F432236

General Info

Members Datasets Scaffolds Average Seq Length
392 244 392 278

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100269135|Ga0070682_1002691352
Length 300
Sequence MKLGSHDVGLERPFFLIAGPCVIESATLTQEIAGRLREITQRLRIPFVFKASYDKANRSSRASYRGPGLEGGLKVLQEVRKQFGVPVLTDVHEDTPLAEVAAVVDVLQTPAFLCRQTNFIVSAASQGKPVNIKKGQFLSPWEMRNVVDKARSTGNDAILVCERGFSFGYNNLVSDMRSLSIMRETDCPVVFDATHSVQLPGGKGTASGGQREFIPVLARAAVASGVSGLFMETHPEPSKALSDGPNAWPLDRMEPLLITLKQLDEAVKARPLEETLLRASPELLTGFARGRASPLREAKS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
143 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
144 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
145 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
157 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
158 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
172 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
173 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
174 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
175 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
181 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
240 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 2.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 4.08
Rhizosphere 90.05
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2581737 2162886007 Bacteria 1938
2 JGI25406J46586_10004938 3300003203 Bacteria 6194
3 Ga0065704_10001819 3300005289 Bacteria 12043
4 Ga0065707_10083189 3300005295 Bacteria 10076
5 Ga0070658_10045812 3300005327 Bacteria 3537
6 Ga0070658_10459953 3300005327 Bacteria 1097
7 Ga0070676_10039971 3300005328 Bacteria 2714
8 Ga0070683_100038299 3300005329 Bacteria 4394
9 Ga0070690_100014489 3300005330 Bacteria 4678
10 Ga0070690_100045953 3300005330 Bacteria 2776
11 Ga0070670_100175666 3300005331 Bacteria 1859
12 Ga0070677_10075904 3300005333 Bacteria 1426
13 Ga0070666_10004512 3300005335 Bacteria 8484
14 Ga0070666_10063356 3300005335 Bacteria 2506
15 Ga0070680_100042941 3300005336 Bacteria 3670
16 Ga0070680_100045046 3300005336 Bacteria 3585
17 Ga0070680_100192095 3300005336 Bacteria 1720
18 Ga0070682_100269135 3300005337 Bacteria 1237
19 Ga0068868_100003680 3300005338 Bacteria 10710
20 Ga0068868_100075678 3300005338 Bacteria 2691
21 Ga0070668_100023812 3300005347 Bacteria 4635
22 Ga0070669_100037541 3300005353 Bacteria 3514
23 Ga0070675_100021095 3300005354 Bacteria 5202
24 Ga0070671_100009266 3300005355 Bacteria 7909
25 Ga0070671_100060269 3300005355 Bacteria 3160
26 Ga0070674_100021852 3300005356 Bacteria 4117
27 Ga0070673_100055271 3300005364 Bacteria 3127
28 Ga0070667_100000068 3300005367 Bacteria 127663
29 Ga0070667_100003283 3300005367 Bacteria 13816
30 Ga0070667_100027990 3300005367 Bacteria 4690
31 Ga0070709_10012650 3300005434 Bacteria 4727
32 Ga0070709_10174699 3300005434 Bacteria 1504
33 Ga0070713_100000837 3300005436 Bacteria 19662
34 Ga0070713_100106649 3300005436 Bacteria 2436
35 Ga0070711_100000311 3300005439 Bacteria 25257
36 Ga0070678_100005775 3300005456 Bacteria 7198
37 Ga0070662_100011141 3300005457 Bacteria 5923
38 Ga0070681_10004492 3300005458 Bacteria 13307
39 Ga0070681_10082236 3300005458 Bacteria 3175
40 Ga0070681_10086684 3300005458 Bacteria 3084
41 Ga0070681_10105802 3300005458 Bacteria 2756
42 Ga0070681_10371575 3300005458 Bacteria 1340
43 Ga0070707_100428808 3300005468 Bacteria 1283
44 Ga0070699_100129987 3300005518 Bacteria 2220
45 Ga0070679_100007158 3300005530 Bacteria 10412
46 Ga0070679_100072577 3300005530 Bacteria 3434
47 Ga0070679_100140989 3300005530 Bacteria 2390
48 Ga0070684_100199307 3300005535 Bacteria 1823
49 Ga0068853_100176870 3300005539 Bacteria 1933
50 Ga0070672_100019844 3300005543 Bacteria 4890
51 Ga0070686_100191625 3300005544 Bacteria 1459
52 Ga0070665_100000697 3300005548 Bacteria 44802
53 Ga0070665_100006033 3300005548 Bacteria 12380
54 Ga0070665_100015281 3300005548 Bacteria 7707
55 Ga0068855_100046131 3300005563 Bacteria 5152
56 Ga0068855_100201950 3300005563 Bacteria 2237
57 Ga0068855_100223878 3300005563 Bacteria 2108
58 Ga0068855_100268023 3300005563 Bacteria 1900
59 Ga0068854_100059252 3300005578 Bacteria 2766
60 Ga0068856_100067009 3300005614 Bacteria 3548
61 Ga0068856_100318342 3300005614 Bacteria 1573
62 Ga0068852_100072462 3300005616 Bacteria 3028
63 Ga0068859_100044796 3300005617 Bacteria 4445
64 Ga0068864_100396941 3300005618 Bacteria 1310
65 Ga0068861_100005711 3300005719 Bacteria 8435
66 Ga0068851_10101836 3300005834 Bacteria 1525
67 Ga0068863_100016691 3300005841 Bacteria 7045
68 Ga0068863_100027766 3300005841 Bacteria 5401
69 Ga0068858_100007259 3300005842 Bacteria 10736
70 Ga0068858_100093487 3300005842 Bacteria 2799
71 Ga0068860_100022026 3300005843 Bacteria 6168
72 Ga0068860_100056242 3300005843 Bacteria 3741
73 Ga0068862_100007821 3300005844 Bacteria 8842
74 Ga0081539_10000004 3300005985 Bacteria 555600
75 Ga0070716_100018840 3300006173 Bacteria 3600
76 Ga0070712_100004864 3300006175 Bacteria 8304
77 Ga0070712_100094819 3300006175 Bacteria 2194
78 Ga0075366_10023873 3300006195 Bacteria 3563
79 Ga0097621_100024685 3300006237 Bacteria 4697
80 Ga0097621_100051404 3300006237 Bacteria 3354
81 Ga0097621_100180103 3300006237 Bacteria 1826
82 Ga0068871_100033543 3300006358 Bacteria 4066
83 Ga0075428_100023966 3300006844 Bacteria 6753
84 Ga0075430_100022271 3300006846 Bacteria 5389
85 Ga0075431_100038305 3300006847 Bacteria 4936
86 Ga0068865_100017596 3300006881 Bacteria 4599
87 Ga0097620_100044797 3300006931 Bacteria 4445
88 Ga0105240_10003535 3300009093 Bacteria 24236
89 Ga0105240_10035089 3300009093 Bacteria 6467
90 Ga0105240_10035623 3300009093 Bacteria 6412
91 Ga0105240_10075495 3300009093 Bacteria 4157
92 Ga0105240_10155882 3300009093 Bacteria 2716
93 Ga0105240_10161244 3300009093 Bacteria 2663
94 Ga0105240_10505627 3300009093 Bacteria 1343
95 Ga0111539_10007684 3300009094 Bacteria 13772
96 Ga0105245_10191836 3300009098 Bacteria 1957
97 Ga0105247_10081013 3300009101 Bacteria 2046
98 Ga0114129_10146449 3300009147 Bacteria 3235
99 Ga0105243_10370448 3300009148 Bacteria 1321
100 Ga0105241_10049924 3300009174 Bacteria 3188
101 Ga0105242_10001990 3300009176 Bacteria 16074
102 Ga0105242_10018258 3300009176 Bacteria 5482
103 Ga0105242_10171464 3300009176 Bacteria 1907
104 Ga0105248_10006124 3300009177 Bacteria 13196
105 Ga0105248_10053010 3300009177 Bacteria 4552
106 Ga0105237_10211678 3300009545 Bacteria 1938
107 Ga0105237_10414697 3300009545 Bacteria 1352
108 Ga0105238_10002167 3300009551 Bacteria 19836
109 Ga0105238_10068178 3300009551 Bacteria 3559
110 Ga0105238_10303847 3300009551 Bacteria 1579
111 Ga0105238_10340727 3300009551 Bacteria 1487
112 Ga0105238_10414646 3300009551 Bacteria 1341
113 Ga0105030_107476 3300009987 Bacteria 929
114 Ga0105239_10039150 3300010375 Bacteria 5194
115 Ga0105239_10067733 3300010375 Bacteria 3922
116 Ga0105239_10772253 3300010375 Bacteria 1100
117 Ga0157370_10004311 3300013104 Bacteria 16348
118 Ga0157369_10064073 3300013105 Bacteria 3959
119 Ga0157369_10129511 3300013105 Bacteria 2674
120 Ga0157374_10003025 3300013296 Bacteria 14090
121 Ga0157374_10008461 3300013296 Bacteria 8798
122 Ga0157374_10617729 3300013296 Bacteria 1094
123 Ga0157378_10017897 3300013297 Bacteria 6220
124 Ga0157378_10031781 3300013297 Bacteria 4663
125 Ga0157378_10046063 3300013297 Bacteria 3877
126 Ga0163162_10009016 3300013306 Bacteria 9697
127 Ga0163162_10034120 3300013306 Bacteria 5062
128 Ga0157372_10052964 3300013307 Bacteria 4521
129 Ga0157375_10015518 3300013308 Bacteria 6821
130 Ga0163163_10101457 3300014325 Bacteria 2900
131 Ga0163163_10126029 3300014325 Bacteria 2599
132 Ga0163163_10335894 3300014325 Bacteria 1566
133 Ga0157380_10003144 3300014326 Bacteria 11267
134 Ga0157380_10062123 3300014326 Bacteria 2991
135 Ga0157380_10229970 3300014326 Bacteria 1665
136 Ga0157379_10002563 3300014968 Bacteria 15248
137 Ga0157379_10039845 3300014968 Bacteria 4192
138 Ga0157379_10077741 3300014968 Bacteria 2971
139 Ga0157379_10231950 3300014968 Bacteria 1673
140 Ga0157379_10303226 3300014968 Bacteria 1456
141 Ga0157376_10000400 3300014969 Bacteria 28297
142 Ga0163161_10091437 3300017792 Bacteria 2252
143 Ga0213876_10026429 3300021384 Bacteria 3061
144 Ga0207656_10155417 3300025321 Bacteria 1085
145 Ga0207682_10078364 3300025893 Bacteria 1412
146 Ga0207692_10036363 3300025898 Bacteria 2400
147 Ga0207680_10014471 3300025903 Bacteria 4085
148 Ga0207680_10048539 3300025903 Bacteria 2523
149 Ga0207680_10071238 3300025903 Bacteria 2154
150 Ga0207699_10004969 3300025906 Bacteria 6360
151 Ga0207645_10000328 3300025907 Bacteria 39622
152 Ga0207643_10155583 3300025908 Bacteria 1373
153 Ga0207654_10099383 3300025911 Bacteria 1790
154 Ga0207707_10004603 3300025912 Bacteria 12114
155 Ga0207707_10034444 3300025912 Bacteria 4431
156 Ga0207707_10092523 3300025912 Bacteria 2642
157 Ga0207695_10019870 3300025913 Bacteria 7718
158 Ga0207695_10027990 3300025913 Bacteria 6264
159 Ga0207695_10046321 3300025913 Bacteria 4610
160 Ga0207695_10046530 3300025913 Bacteria 4599
161 Ga0207695_10067027 3300025913 Bacteria 3684
162 Ga0207695_10148399 3300025913 Bacteria 2286
163 Ga0207695_10265249 3300025913 Bacteria 1614
164 Ga0207695_10321300 3300025913 Bacteria 1437
165 Ga0207671_10025320 3300025914 Bacteria 4457
166 Ga0207671_10059443 3300025914 Bacteria 2834
167 Ga0207693_10000462 3300025915 Bacteria 37190
168 Ga0207693_10154989 3300025915 Bacteria 1802
169 Ga0207663_10058791 3300025916 Bacteria 2428
170 Ga0207660_10003894 3300025917 Bacteria 9727
171 Ga0207660_10107441 3300025917 Bacteria 2094
172 Ga0207660_10277379 3300025917 Bacteria 1329
173 Ga0207652_10033769 3300025921 Bacteria 4309
174 Ga0207694_10006259 3300025924 Bacteria 9089
175 Ga0207694_10016134 3300025924 Bacteria 5637
176 Ga0207694_10042880 3300025924 Bacteria 3491
177 Ga0207694_10086640 3300025924 Bacteria 2466
178 Ga0207694_10291891 3300025924 Bacteria 1341
179 Ga0207694_10350463 3300025924 Bacteria 1222
180 Ga0207687_10220634 3300025927 Bacteria 1493
181 Ga0207700_10023287 3300025928 Bacteria 4266
182 Ga0207700_10123203 3300025928 Bacteria 2105
183 Ga0207700_10135503 3300025928 Bacteria 2017
184 Ga0207644_10132680 3300025931 Bacteria 1909
185 Ga0207706_10000476 3300025933 Bacteria 42949
186 Ga0207686_10103693 3300025934 Bacteria 1904
187 Ga0207709_10258366 3300025935 Bacteria 1276
188 Ga0207704_10178006 3300025938 Bacteria 1533
189 Ga0207665_10039754 3300025939 Bacteria 3136
190 Ga0207691_10000632 3300025940 Bacteria 34796
191 Ga0207691_10170805 3300025940 Bacteria 1904
192 Ga0207711_10043186 3300025941 Bacteria 3844
193 Ga0207711_10066646 3300025941 Bacteria 3114
194 Ga0207661_10413930 3300025944 Bacteria 1224
195 Ga0207667_10000859 3300025949 Bacteria 39082
196 Ga0207667_10195662 3300025949 Bacteria 2074
197 Ga0207651_10078361 3300025960 Bacteria 2370
198 Ga0207712_10116355 3300025961 Bacteria 2014
199 Ga0207668_10046217 3300025972 Bacteria 2974
200 Ga0207658_10000325 3300025986 Bacteria 48105
201 Ga0207658_10007697 3300025986 Bacteria 7336
202 Ga0207658_10368306 3300025986 Bacteria 1255
203 Ga0207677_10050859 3300026023 Bacteria 2806
204 Ga0207677_10146147 3300026023 Bacteria 1817
205 Ga0207703_10000663 3300026035 Bacteria 34425
206 Ga0207703_10022060 3300026035 Bacteria 4989
207 Ga0207703_10056609 3300026035 Bacteria 3194
208 Ga0207702_10198005 3300026078 Bacteria 1860
209 Ga0207702_10212113 3300026078 Bacteria 1801
210 Ga0207641_10009947 3300026088 Bacteria 7827
211 Ga0207648_10000334 3300026089 Bacteria 51629
212 Ga0207676_10354375 3300026095 Bacteria 1358
213 Ga0207676_10417725 3300026095 Bacteria 1257
214 Ga0207674_10290989 3300026116 Bacteria 1582
215 Ga0207675_100000130 3300026118 Bacteria 63098
216 Ga0207683_10016700 3300026121 Bacteria 6246
217 Ga0209999_1013918 3300027543 Bacteria 1458
218 Ga0209982_1003044 3300027552 Bacteria 2373
219 Ga0209983_1000042 3300027665 Bacteria 17996
220 Ga0209998_10000179 3300027717 Bacteria 23068
221 Ga0209974_10006986 3300027876 Bacteria 3908
222 Ga0207428_10215614 3300027907 Bacteria 1441
223 Ga0268266_10000834 3300028379 Bacteria 40263
224 Ga0268266_10151126 3300028379 Bacteria 2093
225 Ga0268265_10052172 3300028380 Bacteria 3091
226 Ga0268265_10126145 3300028380 Bacteria 2118
227 Ga0268264_10000057 3300028381 Bacteria 309824
228 Ga0268264_10000165 3300028381 Bacteria 147648
229 Ga0268264_10029410 3300028381 Bacteria 4499
230 Ga0268264_10042280 3300028381 Bacteria 3772
231 Ga0265334_10011614 3300028573 Bacteria 3704
232 Ga0307515_10001344 3300028794 Bacteria 55675
233 Ga0307515_10100996 3300028794 Bacteria 3487
234 Ga0307515_10159820 3300028794 Bacteria 2305
235 Ga0265338_10056287 3300028800 Bacteria 3489
236 Ga0265340_10009378 3300031247 Bacteria 5257
237 Ga0265331_10003538 3300031250 Bacteria 10028
238 Ga0307509_10000013 3300031507 Bacteria 283027
239 Ga0265313_10114437 3300031595 Bacteria 1183
240 Ga0316575_10024763 3300031665 Bacteria 2325
241 Ga0316579_10009069 3300031691 Bacteria 4173
242 Ga0316579_10075152 3300031691 Bacteria 1605
243 Ga0316576_10001053 3300031727 Bacteria 14312
244 Ga0316576_10010217 3300031727 Bacteria 6088
245 Ga0316576_10010704 3300031727 Bacteria 5974
246 Ga0316578_10274712 3300031728 Bacteria 1009
247 Ga0307516_10038616 3300031730 Bacteria 4763
248 Ga0307405_10115797 3300031731 Bacteria 1824
249 Ga0307405_10440676 3300031731 Bacteria 1030
250 Ga0316577_10004130 3300031733 Bacteria 7454
251 Ga0316577_10020033 3300031733 Bacteria 3706
252 Ga0307410_10046860 3300031852 Bacteria 2886
253 Ga0307410_10272478 3300031852 Bacteria 1324
254 Ga0307406_10109301 3300031901 Bacteria 1900
255 Ga0307412_10045788 3300031911 Bacteria 2862
256 Ga0307409_100183615 3300031995 Bacteria 1854
257 Ga0307416_100283273 3300032002 Bacteria 1636
258 Ga0307411_10187143 3300032005 Bacteria 1577
259 Ga0307411_10195749 3300032005 Bacteria 1547
260 Ga0307415_100040511 3300032126 Bacteria 3086
261 Ga0307415_100115831 3300032126 Bacteria 1998
262 Ga0316585_10025264 3300032137 Bacteria 1841
263 Ga0316585_10098832 3300032137 Bacteria 956
264 Ga0316580_10007402 3300032139 Bacteria 3269
265 Ga0316593_10001327 3300032168 Bacteria 5402
266 Ga0316593_10001575 3300032168 Bacteria 5082
267 Ga0316593_10002241 3300032168 Bacteria 4527
268 Ga0316593_10004559 3300032168 Bacteria 3570
269 Ga0316593_10012909 3300032168 Bacteria 2462
270 Ga0316587_1010243 3300033529 Bacteria 1498
271 Ga0316596_1001513 3300033541 Bacteria 4720
272 Ga0316596_1039626 3300033541 Bacteria 1236
273 Ga0373954_0119860 3300035118 Bacteria 1277
274 Ga0373954_0135007 3300035118 Bacteria 1202
275 Ga0373955_0037553 3300035172 Bacteria 2576
276 Ga0316574_0007383 3300035398 Bacteria 6025
277 Ga0316574_0235024 3300035398 Bacteria 1172
278 Ga0373927_0023860 3300035695 Bacteria 4002
279 Ga0373927_0184050 3300035695 Bacteria 1370
280 Ga0373933_0036152 3300035724 Bacteria 2889
281 Ga0373947_0029991 3300035725 Bacteria 3193
282 Ga0373937_0026022 3300036401 Bacteria 5286
283 Ga0316582_0010241 3300036647 Bacteria 5125
284 Ga0316582_0034781 3300036647 Bacteria 3106
285 Ga0316582_0231935 3300036647 Bacteria 1264
286 Ga0316584_0002382 3300036712 Bacteria 11867
287 Ga0316584_0003101 3300036712 Bacteria 10726
288 Ga0316584_0033419 3300036712 Bacteria 3810
289 Ga0316584_0048932 3300036712 Bacteria 3159
290 Ga0316584_0113485 3300036712 Bacteria 2027
291 Ga0316584_0465631 3300036712 Bacteria 892
292 Ga0373925_0042640 3300037068 Bacteria 3366
293 Ga0316581_0020961 3300037588 Bacteria 1917
294 Ga0400490_00276 3300038726 Bacteria 11616
295 Ga0400490_13166 3300038726 Bacteria 2743
296 Ga0400488_49585 3300038741 Bacteria 20652
297 Ga0400486_22372 3300038742 Bacteria 1389
298 Ga0400487_27515 3300039110 Bacteria 45618
299 Ga0436365_0156147 3300039437 Bacteria 1405
300 Ga0436365_1144419 3300039437 Bacteria 9133
301 Ga0436365_1654024 3300039437 Bacteria 1528
302 Ga0436360_0347015 3300039438 Bacteria 4104
303 Ga0436363_1191658 3300039450 Bacteria 7321
304 Ga0436363_1690332 3300039450 Bacteria 1425
305 Ga0436363_1702804 3300039450 Bacteria 8666
306 Ga0439446_0004602 3300042156 Bacteria 3501
307 Ga0439435_0000998 3300042436 Bacteria 4956
308 Ga0439435_0077042 3300042436 Bacteria 996
309 Ga0439444_0006073 3300042437 Bacteria 1812
310 Ga0451577_0015507 3300042876 Bacteria 7088
311 Ga0451577_0081549 3300042876 Bacteria 2885
312 Ga0466969_0014779 3300044656 Bacteria 4101
313 Ga0466969_0043304 3300044656 Bacteria 2244
314 Ga0466966_0005277 3300044684 Bacteria 8493
315 Ga0466964_0000540 3300044706 Bacteria 11854
316 Ga0453684_0043231 3300044712 Bacteria 6059
317 Ga0453684_0048320 3300044712 Bacteria 5629
318 Ga0453684_0459249 3300044712 Bacteria 1416
319 Ga0466957_0076854 3300044842 Bacteria 2074
320 Ga0466959_0015193 3300045049 Bacteria 5607
321 Ga0466959_0100972 3300045049 Bacteria 2065
322 Ga0451576_0028243 3300045051 Bacteria 6012
323 Ga0466967_0172127 3300045976 Bacteria 2038
324 Ga0495580_0001636 3300046472 Bacteria 19707
325 Ga0495583_0114948 3300046506 Bacteria 1137
326 Ga0495630_0033201 3300046517 Bacteria 3849
327 Ga0495640_0156661 3300046533 Bacteria 1462
328 Ga0495599_0038253 3300046678 Bacteria 3015
329 Ga0495646_0188868 3300046680 Bacteria 1127
330 Ga0495604_0154996 3300047317 Bacteria 1624
331 Ga0495602_0021748 3300048088 Bacteria 6302
332 Ga0496100_0035122 3300048903 Bacteria 3151
333 Ga0496100_0204456 3300048903 Bacteria 1441
334 Ga0496101_0014901 3300048904 Bacteria 5231
335 Ga0496102_0017776 3300048905 Bacteria 6234
336 Ga0496104_0002130 3300048907 Bacteria 17171
337 Ga0496105_0039471 3300048908 Bacteria 3891
338 Ga0496105_0065355 3300048908 Bacteria 3002
339 Ga0496107_0016316 3300048910 Bacteria 5213
340 Ga0496108_0039878 3300048911 Bacteria 3914
341 Ga0496109_0042638 3300048912 Bacteria 4111
342 Ga0496109_0109526 3300048912 Bacteria 2567
343 Ga0496110_0011315 3300048913 Bacteria 7297
344 Ga0496110_0141473 3300048913 Bacteria 2175
345 Ga0496111_0002909 3300048914 Bacteria 10462
346 Ga0496114_0069026 3300048917 Bacteria 2967
347 Ga0496115_0010179 3300048918 Bacteria 7018
348 Ga0496121_0387522 3300048924 Bacteria 920
349 Ga0501032_0076987 3300049569 Bacteria 2221
350 Ga0501033_0003546 3300049570 Bacteria 12763
351 Ga0501034_0020412 3300049571 Bacteria 6764
352 Ga0501036_0083525 3300049572 Bacteria 2700
353 Ga0501037_0002476 3300049573 Bacteria 13336
354 Ga0501038_0000828 3300049574 Bacteria 27543
355 Ga0501038_0021026 3300049574 Bacteria 5863
356 Ga0501039_0161315 3300049575 Bacteria 1762
357 Ga0501046_0175879 3300049580 Bacteria 1603
358 Ga0501047_0093220 3300049581 Bacteria 2891
359 Ga0501047_0337423 3300049581 Bacteria 1345
360 Ga0501067_0000436 3300049583 Bacteria 22842
361 Ga0501067_0049245 3300049583 Bacteria 2335
362 Ga0501068_0089279 3300049584 Bacteria 1900
363 Ga0501071_0000729 3300049587 Bacteria 17355
364 Ga0501072_0047682 3300049588 Bacteria 3374
365 Ga0501073_0003248 3300049589 Bacteria 12199
366 Ga0501073_0009519 3300049589 Bacteria 7171
367 Ga0501073_0283683 3300049589 Bacteria 1143
368 Ga0501074_0035030 3300049590 Bacteria 3638
369 Ga0501075_0021687 3300049591 Bacteria 4685
370 Ga0501075_0352275 3300049591 Bacteria 1122
371 Ga0501076_0176980 3300049592 Bacteria 1739
372 Ga0501077_0024080 3300049593 Bacteria 3863
373 Ga0501080_0005463 3300049742 Bacteria 11342
374 Ga0501080_0014481 3300049742 Bacteria 7264
375 Ga0501080_0037717 3300049742 Bacteria 4513
376 Ga0501083_0019407 3300049744 Bacteria 4737
377 Ga0501083_0137168 3300049744 Bacteria 1603
378 Ga0501035_0059897 3300049822 Bacteria 3391
379 Ga0501044_0001571 3300049823 Bacteria 26728
380 nmdc:mga05p37_285769_c1 3300050507 Bacteria 1965
381 nmdc:mga09592_23527_c1 3300050508 Bacteria 5089
382 nmdc:mga06r32_121613_c1 3300050510 Bacteria 2576
383 nmdc:mga06r32_52980_c1 3300050510 Bacteria 3887
384 nmdc:mga08y16_214405_c1 3300050511 Bacteria 1994
385 nmdc:mga0a205_463914_c1 3300050515 Bacteria 1126
386 Ga0500646_0035919 3300053090 Bacteria 1379
387 Ga0500556_0000152 3300053104 Bacteria 57878
388 Ga0500616_0000032 3300053153 Bacteria 403673
389 Ga0500622_0003563 3300053156 Bacteria 10287
390 Ga0501082_0012681 3300060353 Bacteria 7243
391 Ga0501082_0026289 3300060353 Bacteria 5015
392 Ga0466962_0006324 3300061719 Bacteria 5682

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0465631 Ga0316584_0465631_11_742 238
2 3300049744 Ga0501083_0019407 Ga0501083_0019407_18_788 243
3 3300037068 Ga0373925_0042640 Ga0373925_0042640_2606_3352 245
4 3300049589 Ga0501073_0283683 Ga0501073_0283683_360_1109 247
5 3300042436 Ga0439435_0077042 Ga0439435_0077042_188_958 255
6 3300039450 Ga0436363_1690332 Ga0436363_1690332_542_1375 256
7 3300032168 Ga0316593_10012909 Ga0316593_100129092 262
8 3300049569 Ga0501032_0076987 Ga0501032_0076987_1085_1918 264
9 3300049570 Ga0501033_0003546 Ga0501033_0003546_10365_11198 264
10 3300049571 Ga0501034_0020412 Ga0501034_0020412_4780_5613 264
11 3300049572 Ga0501036_0083525 Ga0501036_0083525_282_1115 264
12 3300049573 Ga0501037_0002476 Ga0501037_0002476_8130_8963 264
13 3300049574 Ga0501038_0021026 Ga0501038_0021026_4958_5791 264
14 3300049575 Ga0501039_0161315 Ga0501039_0161315_845_1678 264
15 3300049580 Ga0501046_0175879 Ga0501046_0175879_702_1535 264
16 3300049581 Ga0501047_0093220 Ga0501047_0093220_1201_2034 264
17 3300049583 Ga0501067_0049245 Ga0501067_0049245_122_955 264
18 3300049589 Ga0501073_0009519 Ga0501073_0009519_4616_5449 264
19 3300049590 Ga0501074_0035030 Ga0501074_0035030_1512_2345 264
20 3300049742 Ga0501080_0014481 Ga0501080_0014481_3182_4015 264
21 3300049822 Ga0501035_0059897 Ga0501035_0059897_2004_2837 264
22 3300049823 Ga0501044_0001571 Ga0501044_0001571_3995_4828 264
23 3300060353 Ga0501082_0026289 Ga0501082_0026289_80_913 264
24 3300028794 Ga0307515_10001344 Ga0307515_100013443 267
25 3300053090 Ga0500646_0035919 Ga0500646_0035919_374_1180 267
26 3300053156 Ga0500622_0003563 Ga0500622_0003563_7082_7888 267
27 3300005327 Ga0070658_10459953 Ga0070658_104599532 271
28 3300009093 Ga0105240_10505627 Ga0105240_105056272 271
29 3300025913 Ga0207695_10321300 Ga0207695_103213002 271
30 3300035695 Ga0373927_0023860 Ga0373927_0023860_1892_2710 271
31 3300031730 Ga0307516_10038616 Ga0307516_100386164 272
32 3300005434 Ga0070709_10174699 Ga0070709_101746992 274
33 3300014326 Ga0157380_10229970 Ga0157380_102299702 274
34 3300005436 Ga0070713_100106649 Ga0070713_1001066492 275
35 3300005548 Ga0070665_100000697 Ga0070665_1000006977 275
36 3300009093 Ga0105240_10161244 Ga0105240_101612442 275
37 3300009545 Ga0105237_10414697 Ga0105237_104146972 275
38 3300010375 Ga0105239_10772253 Ga0105239_107722532 275
39 3300014968 Ga0157379_10077741 Ga0157379_100777412 275
40 3300025913 Ga0207695_10148399 Ga0207695_101483992 275
41 3300028379 Ga0268266_10000834 Ga0268266_1000083422 275
42 2162886007 SwRhRL2b_contig_2581737 SwRhRL2b_0339.00005140 276
43 3300003203 JGI25406J46586_10004938 JGI25406J46586_100049383 276
44 3300005289 Ga0065704_10001819 Ga0065704_1000181912 276
45 3300005295 Ga0065707_10083189 Ga0065707_100831897 276
46 3300005327 Ga0070658_10045812 Ga0070658_100458122 276
47 3300005328 Ga0070676_10039971 Ga0070676_100399711 276
48 3300005329 Ga0070683_100038299 Ga0070683_1000382994 276
49 3300005330 Ga0070690_100014489 Ga0070690_1000144893 276
50 3300005330 Ga0070690_100045953 Ga0070690_1000459532 276
51 3300005331 Ga0070670_100175666 Ga0070670_1001756662 276
52 3300005333 Ga0070677_10075904 Ga0070677_100759042 276
53 3300005335 Ga0070666_10004512 Ga0070666_100045123 276
54 3300005335 Ga0070666_10063356 Ga0070666_100633562 276
55 3300005336 Ga0070680_100042941 Ga0070680_1000429413 276
56 3300005336 Ga0070680_100045046 Ga0070680_1000450463 276
57 3300005336 Ga0070680_100192095 Ga0070680_1001920952 276
58 3300005337 Ga0070682_100269135 Ga0070682_1002691352 276
59 3300005338 Ga0068868_100003680 Ga0068868_1000036803 276
60 3300005338 Ga0068868_100075678 Ga0068868_1000756782 276
61 3300005347 Ga0070668_100023812 Ga0070668_1000238124 276
62 3300005353 Ga0070669_100037541 Ga0070669_1000375415 276
63 3300005354 Ga0070675_100021095 Ga0070675_1000210953 276
64 3300005355 Ga0070671_100009266 Ga0070671_1000092663 276
65 3300005355 Ga0070671_100060269 Ga0070671_1000602692 276
66 3300005356 Ga0070674_100021852 Ga0070674_1000218523 276
67 3300005364 Ga0070673_100055271 Ga0070673_1000552714 276
68 3300005367 Ga0070667_100000068 Ga0070667_100000068111 276
69 3300005367 Ga0070667_100003283 Ga0070667_1000032835 276
70 3300005367 Ga0070667_100027990 Ga0070667_1000279904 276
71 3300005434 Ga0070709_10012650 Ga0070709_100126502 276
72 3300005436 Ga0070713_100000837 Ga0070713_10000083712 276
73 3300005439 Ga0070711_100000311 Ga0070711_1000003113 276
74 3300005456 Ga0070678_100005775 Ga0070678_1000057753 276
75 3300005457 Ga0070662_100011141 Ga0070662_1000111416 276
76 3300005458 Ga0070681_10004492 Ga0070681_100044922 276
77 3300005458 Ga0070681_10082236 Ga0070681_100822362 276
78 3300005458 Ga0070681_10086684 Ga0070681_100866842 276
79 3300005458 Ga0070681_10105802 Ga0070681_101058023 276
80 3300005458 Ga0070681_10371575 Ga0070681_103715752 276
81 3300005468 Ga0070707_100428808 Ga0070707_1004288082 276
82 3300005518 Ga0070699_100129987 Ga0070699_1001299872 276
83 3300005530 Ga0070679_100007158 Ga0070679_1000071582 276
84 3300005530 Ga0070679_100072577 Ga0070679_1000725773 276
85 3300005530 Ga0070679_100140989 Ga0070679_1001409892 276
86 3300005535 Ga0070684_100199307 Ga0070684_1001993072 276
87 3300005539 Ga0068853_100176870 Ga0068853_1001768702 276
88 3300005543 Ga0070672_100019844 Ga0070672_1000198444 276
89 3300005544 Ga0070686_100191625 Ga0070686_1001916252 276
90 3300005548 Ga0070665_100006033 Ga0070665_1000060331 276
91 3300005548 Ga0070665_100015281 Ga0070665_1000152816 276
92 3300005563 Ga0068855_100046131 Ga0068855_1000461313 276
93 3300005563 Ga0068855_100201950 Ga0068855_1002019502 276
94 3300005563 Ga0068855_100223878 Ga0068855_1002238782 276
95 3300005563 Ga0068855_100268023 Ga0068855_1002680232 276
96 3300005578 Ga0068854_100059252 Ga0068854_1000592522 276
97 3300005614 Ga0068856_100067009 Ga0068856_1000670093 276
98 3300005614 Ga0068856_100318342 Ga0068856_1003183422 276
99 3300005616 Ga0068852_100072462 Ga0068852_1000724622 276
100 3300005617 Ga0068859_100044796 Ga0068859_1000447964 276
101 3300005618 Ga0068864_100396941 Ga0068864_1003969412 276
102 3300005719 Ga0068861_100005711 Ga0068861_1000057113 276
103 3300005834 Ga0068851_10101836 Ga0068851_101018362 276
104 3300005841 Ga0068863_100016691 Ga0068863_1000166913 276
105 3300005841 Ga0068863_100027766 Ga0068863_1000277667 276
106 3300005842 Ga0068858_100007259 Ga0068858_1000072594 276
107 3300005842 Ga0068858_100093487 Ga0068858_1000934872 276
108 3300005843 Ga0068860_100022026 Ga0068860_1000220265 276
109 3300005843 Ga0068860_100056242 Ga0068860_1000562422 276
110 3300005844 Ga0068862_100007821 Ga0068862_1000078214 276
111 3300005985 Ga0081539_10000004 Ga0081539_10000004265 276
112 3300006173 Ga0070716_100018840 Ga0070716_1000188403 276
113 3300006175 Ga0070712_100004864 Ga0070712_1000048642 276
114 3300006175 Ga0070712_100094819 Ga0070712_1000948192 276
115 3300006195 Ga0075366_10023873 Ga0075366_100238732 276
116 3300006237 Ga0097621_100024685 Ga0097621_1000246855 276
117 3300006237 Ga0097621_100051404 Ga0097621_1000514042 276
118 3300006237 Ga0097621_100180103 Ga0097621_1001801032 276
119 3300006358 Ga0068871_100033543 Ga0068871_1000335432 276
120 3300006844 Ga0075428_100023966 Ga0075428_1000239662 276
121 3300006846 Ga0075430_100022271 Ga0075430_1000222712 276
122 3300006847 Ga0075431_100038305 Ga0075431_1000383052 276
123 3300006881 Ga0068865_100017596 Ga0068865_1000175963 276
124 3300006931 Ga0097620_100044797 Ga0097620_1000447974 276
125 3300009093 Ga0105240_10003535 Ga0105240_100035352 276
126 3300009093 Ga0105240_10035089 Ga0105240_100350892 276
127 3300009093 Ga0105240_10035623 Ga0105240_100356232 276
128 3300009093 Ga0105240_10075495 Ga0105240_100754952 276
129 3300009093 Ga0105240_10155882 Ga0105240_101558822 276
130 3300009094 Ga0111539_10007684 Ga0111539_100076845 276
131 3300009098 Ga0105245_10191836 Ga0105245_101918362 276
132 3300009101 Ga0105247_10081013 Ga0105247_100810132 276
133 3300009147 Ga0114129_10146449 Ga0114129_101464492 276
134 3300009148 Ga0105243_10370448 Ga0105243_103704482 276
135 3300009174 Ga0105241_10049924 Ga0105241_100499242 276
136 3300009176 Ga0105242_10001990 Ga0105242_1000199012 276
137 3300009176 Ga0105242_10018258 Ga0105242_100182584 276
138 3300009176 Ga0105242_10171464 Ga0105242_101714642 276
139 3300009177 Ga0105248_10006124 Ga0105248_100061246 276
140 3300009177 Ga0105248_10053010 Ga0105248_100530105 276
141 3300009545 Ga0105237_10211678 Ga0105237_102116781 276
142 3300009551 Ga0105238_10002167 Ga0105238_1000216711 276
143 3300009551 Ga0105238_10068178 Ga0105238_100681783 276
144 3300009551 Ga0105238_10303847 Ga0105238_103038472 276
145 3300009551 Ga0105238_10340727 Ga0105238_103407272 276
146 3300009551 Ga0105238_10414646 Ga0105238_104146462 276
147 3300009987 Ga0105030_107476 Ga0105030_1074761 276
148 3300010375 Ga0105239_10039150 Ga0105239_100391503 276
149 3300010375 Ga0105239_10067733 Ga0105239_100677332 276
150 3300013104 Ga0157370_10004311 Ga0157370_100043113 276
151 3300013105 Ga0157369_10064073 Ga0157369_100640732 276
152 3300013105 Ga0157369_10129511 Ga0157369_101295112 276
153 3300013296 Ga0157374_10003025 Ga0157374_100030257 276
154 3300013296 Ga0157374_10008461 Ga0157374_100084619 276
155 3300013296 Ga0157374_10617729 Ga0157374_106177291 276
156 3300013297 Ga0157378_10017897 Ga0157378_100178977 276
157 3300013297 Ga0157378_10031781 Ga0157378_100317813 276
158 3300013297 Ga0157378_10046063 Ga0157378_100460635 276
159 3300013306 Ga0163162_10009016 Ga0163162_100090169 276
160 3300013306 Ga0163162_10034120 Ga0163162_100341202 276
161 3300013307 Ga0157372_10052964 Ga0157372_100529642 276
162 3300013308 Ga0157375_10015518 Ga0157375_100155183 276
163 3300014325 Ga0163163_10101457 Ga0163163_101014572 276
164 3300014325 Ga0163163_10126029 Ga0163163_101260292 276
165 3300014325 Ga0163163_10335894 Ga0163163_103358942 276
166 3300014326 Ga0157380_10003144 Ga0157380_1000314411 276
167 3300014326 Ga0157380_10062123 Ga0157380_100621232 276
168 3300014968 Ga0157379_10002563 Ga0157379_1000256311 276
169 3300014968 Ga0157379_10039845 Ga0157379_100398452 276
170 3300014968 Ga0157379_10231950 Ga0157379_102319502 276
171 3300014968 Ga0157379_10303226 Ga0157379_103032262 276
172 3300014969 Ga0157376_10000400 Ga0157376_1000040014 276
173 3300017792 Ga0163161_10091437 Ga0163161_100914372 276
174 3300021384 Ga0213876_10026429 Ga0213876_100264292 276
175 3300025321 Ga0207656_10155417 Ga0207656_101554172 276
176 3300025893 Ga0207682_10078364 Ga0207682_100783642 276
177 3300025898 Ga0207692_10036363 Ga0207692_100363632 276
178 3300025903 Ga0207680_10014471 Ga0207680_100144713 276
179 3300025903 Ga0207680_10048539 Ga0207680_100485392 276
180 3300025903 Ga0207680_10071238 Ga0207680_100712382 276
181 3300025906 Ga0207699_10004969 Ga0207699_100049697 276
182 3300025907 Ga0207645_10000328 Ga0207645_1000032829 276
183 3300025908 Ga0207643_10155583 Ga0207643_101555832 276
184 3300025911 Ga0207654_10099383 Ga0207654_100993832 276
185 3300025912 Ga0207707_10004603 Ga0207707_1000460311 276
186 3300025912 Ga0207707_10034444 Ga0207707_100344442 276
187 3300025912 Ga0207707_10092523 Ga0207707_100925232 276
188 3300025913 Ga0207695_10019870 Ga0207695_100198707 276
189 3300025913 Ga0207695_10027990 Ga0207695_100279902 276
190 3300025913 Ga0207695_10046321 Ga0207695_100463215 276
191 3300025913 Ga0207695_10046530 Ga0207695_100465302 276
192 3300025913 Ga0207695_10067027 Ga0207695_100670272 276
193 3300025913 Ga0207695_10265249 Ga0207695_102652492 276
194 3300025914 Ga0207671_10025320 Ga0207671_100253202 276
195 3300025914 Ga0207671_10059443 Ga0207671_100594432 276
196 3300025915 Ga0207693_10000462 Ga0207693_1000046212 276
197 3300025915 Ga0207693_10154989 Ga0207693_101549892 276
198 3300025916 Ga0207663_10058791 Ga0207663_100587912 276
199 3300025917 Ga0207660_10003894 Ga0207660_100038949 276
200 3300025917 Ga0207660_10107441 Ga0207660_101074412 276
201 3300025917 Ga0207660_10277379 Ga0207660_102773792 276
202 3300025921 Ga0207652_10033769 Ga0207652_100337693 276
203 3300025924 Ga0207694_10006259 Ga0207694_1000625910 276
204 3300025924 Ga0207694_10016134 Ga0207694_100161345 276
205 3300025924 Ga0207694_10042880 Ga0207694_100428803 276
206 3300025924 Ga0207694_10086640 Ga0207694_100866402 276
207 3300025924 Ga0207694_10291891 Ga0207694_102918912 276
208 3300025924 Ga0207694_10350463 Ga0207694_103504631 276
209 3300025927 Ga0207687_10220634 Ga0207687_102206342 276
210 3300025928 Ga0207700_10023287 Ga0207700_100232873 276
211 3300025928 Ga0207700_10123203 Ga0207700_101232032 276
212 3300025928 Ga0207700_10135503 Ga0207700_101355032 276
213 3300025931 Ga0207644_10132680 Ga0207644_101326802 276
214 3300025933 Ga0207706_10000476 Ga0207706_1000047615 276
215 3300025934 Ga0207686_10103693 Ga0207686_101036932 276
216 3300025935 Ga0207709_10258366 Ga0207709_102583662 276
217 3300025938 Ga0207704_10178006 Ga0207704_101780062 276
218 3300025939 Ga0207665_10039754 Ga0207665_100397542 276
219 3300025940 Ga0207691_10000632 Ga0207691_1000063229 276
220 3300025940 Ga0207691_10170805 Ga0207691_101708052 276
221 3300025941 Ga0207711_10043186 Ga0207711_100431863 276
222 3300025941 Ga0207711_10066646 Ga0207711_100666462 276
223 3300025944 Ga0207661_10413930 Ga0207661_104139301 276
224 3300025949 Ga0207667_10000859 Ga0207667_100008593 276
225 3300025949 Ga0207667_10195662 Ga0207667_101956622 276
226 3300025960 Ga0207651_10078361 Ga0207651_100783612 276
227 3300025961 Ga0207712_10116355 Ga0207712_101163552 276
228 3300025972 Ga0207668_10046217 Ga0207668_100462172 276
229 3300025986 Ga0207658_10000325 Ga0207658_1000032522 276
230 3300025986 Ga0207658_10007697 Ga0207658_100076978 276
231 3300025986 Ga0207658_10368306 Ga0207658_103683061 276
232 3300026023 Ga0207677_10050859 Ga0207677_100508592 276
233 3300026023 Ga0207677_10146147 Ga0207677_101461472 276
234 3300026035 Ga0207703_10000663 Ga0207703_1000066323 276
235 3300026035 Ga0207703_10022060 Ga0207703_100220602 276
236 3300026035 Ga0207703_10056609 Ga0207703_100566093 276
237 3300026078 Ga0207702_10198005 Ga0207702_101980052 276
238 3300026078 Ga0207702_10212113 Ga0207702_102121132 276
239 3300026088 Ga0207641_10009947 Ga0207641_1000994710 276
240 3300026089 Ga0207648_10000334 Ga0207648_1000033429 276
241 3300026095 Ga0207676_10354375 Ga0207676_103543752 276
242 3300026095 Ga0207676_10417725 Ga0207676_104177252 276
243 3300026116 Ga0207674_10290989 Ga0207674_102909892 276
