365 | 3300048914 | Ga0496111_0002909 | Ga0496111_0002909_2053_2886 | 276 |
| 366 | 3300048917 | Ga0496114_0069026 | Ga0496114_0069026_1576_2418 | 276 |
| 367 | 3300048918 | Ga0496115_0010179 | Ga0496115_0010179_2330_3172 | 276 |
| 368 | 3300048924 | Ga0496121_0387522 | Ga0496121_0387522_37_870 | 276 |
| 369 | 3300049574 | Ga0501038_0000828 | Ga0501038_0000828_17561_18397 | 276 |
| 370 | 3300049581 | Ga0501047_0337423 | Ga0501047_0337423_451_1284 | 276 |
| 371 | 3300049583 | Ga0501067_0000436 | Ga0501067_0000436_966_1799 | 276 |
| 372 | 3300049584 | Ga0501068_0089279 | Ga0501068_0089279_301_1143 | 276 |
| 373 | 3300049587 | Ga0501071_0000729 | Ga0501071_0000729_2927_3769 | 276 |
| 374 | 3300049588 | Ga0501072_0047682 | Ga0501072_0047682_2095_2937 | 276 |
| 375 | 3300049589 | Ga0501073_0003248 | Ga0501073_0003248_10267_11100 | 276 |
| 376 | 3300049591 | Ga0501075_0021687 | Ga0501075_0021687_2253_3095 | 276 |
| 377 | 3300049591 | Ga0501075_0352275 | Ga0501075_0352275_31_864 | 276 |
| 378 | 3300049592 | Ga0501076_0176980 | Ga0501076_0176980_469_1302 | 276 |
| 379 | 3300049593 | Ga0501077_0024080 | Ga0501077_0024080_195_1028 | 276 |
| 380 | 3300049742 | Ga0501080_0005463 | Ga0501080_0005463_10486_11328 | 276 |
| 381 | 3300049742 | Ga0501080_0037717 | Ga0501080_0037717_840_1673 | 276 |
| 382 | 3300049744 | Ga0501083_0137168 | Ga0501083_0137168_157_990 | 276 |
| 383 | 3300050507 | nmdc:mga05p37_285769_c1 | nmdc:mga05p37_285769_c1_971_1804 | 276 |
| 384 | 3300050508 | nmdc:mga09592_23527_c1 | nmdc:mga09592_23527_c1_3375_4208 | 276 |
| 385 | 3300050510 | nmdc:mga06r32_121613_c1 | nmdc:mga06r32_121613_c1_207_1040 | 276 |
| 386 | 3300050510 | nmdc:mga06r32_52980_c1 | nmdc:mga06r32_52980_c1_2903_3736 | 276 |
| 387 | 3300050511 | nmdc:mga08y16_214405_c1 | nmdc:mga08y16_214405_c1_811_1644 | 276 |
| 388 | 3300050515 | nmdc:mga0a205_463914_c1 | nmdc:mga0a205_463914_c1_71_910 | 276 |
| 389 | 3300053104 | Ga0500556_0000152 | Ga0500556_0000152_45928_46761 | 276 |
| 390 | 3300053153 | Ga0500616_0000032 | Ga0500616_0000032_261997_262839 | 276 |
| 391 | 3300060353 | Ga0501082_0012681 | Ga0501082_0012681_4281_5114 | 276 |
| 392 | 3300061719 | Ga0466962_0006324 | Ga0466962_0006324_3998_4831 | 276 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6mdy-assembly1.cif.gz_A | crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 | 0.9657 | 1 | 272 |
| 6mdy-assembly1.cif.gz_C | crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 | 0.9643 | 1 | 270 |
| 6mdy-assembly1.cif.gz_B | crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 | 0.9628 | 1 | 272 |
| 3fs2-assembly1.cif.gz_B | crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from bruciella melitensis at 1.85a resolution | 0.9582 | 8 | 269 |
| 6mdy-assembly1.cif.gz_A | crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 | 0.9539 | 1 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1fwtA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9479 | 12 | 268 | 3.20.20.70 |
| 1o60D00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.932 | 2 | 271 | 3.20.20.70 |
| 1fwtA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9235 | 12 | 268 | 3.20.20.70 |
| 3t4cC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9076 | 1 | 274 | 3.20.20.70 |
| 4z1aA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9015 | 12 | 265 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2I2A2C0-F1-model_v4 | 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) | 0.9809 | 1 | 141 |
GO:0005737
GO:0008676 GO:0009103 |
| AF-A0A1Y5EX63-F1-model_v4 | 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) | 0.9746 | 1 | 123 |
GO:0005737
GO:0008676 GO:0009103 |
| AF-A0A536Y5B0-F1-model_v4 | 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) | 0.97 | 1 | 158 |
GO:0005737
GO:0008676 GO:0009103 |
| AF-A0A3N5KW82-F1-model_v4 | 2-dehydro-3-deoxyphosphooctonate aldolase (EC 2.5.1.55) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthase) (KDO-8-phosphate synthase) (KDO 8-P synthase) (KDOPS) (Phospho-2-dehydro-3-deoxyoctonate aldolase) | 0.9696 | 1 | 276 |
GO:0005737
GO:0008676 GO:0019294 |
| AF-Q3SL44-F1-model_v4 | 2-dehydro-3-deoxyphosphooctonate aldolase (EC 2.5.1.55) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthase) (KDO-8-phosphate synthase) (KDO 8-P synthase) (KDOPS) (Phospho-2-dehydro-3-deoxyoctonate aldolase) | 0.9685 | 1 | 275 |
GO:0005737
GO:0008676 GO:0019294 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar