metagRoot

F432164

General Info

Members	Datasets	Scaffolds	Average Seq Length
391	244	380	243

Family's Representative Sequence

Representative Sequence	3300049583\|Ga0501067_0306296\|Ga0501067_0306296_14_751
Length	245
Sequence	VEAVILFPAIDLKDGKCVRLLRGDLQQATIFDVAPADQARRFVDAGCEWLHLVDLNGAVEGRPVNRAAVAAILDAVGKLPVQLGGGIRDMETMALWLDAGVRRVILGTVAVRDPALVKDACRQWPGRIAVGIDAREGLVAVDGWTRQSTVKALDLALMFEDVGVSAIIYTDINRDGAMGGVNVDQTVNLAFHLTTPVIASGGVSSLDDLRELKQHEDSGIVGVVAGRSLYDGRIALSEALKLLKA

Samples

	Sample ID	Description	Type	Environment
1	2511231221	Azospirillum lipoferum 4B	Isolate	Rhizosphere
2	2524023250	Niveispirillum irakense DSM 11586	Isolate	Unclassified
3	2597490356	Azospirillum brasilense sp7	Isolate	Unclassified
4	2821443989	Inquilinus ginsengisoli 584	Isolate	Unclassified
5	2840878972	Albibacillus kandeliae J95	Isolate	Rhizosphere
6	2842333319	Skermanella aerolata SEMIA 4010	Isolate	Nodule
7	2844533157	Inquilinus sp. R-72501 v. 2	Isolate	Unclassified
8	2846952575	Azospirillum brasilense sp7	Isolate	Unclassified
9	2848858292	Azospirillum brasilense Az39	Isolate	Unclassified
10	2897803580	Azospirillum doebereinerae GSF71	Isolate	Unclassified
11	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
12	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
13	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
14	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
15	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
16	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
17	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
18	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
19	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
20	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
21	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
22	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
23	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
24	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
25	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
26	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
27	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
28	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
29	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
30	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
31	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
32	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
33	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
34	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
35	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
36	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
37	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
38	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
39	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
40	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
41	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
42	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
43	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
44	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
45	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
46	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
47	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
48	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
49	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
50	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
51	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
52	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
53	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
54	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
55	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
56	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
57	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
58	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
59	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
60	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
61	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
62	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
63	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
64	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
65	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
66	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
67	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
69	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
70	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
71	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
72	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
73	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
75	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
76	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
77	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
78	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
79	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
80	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
81	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
82	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
83	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
84	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
85	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
86	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
87	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
88	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
89	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
90	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
91	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
92	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
131	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
132	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
133	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
134	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
135	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
136	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
137	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
138	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
139	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
140	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
141	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
142	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
143	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
144	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
145	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
146	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
147	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
148	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
149	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
150	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
151	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
152	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
153	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
154	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
155	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
156	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
157	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
158	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
159	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
160	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
161	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
162	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
163	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
164	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
165	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
166	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
167	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
168	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
169	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
170	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
171	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
172	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
173	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
174	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
175	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
176	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
177	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
178	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
179	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
180	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
181	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
182	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
183	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
184	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
185	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
186	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
187	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
188	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
189	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
190	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
191	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
192	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
193	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
194	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
195	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
196	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
197	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
198	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
199	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
200	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
201	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
202	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
203	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
204	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
205	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
206	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
207	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
208	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
209	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
210	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
211	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
212	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
213	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
214	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
215	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
216	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
217	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
219	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
220	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
221	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
222	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
223	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
224	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
225	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
226	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
227	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
228	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
229	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
230	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
231	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
232	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
233	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
234	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
235	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
236	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
237	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
238	3300053733	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere	Metagenome	Endosphere
239	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
240	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
241	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
242	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
243	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
244	8054002106	Azospirillum lipoferum 59b	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	96.68
Metatranscriptomes	0.51
Isolates	2.81

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	7.67
Nodule	0.26
Rhizoplane	1.79
Rhizosphere	86.45
Stem	0
Stem Tuber	0
Unclassified	3.84

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25151J46595_10000240	3300003187	Bacteria	64258
2	JGI25406J46586_10083260	3300003203	Bacteria	977
3	JGI25153J46596_10058464	3300003215	Bacteria	1061
4	Ga0065712_10000441	3300005290	Bacteria	22669
5	Ga0065715_10004929	3300005293	Bacteria	3732
6	Ga0070658_10003411	3300005327	Bacteria	13073
7	Ga0070683_100067502	3300005329	Bacteria	3331
8	Ga0070680_100000442	3300005336	Bacteria	28246
9	Ga0070680_100079570	3300005336	Bacteria	2701
10	Ga0068868_100410924	3300005338	Bacteria	1170
11	Ga0070660_100162051	3300005339	Bacteria	1803
12	Ga0070691_10021335	3300005341	Bacteria	2996
13	Ga0070661_100013093	3300005344	Bacteria	5819
14	Ga0070668_100665498	3300005347	Bacteria	916
15	Ga0070675_100267356	3300005354	Bacteria	1500
16	Ga0070688_100087846	3300005365	Bacteria	2026
17	Ga0070659_100387184	3300005366	Bacteria	1178
18	Ga0070667_100387625	3300005367	Bacteria	1270
19	Ga0070714_100000204	3300005435	Bacteria	47913
20	Ga0070714_100649180	3300005435	Bacteria	1016
21	Ga0070711_100471196	3300005439	Bacteria	1031
22	Ga0070705_100490099	3300005440	Bacteria	931
23	Ga0070708_100202243	3300005445	Bacteria	1860
24	Ga0070678_100524603	3300005456	Unclassified	1048
25	Ga0070681_10020098	3300005458	Bacteria	6692
26	Ga0070706_100113284	3300005467	Bacteria	2526
27	Ga0070706_100328290	3300005467	Bacteria	1427
28	Ga0070707_100291138	3300005468	Bacteria	1587
29	Ga0070698_100007893	3300005471	Bacteria	11520
30	Ga0070699_100353507	3300005518	Bacteria	1324
31	Ga0070679_100006180	3300005530	Bacteria	11147
32	Ga0070697_100043451	3300005536	Bacteria	3639
33	Ga0070672_100578742	3300005543	Bacteria	977
34	Ga0070695_100073209	3300005545	Bacteria	2248
35	Ga0070665_100001288	3300005548	Bacteria	30002
36	Ga0070665_100005222	3300005548	Bacteria	13436
37	Ga0070665_100081488	3300005548	Bacteria	3242
38	Ga0070665_100775372	3300005548	Bacteria	972
39	Ga0068855_100007341	3300005563	Bacteria	13354
40	Ga0068855_100044790	3300005563	Bacteria	5235
41	Ga0070664_100077755	3300005564	Bacteria	2853
42	Ga0068857_100472299	3300005577	Bacteria	1175
43	Ga0068856_100157398	3300005614	Bacteria	2282
44	Ga0068856_100377150	3300005614	Bacteria	1437
45	Ga0068859_100636306	3300005617	Bacteria	1159
46	Ga0068864_100954332	3300005618	Bacteria	849
47	Ga0068851_10231785	3300005834	Bacteria	1041
48	Ga0068860_100013755	3300005843	Bacteria	7934
49	Ga0081455_10011005	3300005937	Bacteria	9117
50	Ga0081455_10015320	3300005937	Bacteria	7455
51	Ga0081455_10128056	3300005937	Bacteria	1989
52	Ga0081540_1045900	3300005983	Bacteria	2212
53	Ga0081539_10001401	3300005985	Bacteria	41535
54	Ga0081539_10013309	3300005985	Bacteria	6209
55	Ga0075365_10173699	3300006038	Bacteria	1505
56	Ga0075365_10173922	3300006038	Bacteria	1503
57	Ga0075365_10258670	3300006038	Bacteria	1224
58	Ga0075363_100238660	3300006048	Bacteria	1045
59	Ga0070716_100141522	3300006173	Bacteria	1535
60	Ga0070712_100119215	3300006175	Bacteria	1983
61	Ga0070712_100127410	3300006175	Bacteria	1925
62	Ga0075362_10005819	3300006177	Bacteria	4547
63	Ga0075362_10007495	3300006177	Bacteria	4135
64	Ga0075362_10102307	3300006177	Bacteria	1341
65	Ga0075369_10002262	3300006186	Bacteria	6836
66	Ga0075369_10071583	3300006186	Bacteria	1526
67	Ga0075428_100048381	3300006844	Bacteria	4667
68	Ga0075430_100030693	3300006846	Bacteria	4565
69	Ga0075430_100171927	3300006846	Bacteria	1803
70	Ga0075431_100004447	3300006847	Bacteria	13747
71	Ga0075431_100077156	3300006847	Unclassified	3439
72	Ga0075431_100238029	3300006847	Unclassified	1853
73	Ga0075433_10002633	3300006852	Bacteria	13703
74	Ga0075433_10059190	3300006852	Bacteria	3351
75	Ga0075433_10328378	3300006852	Bacteria	1353
76	Ga0075434_100001714	3300006871	Bacteria	18781
77	Ga0075434_100053640	3300006871	Bacteria	4005
78	Ga0075434_100060728	3300006871	Unclassified	3760
79	Ga0075429_100080445	3300006880	Bacteria	2841
80	Ga0075429_100243281	3300006880	Unclassified	1576
81	Ga0075436_100027049	3300006914	Bacteria	3950
82	Ga0097620_100636193	3300006931	Bacteria	1159
83	Ga0075435_100120302	3300007076	Bacteria	2191
84	Ga0075435_100260636	3300007076	Bacteria	1477
85	Ga0099794_10209729	3300007265	Bacteria	999
86	Ga0099795_10076630	3300007788	Bacteria	1271
87	Ga0105240_10024088	3300009093	Bacteria	8036
88	Ga0105240_10264290	3300009093	Bacteria	1984
89	Ga0105240_10323758	3300009093	Bacteria	1756
90	Ga0105240_10434582	3300009093	Bacteria	1472
91	Ga0105240_10617468	3300009093	Bacteria	1192
92	Ga0111539_10311396	3300009094	Unclassified	1832
93	Ga0111539_10555451	3300009094	Bacteria	1337
94	Ga0114129_10155344	3300009147	Bacteria	3129
95	Ga0114129_10162983	3300009147	Unclassified	3044
96	Ga0114129_10164395	3300009147	Bacteria	3030
97	Ga0114129_11495914	3300009147	Bacteria	830
98	Ga0105248_11221280	3300009177	Bacteria	850
99	Ga0105237_10470517	3300009545	Bacteria	1263
100	Ga0105238_10009225	3300009551	Bacteria	9873
101	Ga0105238_10336454	3300009551	Bacteria	1497
102	Ga0105239_10057618	3300010375	Bacteria	4262