244 3300026118 Ga0207675_100000130 Ga0207675_10000013028 276
245 3300026121 Ga0207683_10016700 Ga0207683_100167006 276
246 3300027543 Ga0209999_1013918 Ga0209999_10139182 276
247 3300027552 Ga0209982_1003044 Ga0209982_10030442 276
248 3300027665 Ga0209983_1000042 Ga0209983_100004219 276
249 3300027717 Ga0209998_10000179 Ga0209998_1000017920 276
250 3300027876 Ga0209974_10006986 Ga0209974_100069863 276
251 3300027907 Ga0207428_10215614 Ga0207428_102156142 276
252 3300028379 Ga0268266_10151126 Ga0268266_101511262 276
253 3300028380 Ga0268265_10052172 Ga0268265_100521722 276
254 3300028380 Ga0268265_10126145 Ga0268265_101261452 276
255 3300028381 Ga0268264_10000057 Ga0268264_10000057116 276
256 3300028381 Ga0268264_10000165 Ga0268264_10000165132 276
257 3300028381 Ga0268264_10029410 Ga0268264_100294102 276
258 3300028381 Ga0268264_10042280 Ga0268264_100422802 276
259 3300028573 Ga0265334_10011614 Ga0265334_100116142 276
260 3300028794 Ga0307515_10100996 Ga0307515_101009964 276
261 3300028794 Ga0307515_10159820 Ga0307515_101598202 276
262 3300028800 Ga0265338_10056287 Ga0265338_100562872 276
263 3300031247 Ga0265340_10009378 Ga0265340_100093784 276
264 3300031250 Ga0265331_10003538 Ga0265331_100035386 276
265 3300031507 Ga0307509_10000013 Ga0307509_1000001391 276
266 3300031595 Ga0265313_10114437 Ga0265313_101144372 276
267 3300031665 Ga0316575_10024763 Ga0316575_100247632 276
268 3300031691 Ga0316579_10009069 Ga0316579_100090692 276
269 3300031691 Ga0316579_10075152 Ga0316579_100751522 276
270 3300031727 Ga0316576_10001053 Ga0316576_100010539 276
271 3300031727 Ga0316576_10010217 Ga0316576_100102178 276
272 3300031727 Ga0316576_10010704 Ga0316576_100107045 276
273 3300031728 Ga0316578_10274712 Ga0316578_102747122 276
274 3300031731 Ga0307405_10115797 Ga0307405_101157972 276
275 3300031731 Ga0307405_10440676 Ga0307405_104406761 276
276 3300031733 Ga0316577_10004130 Ga0316577_100041304 276
277 3300031733 Ga0316577_10020033 Ga0316577_100200332 276
278 3300031852 Ga0307410_10046860 Ga0307410_100468602 276
279 3300031852 Ga0307410_10272478 Ga0307410_102724782 276
280 3300031901 Ga0307406_10109301 Ga0307406_101093012 276
281 3300031911 Ga0307412_10045788 Ga0307412_100457882 276
282 3300031995 Ga0307409_100183615 Ga0307409_1001836152 276
283 3300032002 Ga0307416_100283273 Ga0307416_1002832732 276
284 3300032005 Ga0307411_10187143 Ga0307411_101871432 276
285 3300032005 Ga0307411_10195749 Ga0307411_101957492 276
286 3300032126 Ga0307415_100040511 Ga0307415_1000405112 276
287 3300032126 Ga0307415_100115831 Ga0307415_1001158312 276
288 3300032137 Ga0316585_10025264 Ga0316585_100252641 276
289 3300032137 Ga0316585_10098832 Ga0316585_100988321 276
290 3300032139 Ga0316580_10007402 Ga0316580_100074023 276
291 3300032168 Ga0316593_10001327 Ga0316593_100013278 276
292 3300032168 Ga0316593_10001575 Ga0316593_100015754 276
293 3300032168 Ga0316593_10002241 Ga0316593_100022414 276
294 3300032168 Ga0316593_10004559 Ga0316593_100045594 276
295 3300033529 Ga0316587_1010243 Ga0316587_10102432 276
296 3300033541 Ga0316596_1001513 Ga0316596_10015134 276
297 3300033541 Ga0316596_1039626 Ga0316596_10396262 276
298 3300035118 Ga0373954_0119860 Ga0373954_0119860_353_1195 276
299 3300035118 Ga0373954_0135007 Ga0373954_0135007_220_1062 276
300 3300035172 Ga0373955_0037553 Ga0373955_0037553_88_930 276
301 3300035398 Ga0316574_0007383 Ga0316574_0007383_4588_5421 276
302 3300035398 Ga0316574_0235024 Ga0316574_0235024_297_1145 276
303 3300035695 Ga0373927_0184050 Ga0373927_0184050_131_973 276
304 3300035724 Ga0373933_0036152 Ga0373933_0036152_1644_2486 276
305 3300035725 Ga0373947_0029991 Ga0373947_0029991_1102_1944 276
306 3300036401 Ga0373937_0026022 Ga0373937_0026022_3175_4017 276
307 3300036647 Ga0316582_0010241 Ga0316582_0010241_2180_3013 276
308 3300036647 Ga0316582_0034781 Ga0316582_0034781_1672_2505 276
309 3300036647 Ga0316582_0231935 Ga0316582_0231935_10_843 276
310 3300036712 Ga0316584_0002382 Ga0316584_0002382_9362_10195 276
311 3300036712 Ga0316584_0003101 Ga0316584_0003101_4070_4903 276
312 3300036712 Ga0316584_0033419 Ga0316584_0033419_2197_3030 276
313 3300036712 Ga0316584_0048932 Ga0316584_0048932_25_864 276
314 3300036712 Ga0316584_0113485 Ga0316584_0113485_1062_1895 276
315 3300037588 Ga0316581_0020961 Ga0316581_0020961_228_1061 276
316 3300038726 Ga0400490_00276 Ga0400490_00276_254_1087 276
317 3300038726 Ga0400490_13166 Ga0400490_13166_779_1612 276
318 3300038741 Ga0400488_49585 Ga0400488_49585_3930_4763 276
319 3300038742 Ga0400486_22372 Ga0400486_22372_311_1150 276
320 3300039110 Ga0400487_27515 Ga0400487_27515_34298_35143 276
321 3300039437 Ga0436365_0156147 Ga0436365_0156147_251_1099 276
322 3300039437 Ga0436365_1144419 Ga0436365_1144419_6832_7665 276
323 3300039437 Ga0436365_1654024 Ga0436365_1654024_245_1078 276
324 3300039438 Ga0436360_0347015 Ga0436360_0347015_1883_2716 276
325 3300039450 Ga0436363_1191658 Ga0436363_1191658_4154_4987 276
326 3300039450 Ga0436363_1702804 Ga0436363_1702804_6981_7814 276
327 3300042156 Ga0439446_0004602 Ga0439446_0004602_1717_2550 276
328 3300042436 Ga0439435_0000998 Ga0439435_0000998_3497_4330 276
329 3300042437 Ga0439444_0006073 Ga0439444_0006073_247_1080 276
330 3300042876 Ga0451577_0015507 Ga0451577_0015507_3122_3952 276
331 3300042876 Ga0451577_0081549 Ga0451577_0081549_1682_2515 276
332 3300044656 Ga0466969_0014779 Ga0466969_0014779_754_1587 276
333 3300044656 Ga0466969_0043304 Ga0466969_0043304_25_858 276
334 3300044684 Ga0466966_0005277 Ga0466966_0005277_6780_7613 276
335 3300044706 Ga0466964_0000540 Ga0466964_0000540_4443_5276 276
336 3300044712 Ga0453684_0043231 Ga0453684_0043231_4075_4908 276
337 3300044712 Ga0453684_0048320 Ga0453684_0048320_2509_3342 276
338 3300044712 Ga0453684_0459249 Ga0453684_0459249_466_1296 276