103	Ga0105246_10661532	3300011119	Bacteria	911
104	Ga0157373_10140298	3300013100	Bacteria	1699
105	Ga0157371_10247602	3300013102	Bacteria	1283
106	Ga0157374_10052624	3300013296	Bacteria	3793
107	Ga0157378_10014338	3300013297	Bacteria	6940
108	Ga0157378_10022279	3300013297	Bacteria	5577
109	Ga0163163_10558327	3300014325	Bacteria	1207
110	Ga0182008_10071323	3300014497	Bacteria	1709
111	Ga0157379_10283349	3300014968	Bacteria	1508
112	Ga0213872_10034348	3300021361	Bacteria	2321
113	Ga0213875_10028441	3300021388	Bacteria	2654
114	Ga0213871_10034962	3300021441	Bacteria	1327
115	Ga0209025_1000179	3300025294	Bacteria	157965
116	Ga0209758_1002547	3300025297	Bacteria	18378
117	Ga0207426_1036926	3300025302	Bacteria	1549
118	Ga0207697_10106779	3300025315	Bacteria	1197
119	Ga0207697_10148729	3300025315	Bacteria	1018
120	Ga0207688_10249560	3300025901	Bacteria	1075
121	Ga0207645_10115946	3300025907	Bacteria	1737
122	Ga0207705_10003414	3300025909	Bacteria	12079
123	Ga0207684_10660804	3300025910	Bacteria	890
124	Ga0207707_10010938	3300025912	Bacteria	7893
125	Ga0207707_10028741	3300025912	Bacteria	4858
126	Ga0207695_10051047	3300025913	Bacteria	4345
127	Ga0207695_10109956	3300025913	Bacteria	2737
128	Ga0207695_10125058	3300025913	Bacteria	2535
129	Ga0207695_10289681	3300025913	Bacteria	1530
130	Ga0207671_10403680	3300025914	Bacteria	1087
131	Ga0207663_10303615	3300025916	Bacteria	1193
132	Ga0207660_10064491	3300025917	Bacteria	2644
133	Ga0207657_10104934	3300025919	Bacteria	2340
134	Ga0207657_10131155	3300025919	Bacteria	2054
135	Ga0207649_10188020	3300025920	Bacteria	1450
136	Ga0207652_10108281	3300025921	Bacteria	2462
137	Ga0207652_10155859	3300025921	Bacteria	2046
138	Ga0207646_10072395	3300025922	Bacteria	3078
139	Ga0207694_10000316	3300025924	Bacteria	45429
140	Ga0207694_10128623	3300025924	Bacteria	2028
141	Ga0207659_10219056	3300025926	Bacteria	1529
142	Ga0207664_10000405	3300025929	Bacteria	30849
143	Ga0207664_10217678	3300025929	Bacteria	1655
144	Ga0207706_10077004	3300025933	Bacteria	2934
145	Ga0207706_10106144	3300025933	Unclassified	2471
146	Ga0207670_10190476	3300025936	Bacteria	1552
147	Ga0207665_10137102	3300025939	Bacteria	1742
148	Ga0207691_10296200	3300025940	Bacteria	1390
149	Ga0207691_10685080	3300025940	Bacteria	865
150	Ga0207689_10216113	3300025942	Bacteria	1584
151	Ga0207661_10093268	3300025944	Bacteria	2512
152	Ga0207667_10024558	3300025949	Bacteria	6614
153	Ga0207667_10665747	3300025949	Bacteria	1045
154	Ga0207651_10284695	3300025960	Unclassified	1368
155	Ga0207712_10651516	3300025961	Bacteria	915
156	Ga0207668_10820423	3300025972	Bacteria	824
157	Ga0207640_10152480	3300025981	Bacteria	1699
158	Ga0207658_10230931	3300025986	Bacteria	1562
159	Ga0207639_10060258	3300026041	Bacteria	2928
160	Ga0207678_10185268	3300026067	Bacteria	1778
161	Ga0207702_10069727	3300026078	Bacteria	3023
162	Ga0207702_10227626	3300026078	Bacteria	1741
163	Ga0207675_100504154	3300026118	Unclassified	1205
164	Ga0209982_1017806	3300027552	Unclassified	1085
165	Ga0209971_1006019	3300027682	Bacteria	2875
166	Ga0209966_1007530	3300027695	Bacteria	1911
167	Ga0268266_10000508	3300028379	Bacteria	54988
168	Ga0268266_10106744	3300028379	Bacteria	2476
169	Ga0268264_10018176	3300028381	Bacteria	5749
170	Ga0268264_10654943	3300028381	Bacteria	1040
171	Ga0265334_10006693	3300028573	Bacteria	4952
172	Ga0265340_10164854	3300031247	Bacteria	1005
173	Ga0265331_10002631	3300031250	Bacteria	12053
174	Ga0265331_10067225	3300031250	Bacteria	1682
175	Ga0265316_10019064	3300031344	Bacteria	5878
176	Ga0265313_10000080	3300031595	Bacteria	95370
177	Ga0307410_10415069	3300031852	Bacteria	1091
178	Ga0307410_10498039	3300031852	Bacteria	1002
179	Ga0307406_10077112	3300031901	Unclassified	2204
180	Ga0307407_10043185	3300031903	Bacteria	2533
181	Ga0307409_100329838	3300031995	Bacteria	1432
182	Ga0307409_100828142	3300031995	Unclassified	935
183	Ga0307409_100880933	3300031995	Bacteria	908
184	Ga0307416_100090226	3300032002	Bacteria	2627
185	Ga0307416_101430740	3300032002	Bacteria	797
186	Ga0307414_10340969	3300032004	Bacteria	1283
187	Ga0307411_10457818	3300032005	Bacteria	1069
188	Ga0307415_100435085	3300032126	Bacteria	1130
189	Ga0373926_0061349	3300035083	Bacteria	1371
190	Ga0373926_0143764	3300035083	Bacteria	907
191	Ga0373945_0056916	3300035116	Unclassified	1451
192	Ga0373943_0026076	3300035170	Bacteria	2736
193	Ga0373924_0164724	3300035410	Bacteria	973
194	Ga0373924_0252501	3300035410	Bacteria	781
195	Ga0373931_0009226	3300035691	Bacteria	4711
196	Ga0373931_0077025	3300035691	Bacteria	1833
197	Ga0373931_0146231	3300035691	Bacteria	1374
198	Ga0373931_0330589	3300035691	Bacteria	949
199	Ga0373935_0047039	3300035692	Unclassified	2726
200	Ga0373935_0361333	3300035692	Bacteria	1037
201	Ga0373927_0152698	3300035695	Bacteria	1512
202	Ga0373933_0592415	3300035724	Bacteria	728
203	Ga0373947_0101573	3300035725	Bacteria	1808
204	Ga0373937_0072009	3300036401	Bacteria	3188
205	Ga0373925_0023167	3300037068	Bacteria	4531
206	Ga0373925_0147961	3300037068	Bacteria	1842
207	Ga0395899_0002111	3300037312	Bacteria	16338
208	Ga0395899_0030459	3300037312	Bacteria	4058
209	Ga0395899_0038162	3300037312	Bacteria	3599
210	Ga0395899_0189361	3300037312	Bacteria	1440
211	Ga0395899_0360473	3300037312	Bacteria	970
212	Ga0395900_0004214	3300037418	Bacteria	15263
213	Ga0395900_0023671	3300037418	Bacteria	6283
214	Ga0395900_0026019	3300037418	Bacteria	5991
215	Ga0395898_0001885	3300037466	Bacteria	26764
216	Ga0395898_0015875	3300037466	Bacteria	7716
217	Ga0395898_0034318	3300037466	Bacteria	5057
218	Ga0395905_0537015	3300037471	Bacteria	1070
219	Ga0436364_1240134	3300037853	Bacteria	27720
220	Ga0395901_0004821	3300038443	Bacteria	13612
221	Ga0395901_0041412	3300038443	Bacteria	4773
222	Ga0395901_0062456	3300038443	Bacteria	3876
223	Ga0395901_0217822	3300038443	Bacteria	1996
224	Ga0400483_085389	3300039062	Bacteria	2662
225	Ga0400483_285891	3300039062	Bacteria	1557
226	Ga0436365_1699085	3300039437	Bacteria	4383
227	Ga0436360_0262816	3300039438	Bacteria	4599
228	Ga0436360_1036658	3300039438	Bacteria	1450
229	Ga0436361_0101602	3300039447	Bacteria	3365
230	Ga0436361_0132672	3300039447	Bacteria	2740
231	Ga0436361_0821000	3300039447	Bacteria	1682
232	Ga0439466_0127497	3300041411	Bacteria	784
233	Ga0439448_0086013	3300042005	Bacteria	1059
234	Ga0466963_0050543	3300044694	Bacteria	2751
235	Ga0466964_0244138	3300044706	Bacteria	882
236	Ga0453684_0419357	3300044712	Bacteria	1495
237	Ga0466960_0056300	3300044901	Bacteria	1914
238	Ga0451576_0000402	3300045051	Bacteria	100964
239	Ga0451576_0125000	3300045051	Unclassified	2680
240	Ga0466967_0183289	3300045976	Bacteria	1976
241	Ga0466967_0529176	3300045976	Bacteria	1159
242	Ga0495603_0248137	3300046455	Bacteria	1025
243	Ga0495580_0036381	3300046472	Unclassified	3535
244	Ga0495594_0152999	3300046499	Bacteria	1310
245	Ga0495610_0027427	3300046512	Bacteria	3026
246	Ga0495668_0275527	3300046616	Bacteria	922
247	Ga0495670_0299419	3300046691	Bacteria	862
248	Ga0495673_0092050	3300047469	Bacteria	1238
249	Ga0495615_0026141	3300048090	Bacteria	1361
250	Ga0496102_0858385	3300048905	Bacteria	830
251	Ga0496104_0225137	3300048907	Bacteria	1788
252	Ga0496110_0158825	3300048913	Bacteria	2049
253	Ga0496112_0015725	3300048915	Bacteria	7068
254	Ga0496112_0322205	3300048915	Bacteria	1490
255	Ga0496114_0272452	3300048917	Bacteria	1492
256	Ga0496115_0368649	3300048918	Bacteria	1169
257	Ga0496122_0173593	3300048925	Bacteria	1295
258	Ga0496126_0044440	3300048929	Bacteria	4091
259	Ga0501031_0005179	3300049568	Bacteria	8500
260	Ga0501032_0035445	3300049569	Bacteria	3410
261	Ga0501033_0027346	3300049570	Bacteria	4288
262	Ga0501034_0005145	3300049571	Bacteria	14352
263	Ga0501034_0005249	3300049571	Bacteria	14219
264	Ga0501034_0034915	3300049571	Bacteria	5100
265	Ga0501034_0040232	3300049571	Bacteria	4733
266	Ga0501034_0237507	3300049571	Bacteria	1770
267	Ga0501034_0817733	3300049571	Bacteria	824
268	Ga0501036_0006342	3300049572	Bacteria	9597
269	Ga0501036_0048610	3300049572	Bacteria	3591
270	Ga0501036_0563764	3300049572	Bacteria	946
271	Ga0501037_0021688	3300049573	Bacteria	4750
272	Ga0501037_0214484	3300049573	Bacteria	1356
273	Ga0501038_0013497	3300049574	Bacteria	7445
274	Ga0501038_0059400	3300049574	Bacteria	3275
275	Ga0501039_0004564	3300049575	Bacteria	10464
276	Ga0501039_0039822	3300049575	Bacteria	3628
277	Ga0501039_0062509	3300049575	Bacteria	2885
278	Ga0501040_0006529	3300049576	Bacteria	7572
279	Ga0501040_0056413	3300049576	Unclassified	2695
280	Ga0501041_0011444	3300049577	Bacteria	5243
281	Ga0501041_0054951	3300049577	Unclassified	2429
282	Ga0501042_0013495	3300049578	Bacteria	5562
283	Ga0501042_0070102	3300049578	Unclassified	2507
284	Ga0501042_0116940	3300049578	Bacteria	1920
285	Ga0501043_0057645	3300049579	Bacteria	3050
286	Ga0501043_0111130	3300049579	Unclassified	2151
287	Ga0501043_0574157	3300049579	Bacteria	835
288	Ga0501046_0045626	3300049580	Bacteria	3481
289	Ga0501046_0173824	3300049580	Bacteria	1615
290	Ga0501046_0257925	3300049580	Bacteria	1281
291	Ga0501047_0121224	3300049581	Bacteria	2497
292	Ga0501047_0149215	3300049581	Bacteria	2214
293	Ga0501047_0232972	3300049581	Bacteria	1694
294	Ga0501048_0034109	3300049582	Bacteria	3674
295	Ga0501067_0306296	3300049583	Bacteria	885
296	Ga0501068_0029234	3300049584	Unclassified	3262
297	Ga0501068_0077535	3300049584	Bacteria	2035
298	Ga0501068_0220360	3300049584	Bacteria	1206
299	Ga0501070_0013267	3300049586	Bacteria	6947
300	Ga0501070_0283262	3300049586	Bacteria	1352
301	Ga0501070_0364380	3300049586	Bacteria	1172
302	Ga0501070_0429152	3300049586	Bacteria	1067
303	Ga0501071_0006536	3300049587	Bacteria	7569
304	Ga0501071_0035121	3300049587	Bacteria	3570
305	Ga0501071_0073337	3300049587	Unclassified	2497
306	Ga0501071_0568316	3300049587	Bacteria	871
307	Ga0501072_0009536	3300049588	Bacteria	7383
308	Ga0501072_0169828	3300049588	Unclassified	1740
309	Ga0501073_0010999	3300049589	Bacteria	6617
310	Ga0501074_0008472	3300049590	Bacteria	7451
311	Ga0501074_0011331	3300049590	Bacteria	6482
312	Ga0501075_0022165	3300049591	Bacteria	4637
313	Ga0501075_0034563	3300049591	Bacteria	3764
314	Ga0501076_0000646	3300049592	Bacteria	22287
315	Ga0501076_0061628	3300049592	Unclassified	2985
316	Ga0501076_0074750	3300049592	Bacteria	2715
317	Ga0501076_0216614	3300049592	Bacteria	1565
318	Ga0501077_0002411	3300049593	Bacteria	11223
319	Ga0501077_0011082	3300049593	Bacteria	5623
320	Ga0501077_0042948	3300049593	Bacteria	2873
321	Ga0501079_0002961	3300049741	Bacteria	12418
322	Ga0501079_0041346	3300049741	Bacteria	3558
323	Ga0501080_0014888	3300049742	Bacteria	7162
324	Ga0501080_0029108	3300049742	Bacteria	5141
325	Ga0501081_0006728	3300049743	Bacteria	7476
326	Ga0501081_0022683	3300049743	Bacteria	4201
327	Ga0501083_0042615	3300049744	Bacteria	3076
328	Ga0501083_0207650	3300049744	Bacteria	1277
329	Ga0501035_0023499	3300049822	Bacteria	5654
330	Ga0501035_0079779	3300049822	Unclassified	2891
331	Ga0501044_0073567	3300049823	Bacteria	3473
332	Ga0501044_0147146	3300049823	Bacteria	2340
333	Ga0501044_0150822	3300049823	Bacteria	2307
334	Ga0501045_0013964	3300049824	Bacteria	5684
335	Ga0501045_0185658	3300049824	Bacteria	1549
336	nmdc:mga03683_150147_c1	3300050489	Bacteria	1051
337	nmdc:mga03683_472_c2	3300050489	Bacteria	11243
338	nmdc:mga0yw44_244910_c1	3300050492	Bacteria	1192
339	nmdc:mga0yw44_90923_c1	3300050492	Bacteria	1929
340	nmdc:mga0k408_329084_c1	3300050493	Bacteria	911
341	nmdc:mga0k408_57973_c1	3300050493	Bacteria	2249
342	nmdc:mga06z11_30591_c1	3300050494	Bacteria	2606
343	nmdc:mga05p37_5806_c1	3300050507	Bacteria	14510
344	nmdc:mga05p37_94940_c1	3300050507	Bacteria	3674
345	nmdc:mga05p37_95491_c1	3300050507	Bacteria	3662