339 3300044842 Ga0466957_0076854 Ga0466957_0076854_921_1754 276
340 3300045049 Ga0466959_0015193 Ga0466959_0015193_3145_3978 276
341 3300045049 Ga0466959_0100972 Ga0466959_0100972_1145_1978 276
342 3300045051 Ga0451576_0028243 Ga0451576_0028243_4987_5820 276
343 3300045976 Ga0466967_0172127 Ga0466967_0172127_930_1778 276
344 3300046472 Ga0495580_0001636 Ga0495580_0001636_3564_4406 276
345 3300046506 Ga0495583_0114948 Ga0495583_0114948_19_852 276
346 3300046517 Ga0495630_0033201 Ga0495630_0033201_1148_1990 276
347 3300046533 Ga0495640_0156661 Ga0495640_0156661_473_1315 276
348 3300046678 Ga0495599_0038253 Ga0495599_0038253_1469_2311 276
349 3300046680 Ga0495646_0188868 Ga0495646_0188868_189_1031 276
350 3300047317 Ga0495604_0154996 Ga0495604_0154996_554_1396 276
351 3300048088 Ga0495602_0021748 Ga0495602_0021748_3810_4652 276
352 3300048903 Ga0496100_0035122 Ga0496100_0035122_1582_2424 276
353 3300048903 Ga0496100_0204456 Ga0496100_0204456_441_1274 276
354 3300048904 Ga0496101_0014901 Ga0496101_0014901_2012_2854 276
355 3300048905 Ga0496102_0017776 Ga0496102_0017776_2060_2902 276
356 3300048907 Ga0496104_0002130 Ga0496104_0002130_13487_14320 276
357 3300048908 Ga0496105_0039471 Ga0496105_0039471_735_1568 276
358 3300048908 Ga0496105_0065355 Ga0496105_0065355_1423_2265 276
359 3300048910 Ga0496107_0016316 Ga0496107_0016316_2097_2939 276
360 3300048911 Ga0496108_0039878 Ga0496108_0039878_1962_2804 276
361 3300048912 Ga0496109_0042638 Ga0496109_0042638_1598_2440 276
362 3300048912 Ga0496109_0109526 Ga0496109_0109526_937_1770 276
363 3300048913 Ga0496110_0011315 Ga0496110_0011315_2248_3081 276
364 3300048913 Ga0496110_0141473 Ga0496110_0141473_1276_2118 276
365 3300048914 Ga0496111_0002909 Ga0496111_0002909_2053_2886 276
366 3300048917 Ga0496114_0069026 Ga0496114_0069026_1576_2418 276
367 3300048918 Ga0496115_0010179 Ga0496115_0010179_2330_3172 276
368 3300048924 Ga0496121_0387522 Ga0496121_0387522_37_870 276
369 3300049574 Ga0501038_0000828 Ga0501038_0000828_17561_18397 276
370 3300049581 Ga0501047_0337423 Ga0501047_0337423_451_1284 276
371 3300049583 Ga0501067_0000436 Ga0501067_0000436_966_1799 276
372 3300049584 Ga0501068_0089279 Ga0501068_0089279_301_1143 276
373 3300049587 Ga0501071_0000729 Ga0501071_0000729_2927_3769 276
374 3300049588 Ga0501072_0047682 Ga0501072_0047682_2095_2937 276
375 3300049589 Ga0501073_0003248 Ga0501073_0003248_10267_11100 276
376 3300049591 Ga0501075_0021687 Ga0501075_0021687_2253_3095 276
377 3300049591 Ga0501075_0352275 Ga0501075_0352275_31_864 276
378 3300049592 Ga0501076_0176980 Ga0501076_0176980_469_1302 276
379 3300049593 Ga0501077_0024080 Ga0501077_0024080_195_1028 276
380 3300049742 Ga0501080_0005463 Ga0501080_0005463_10486_11328 276
381 3300049742 Ga0501080_0037717 Ga0501080_0037717_840_1673 276
382 3300049744 Ga0501083_0137168 Ga0501083_0137168_157_990 276
383 3300050507 nmdc:mga05p37_285769_c1 nmdc:mga05p37_285769_c1_971_1804 276
384 3300050508 nmdc:mga09592_23527_c1 nmdc:mga09592_23527_c1_3375_4208 276
385 3300050510 nmdc:mga06r32_121613_c1 nmdc:mga06r32_121613_c1_207_1040 276
386 3300050510 nmdc:mga06r32_52980_c1 nmdc:mga06r32_52980_c1_2903_3736 276
387 3300050511 nmdc:mga08y16_214405_c1 nmdc:mga08y16_214405_c1_811_1644 276
388 3300050515 nmdc:mga0a205_463914_c1 nmdc:mga0a205_463914_c1_71_910 276
389 3300053104 Ga0500556_0000152 Ga0500556_0000152_45928_46761 276
390 3300053153 Ga0500616_0000032 Ga0500616_0000032_261997_262839 276
391 3300060353 Ga0501082_0012681 Ga0501082_0012681_4281_5114 276
392 3300061719 Ga0466962_0006324 Ga0466962_0006324_3998_4831 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00793

DAHP_synth_1

DAHP synthetase I family

5

269

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mdy-assembly1.cif.gz_A crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 0.9657 1 272
6mdy-assembly1.cif.gz_C crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 0.9643 1 270
6mdy-assembly1.cif.gz_B crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 0.9628 1 272
3fs2-assembly1.cif.gz_B crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from bruciella melitensis at 1.85a resolution 0.9582 8 269
6mdy-assembly1.cif.gz_A crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 0.9539 1 272
ID Description Score Start End Superfamily
1fwtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9479 12 268 3.20.20.70
1o60D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.932 2 271 3.20.20.70
1fwtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9235 12 268 3.20.20.70
3t4cC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9076 1 274 3.20.20.70
4z1aA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9015 12 265 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2I2A2C0-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9809 1 141 GO:0005737
GO:0008676
GO:0009103
AF-A0A1Y5EX63-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9746 1 123 GO:0005737
GO:0008676
GO:0009103
AF-A0A536Y5B0-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.97 1 158 GO:0005737
GO:0008676
GO:0009103
AF-A0A3N5KW82-F1-model_v4 2-dehydro-3-deoxyphosphooctonate aldolase (EC 2.5.1.55) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthase) (KDO-8-phosphate synthase) (KDO 8-P synthase) (KDOPS) (Phospho-2-dehydro-3-deoxyoctonate aldolase) 0.9696 1 276 GO:0005737
GO:0008676
GO:0019294
AF-Q3SL44-F1-model_v4 2-dehydro-3-deoxyphosphooctonate aldolase (EC 2.5.1.55) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthase) (KDO-8-phosphate synthase) (KDO 8-P synthase) (KDOPS) (Phospho-2-dehydro-3-deoxyoctonate aldolase) 0.9685 1 275 GO:0005737
GO:0008676
GO:0019294

Feature Viewer

pLDDT pTM Quality
90.35 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map