346	nmdc:mga09592_81373_c1	3300050508	Bacteria	2759
347	nmdc:mga0qj67_165161_c1	3300050509	Bacteria	1797
348	nmdc:mga0qj67_58141_c1	3300050509	Bacteria	3065
349	nmdc:mga06r32_236311_c1	3300050510	Unclassified	1815
350	nmdc:mga08y16_106285_c1	3300050511	Bacteria	2921
351	nmdc:mga08y16_510704_c1	3300050511	Bacteria	1220
352	nmdc:mga08y16_78067_c1	3300050511	Unclassified	3452
353	nmdc:mga0n895_17959_c1	3300050512	Bacteria	6537
354	nmdc:mga0n895_19377_c1	3300050512	Bacteria	6323
355	nmdc:mga0n895_43449_c1	3300050512	Bacteria	4379
356	nmdc:mga08x19_14811_c1	3300050514	Bacteria	4735
357	nmdc:mga0a205_15640_c1	3300050515	Bacteria	7092
358	nmdc:mga0a205_204670_c1	3300050515	Bacteria	1863
359	nmdc:mga0a205_254226_c1	3300050515	Bacteria	1636
360	nmdc:mga0a205_26655_c1	3300050515	Bacteria	5514
361	nmdc:mga0a205_413302_c1	3300050515	Bacteria	1212
362	nmdc:mga0sz30_164084_c1	3300050516	Bacteria	984
363	nmdc:mga0sz30_946_c1	3300050516	Bacteria	10411
364	Ga0500641_0001394	3300053096	Bacteria	8614
365	Ga0500595_004230	3300053119	Bacteria	6490
366	Ga0500595_056924	3300053119	Bacteria	1193
367	Ga0500655_048232	3300053133	Bacteria	846
368	Ga0500568_0016313	3300053139	Bacteria	3306
369	Ga0500616_0005724	3300053153	Bacteria	8365
370	Ga0500552_000406	3300053733	Bacteria	3953
371	Ga0501084_0000817	3300054114	Bacteria	23911
372	Ga0501084_0022203	3300054114	Bacteria	5296
373	Ga0501084_0163221	3300054114	Unclassified	1879
374	Ga0587077_020500	3300059493	Bacteria	1163
375	Ga0587111_0019129	3300060346	Bacteria	1296
376	Ga0501082_0015517	3300060353	Bacteria	6558
377	Ga0501082_0241908	3300060353	Unclassified	1570
378	Ga0530510_0001034	3300061734	Bacteria	18415
379	Ga0530510_0014493	3300061734	Bacteria	5560
380	Ga0530510_0056951	3300061734	Unclassified	2824

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300035724	Ga0373933_0592415	Ga0373933_0592415_67_717	215
2	3300048905	Ga0496102_0858385	Ga0496102_0858385_132_791	219
3	3300035695	Ga0373927_0152698	Ga0373927_0152698_808_1485	221
4	3300006846	Ga0075430_100171927	Ga0075430_1001719272	224
5	3300050509	nmdc:mga0qj67_58141_c1	nmdc:mga0qj67_58141_c1_2114_2794	224
6	iso_pu_bacteria	2840878972	2840880406	234
7	3300039062	Ga0400483_285891	Ga0400483_285891_402_1118	237
8	3300049581	Ga0501047_0232972	Ga0501047_0232972_822_1550	237
9	iso_pu_bacteria	2524023250	2524611390	237
10	3300039062	Ga0400483_085389	Ga0400483_085389_1154_1918	238
11	3300006852	Ga0075433_10059190	Ga0075433_100591902	239
12	3300006871	Ga0075434_100001714	Ga0075434_1000017147	239
13	3300009147	Ga0114129_10164395	Ga0114129_101643952	239
14	3300031595	Ga0265313_10000080	Ga0265313_1000008071	239
15	3300050507	nmdc:mga05p37_5806_c1	nmdc:mga05p37_5806_c1_13108_13827	239
16	3300050512	nmdc:mga0n895_17959_c1	nmdc:mga0n895_17959_c1_2731_3450	239
17	3300050512	nmdc:mga0n895_19377_c1	nmdc:mga0n895_19377_c1_3790_4509	239
18	3300050515	nmdc:mga0a205_204670_c1	nmdc:mga0a205_204670_c1_861_1580	239
19	3300050515	nmdc:mga0a205_26655_c1	nmdc:mga0a205_26655_c1_3929_4648	239
20	3300005290	Ga0065712_10000441	Ga0065712_1000044117	240
21	3300005293	Ga0065715_10004929	Ga0065715_100049291	240
22	3300005456	Ga0070678_100524603	Ga0070678_1005246031	240
23	3300005564	Ga0070664_100077755	Ga0070664_1000777553	240
24	3300006844	Ga0075428_100048381	Ga0075428_1000483812	240
25	3300006846	Ga0075430_100030693	Ga0075430_1000306933	240
26	3300006847	Ga0075431_100004447	Ga0075431_10000444710	240
27	3300006847	Ga0075431_100077156	Ga0075431_1000771562	240
28	3300006847	Ga0075431_100238029	Ga0075431_1002380292	240
29	3300006852	Ga0075433_10328378	Ga0075433_103283782	240
30	3300006871	Ga0075434_100053640	Ga0075434_1000536403	240
31	3300006871	Ga0075434_100060728	Ga0075434_1000607282	240
32	3300006880	Ga0075429_100080445	Ga0075429_1000804453	240
33	3300006880	Ga0075429_100243281	Ga0075429_1002432812	240
34	3300007076	Ga0075435_100260636	Ga0075435_1002606362	240
35	3300009094	Ga0111539_10311396	Ga0111539_103113962	240
36	3300009147	Ga0114129_10162983	Ga0114129_101629832	240
37	3300013297	Ga0157378_10014338	Ga0157378_100143382	240
38	3300013297	Ga0157378_10022279	Ga0157378_100222791	240
39	3300025315	Ga0207697_10148729	Ga0207697_101487291	240
40	3300025972	Ga0207668_10820423	Ga0207668_108204231	240
41	3300025986	Ga0207658_10230931	Ga0207658_102309312	240
42	3300026118	Ga0207675_100504154	Ga0207675_1005041541	240
43	3300027552	Ga0209982_1017806	Ga0209982_10178062	240
44	3300027682	Ga0209971_1006019	Ga0209971_10060192	240
45	3300027695	Ga0209966_1007530	Ga0209966_10075303	240
46	3300031852	Ga0307410_10415069	Ga0307410_104150692	240
47	3300031901	Ga0307406_10077112	Ga0307406_100771122	240
48	3300032002	Ga0307416_100090226	Ga0307416_1000902262	240
49	3300035691	Ga0373931_0009226	Ga0373931_0009226_3500_4222	240
50	3300036401	Ga0373937_0072009	Ga0373937_0072009_2272_3006	240
51	3300045051	Ga0451576_0125000	Ga0451576_0125000_564_1286	240
52	3300046691	Ga0495670_0299419	Ga0495670_0299419_123_845	240
53	3300048907	Ga0496104_0225137	Ga0496104_0225137_649_1371	240
54	3300048913	Ga0496110_0158825	Ga0496110_0158825_1166_1888	240
55	3300048915	Ga0496112_0015725	Ga0496112_0015725_3303_4025	240
56	3300049571	Ga0501034_0237507	Ga0501034_0237507_309_1031	240
57	3300049581	Ga0501047_0121224	Ga0501047_0121224_1512_2234	240
58	3300049593	Ga0501077_0042948	Ga0501077_0042948_153_875	240
59	3300050507	nmdc:mga05p37_95491_c1	nmdc:mga05p37_95491_c1_501_1223	240
60	3300050508	nmdc:mga09592_81373_c1	nmdc:mga09592_81373_c1_1085_1807	240
61	3300050510	nmdc:mga06r32_236311_c1	nmdc:mga06r32_236311_c1_417_1139	240
62	3300050511	nmdc:mga08y16_78067_c1	nmdc:mga08y16_78067_c1_2139_2861	240
63	3300050512	nmdc:mga0n895_43449_c1	nmdc:mga0n895_43449_c1_1460_2182	240
64	3300050515	nmdc:mga0a205_254226_c1	nmdc:mga0a205_254226_c1_459_1181	240
65	3300003203	JGI25406J46586_10083260	JGI25406J46586_100832601	241
66	3300005327	Ga0070658_10003411	Ga0070658_100034114	241
67	3300005329	Ga0070683_100067502	Ga0070683_1000675023	241
68	3300005336	Ga0070680_100000442	Ga0070680_10000044223	241
69	3300005336	Ga0070680_100079570	Ga0070680_1000795704	241
70	3300005338	Ga0068868_100410924	Ga0068868_1004109242	241
71	3300005339	Ga0070660_100162051	Ga0070660_1001620512	241
72	3300005341	Ga0070691_10021335	Ga0070691_100213354	241
73	3300005344	Ga0070661_100013093	Ga0070661_1000130937	241
74	3300005347	Ga0070668_100665498	Ga0070668_1006654982	241
75	3300005354	Ga0070675_100267356	Ga0070675_1002673561	241
76	3300005365	Ga0070688_100087846	Ga0070688_1000878462	241
77	3300005366	Ga0070659_100387184	Ga0070659_1003871842	241
78	3300005367	Ga0070667_100387625	Ga0070667_1003876252	241
79	3300005435	Ga0070714_100000204	Ga0070714_10000020437	241
80	3300005435	Ga0070714_100649180	Ga0070714_1006491802	241
81	3300005439	Ga0070711_100471196	Ga0070711_1004711962	241
82	3300005440	Ga0070705_100490099	Ga0070705_1004900991	241
83	3300005445	Ga0070708_100202243	Ga0070708_1002022432	241
84	3300005458	Ga0070681_10020098	Ga0070681_100200987	241
85	3300005467	Ga0070706_100113284	Ga0070706_1001132842	241
86	3300005467	Ga0070706_100328290	Ga0070706_1003282901	241
87	3300005468	Ga0070707_100291138	Ga0070707_1002911382	241
88	3300005471	Ga0070698_100007893	Ga0070698_10000789312	241
89	3300005518	Ga0070699_100353507	Ga0070699_1003535071	241
90	3300005530	Ga0070679_100006180	Ga0070679_1000061808	241
91	3300005543	Ga0070672_100578742	Ga0070672_1005787421	241
92	3300005545	Ga0070695_100073209	Ga0070695_1000732093	241
93	3300005548	Ga0070665_100001288	Ga0070665_10000128831	241
94	3300005548	Ga0070665_100005222	Ga0070665_10000522214	241
95	3300005548	Ga0070665_100081488	Ga0070665_1000814884	241
96	3300005548	Ga0070665_100775372	Ga0070665_1007753721	241
97	3300005563	Ga0068855_100007341	Ga0068855_10000734112	241
98	3300005563	Ga0068855_100044790	Ga0068855_1000447906	241
99	3300005577	Ga0068857_100472299	Ga0068857_1004722992	241
100	3300005614	Ga0068856_100157398	Ga0068856_1001573982	241
101	3300005614	Ga0068856_100377150	Ga0068856_1003771502	241
102	3300005618	Ga0068864_100954332	Ga0068864_1009543321	241
103	3300005937	Ga0081455_10011005	Ga0081455_100110055	241
104	3300005937	Ga0081455_10015320	Ga0081455_100153206	241
105	3300005985	Ga0081539_10001401	Ga0081539_100014017	241
106	3300005985	Ga0081539_10013309	Ga0081539_100133095	241
107	3300006038	Ga0075365_10173699	Ga0075365_101736992	241
108	3300006038	Ga0075365_10173922	Ga0075365_101739222	241
109	3300006048	Ga0075363_100238660	Ga0075363_1002386601	241
110	3300006175	Ga0070712_100119215	Ga0070712_1001192152	241
111	3300006175	Ga0070712_100127410	Ga0070712_1001274102	241
112	3300006177	Ga0075362_10005819	Ga0075362_100058192	241
113	3300006177	Ga0075362_10007495	Ga0075362_100074952	241
114	3300006177	Ga0075362_10102307	Ga0075362_101023071	241
115	3300006186	Ga0075369_10002262	Ga0075369_100022626	241
116	3300006186	Ga0075369_10071583	Ga0075369_100715832	241
117	3300006914	Ga0075436_100027049	Ga0075436_1000270494	241
118	3300007265	Ga0099794_10209729	Ga0099794_102097292	241
119	3300007788	Ga0099795_10076630	Ga0099795_100766303	241
120	3300009093	Ga0105240_10024088	Ga0105240_100240882	241
121	3300009093	Ga0105240_10264290	Ga0105240_102642902	241
122	3300009093	Ga0105240_10323758	Ga0105240_103237583	241
123	3300009093	Ga0105240_10434582	Ga0105240_104345822	241
124	3300009093	Ga0105240_10617468	Ga0105240_106174682	241
125	3300009094	Ga0111539_10555451	Ga0111539_105554512	241
126	3300009147	Ga0114129_11495914	Ga0114129_114959141	241
127	3300009177	Ga0105248_11221280	Ga0105248_112212801	241
128	3300009545	Ga0105237_10470517	Ga0105237_104705172	241
129	3300009551	Ga0105238_10009225	Ga0105238_100092256	241
130	3300009551	Ga0105238_10336454	Ga0105238_103364543	241
131	3300010375	Ga0105239_10057618	Ga0105239_100576182	241
132	3300011119	Ga0105246_10661532	Ga0105246_106615322	241
133	3300013100	Ga0157373_10140298	Ga0157373_101402982	241
134	3300013102	Ga0157371_10247602	Ga0157371_102476021	241
135	3300013296	Ga0157374_10052624	Ga0157374_100526243	241
136	3300014325	Ga0163163_10558327	Ga0163163_105583272	241
137	3300014497	Ga0182008_10071323	Ga0182008_100713232	241
138	3300014968	Ga0157379_10283349	Ga0157379_102833491	241
139	3300021361	Ga0213872_10034348	Ga0213872_100343482	241
140	3300021441	Ga0213871_10034962	Ga0213871_100349622	241
141	3300025302	Ga0207426_1036926	Ga0207426_10369262	241
142	3300025315	Ga0207697_10106779	Ga0207697_101067791	241
143	3300025901	Ga0207688_10249560	Ga0207688_102495602	241
144	3300025907	Ga0207645_10115946	Ga0207645_101159462	241
145	3300025909	Ga0207705_10003414	Ga0207705_1000341413	241
146	3300025910	Ga0207684_10660804	Ga0207684_106608042	241
147	3300025912	Ga0207707_10010938	Ga0207707_100109382	241
148	3300025912	Ga0207707_10028741	Ga0207707_100287416	241
149	3300025913	Ga0207695_10051047	Ga0207695_100510472	241
150	3300025913	Ga0207695_10109956	Ga0207695_101099562	241
151	3300025913	Ga0207695_10125058	Ga0207695_101250582	241
152	3300025913	Ga0207695_10289681	Ga0207695_102896812	241
153	3300025914	Ga0207671_10403680	Ga0207671_104036802	241
154	3300025916	Ga0207663_10303615	Ga0207663_103036152	241
155	3300025917	Ga0207660_10064491	Ga0207660_100644912	241
156	3300025919	Ga0207657_10104934	Ga0207657_101049342	241
157	3300025919	Ga0207657_10131155	Ga0207657_101311552	241
158	3300025920	Ga0207649_10188020	Ga0207649_101880202	241
159	3300025921	Ga0207652_10108281	Ga0207652_101082813	241
160	3300025921	Ga0207652_10155859	Ga0207652_101558592	241
161	3300025922	Ga0207646_10072395	Ga0207646_100723955	241
162	3300025924	Ga0207694_10000316	Ga0207694_1000031627	241
163	3300025924	Ga0207694_10128623	Ga0207694_101286233	241
164	3300025926	Ga0207659_10219056	Ga0207659_102190563	241
165	3300025929	Ga0207664_10000405	Ga0207664_1000040532	241
166	3300025929	Ga0207664_10217678	Ga0207664_102176782	241
167	3300025933	Ga0207706_10077004	Ga0207706_100770043	241
168	3300025936	Ga0207670_10190476	Ga0207670_101904761	241
169	3300025940	Ga0207691_10296200	Ga0207691_102962002	241
170	3300025940	Ga0207691_10685080	Ga0207691_106850802	241
171	3300025942	Ga0207689_10216113	Ga0207689_102161131	241
172	3300025944	Ga0207661_10093268	Ga0207661_100932682	241
173	3300025949	Ga0207667_10024558	Ga0207667_100245589	241
174	3300025949	Ga0207667_10665747	Ga0207667_106657472	241
175	3300025960	Ga0207651_10284695	Ga0207651_102846951	241
176	3300025961	Ga0207712_10651516	Ga0207712_106515161	241
177	3300025981	Ga0207640_10152480	Ga0207640_101524802	241
178	3300026041	Ga0207639_10060258	Ga0207639_100602582	241
179	3300026067	Ga0207678_10185268	Ga0207678_101852683	241
180	3300026078	Ga0207702_10069727	Ga0207702_100697272	241
181	3300026078	Ga0207702_10227626	Ga0207702_102276262	241
182	3300028379	Ga0268266_10000508	Ga0268266_1000050821	241
183	3300028379	Ga0268266_10106744	Ga0268266_101067444	241
184	3300028573	Ga0265334_10006693	Ga0265334_100066936	241
185	3300031247	Ga0265340_10164854	Ga0265340_101648541	241
186	3300031250	Ga0265331_10067225	Ga0265331_100672251	241
187	3300031995	Ga0307409_100828142	Ga0307409_1008281422	241
188	3300032002	Ga0307416_101430740	Ga0307416_1014307401	241
189	3300032004	Ga0307414_10340969	Ga0307414_103409692	241
190	3300032005	Ga0307411_10457818	Ga0307411_104578181	241
191	3300032126	Ga0307415_100435085	Ga0307415_1004350851	241
192	3300035083	Ga0373926_0143764	Ga0373926_0143764_64_792	241
193	3300035410	Ga0373924_0252501	Ga0373924_0252501_16_744	241
194	3300035691	Ga0373931_0077025	Ga0373931_0077025_367_1095	241
195	3300035691	Ga0373931_0146231	Ga0373931_0146231_28_756	241
196	3300035691	Ga0373931_0330589	Ga0373931_0330589_98_826	241
197	3300035692	Ga0373935_0361333	Ga0373935_0361333_26_754	241
198	3300037068	Ga0373925_0147961	Ga0373925_0147961_26_754	241
199	3300037312	Ga0395899_0002111	Ga0395899_0002111_9912_10637	241
200	3300037312	Ga0395899_0030459	Ga0395899_0030459_2088_2816	241
201	3300037312	Ga0395899_0038162	Ga0395899_0038162_1379_2104	241
202	3300037312	Ga0395899_0189361	Ga0395899_0189361_258_986	241
203	3300037312	Ga0395899_0360473	Ga0395899_0360473_47_775	241
204	3300037418	Ga0395900_0004214	Ga0395900_0004214_9344_10069	241
205	3300037418	Ga0395900_0023671	Ga0395900_0023671_2177_2980	241
206	3300037418	Ga0395900_0026019	Ga0395900_0026019_3176_3904	241
207	3300037466	Ga0395898_0001885	Ga0395898_0001885_15830_16555	241
208	3300037466	Ga0395898_0015875	Ga0395898_0015875_5374_6102	241
209	3300037466	Ga0395898_0034318	Ga0395898_0034318_2809_3612	241
210	3300037471	Ga0395905_0537015	Ga0395905_0537015_162_890	241
211	3300038443	Ga0395901_0004821	Ga0395901_0004821_11603_12328	241
212	3300038443	Ga0395901_0041412	Ga0395901_0041412_1361_2089	241
213	3300038443	Ga0395901_0062456	Ga0395901_0062456_2448_3251	241
214	3300038443	Ga0395901_0217822	Ga0395901_0217822_970_1695	241
215	3300039437	Ga0436365_1699085	Ga0436365_1699085_3588_4316	241
216	3300039438	Ga0436360_0262816	Ga0436360_0262816_3068_3835	241
217	3300039438	Ga0436360_1036658	Ga0436360_1036658_674_1402	241
218	3300039447	Ga0436361_0101602	Ga0436361_0101602_2306_3037	241
219	3300039447	Ga0436361_0132672	Ga0436361_0132672_1361_2089	241
220	3300039447	Ga0436361_0821000	Ga0436361_0821000_452_1183	241
221	3300041411	Ga0439466_0127497	Ga0439466_0127497_40_768	241
222	3300042005	Ga0439448_0086013	Ga0439448_0086013_155_883	241
223	3300044694	Ga0466963_0050543	Ga0466963_0050543_1271_1999	241
224	3300044706	Ga0466964_0244138	Ga0466964_0244138_11_739	241
225	3300044712	Ga0453684_0419357	Ga0453684_0419357_728_1453	241
226	3300044901	Ga0466960_0056300	Ga0466960_0056300_1103_1828	241
227	3300045051	Ga0451576_0000402	Ga0451576_0000402_78210_78935	241
228	3300045976	Ga0466967_0529176	Ga0466967_0529176_58_789	241
229	3300046616	Ga0495668_0275527	Ga0495668_0275527_85_813	241
230	3300048915	Ga0496112_0322205	Ga0496112_0322205_753_1478	241
231	3300048917	Ga0496114_0272452	Ga0496114_0272452_652_1380	241
232	3300048918	Ga0496115_0368649	Ga0496115_0368649_249_977	241
233	3300048929	Ga0496126_0044440	Ga0496126_0044440_932_1657	241
234	3300049568	Ga0501031_0005179	Ga0501031_0005179_983_1708	241
235	3300049569	Ga0501032_0035445	Ga0501032_0035445_2495_3220	241
236	3300049570	Ga0501033_0027346	Ga0501033_0027346_1652_2377	241
237	3300049571	Ga0501034_0005145	Ga0501034_0005145_1959_2690	241
238	3300049571	Ga0501034_0005249	Ga0501034_0005249_6500_7228	241
239	3300049571	Ga0501034_0034915	Ga0501034_0034915_3677_4405	241
240	3300049571	Ga0501034_0040232	Ga0501034_0040232_3632_4357	241
241	3300049571	Ga0501034_0817733	Ga0501034_0817733_48_776	241
242	3300049572	Ga0501036_0048610	Ga0501036_0048610_2119_2844	241
243	3300049572	Ga0501036_0563764	Ga0501036_0563764_38_766	241
244	3300049573	Ga0501037_0021688	Ga0501037_0021688_1283_2008	241
245	3300049574	Ga0501038_0059400	Ga0501038_0059400_814_1539	241
246	3300049575	Ga0501039_0039822	Ga0501039_0039822_2219_2944	241
247	3300049576	Ga0501040_0056413	Ga0501040_0056413_1039_1764	241
248	3300049577	Ga0501041_0054951	Ga0501041_0054951_1020_1745	241
249	3300049578	Ga0501042_0070102	Ga0501042_0070102_763_1488	241
250	3300049578	Ga0501042_0116940	Ga0501042_0116940_1044_1772	241
251	3300049579	Ga0501043_0057645	Ga0501043_0057645_2089_2817	241
252	3300049579	Ga0501043_0111130	Ga0501043_0111130_238_963	241
253	3300049579	Ga0501043_0574157	Ga0501043_0574157_10_738	241
254	3300049580	Ga0501046_0045626	Ga0501046_0045626_1737_2462	241
255	3300049581	Ga0501047_0149215	Ga0501047_0149215_902_1630	241
256	3300049582	Ga0501048_0034109	Ga0501048_0034109_1085_1810	241
257	3300049583	Ga0501067_0306296	Ga0501067_0306296_14_751	241
258	3300049584	Ga0501068_0029234	Ga0501068_0029234_1573_2298	241
259	3300049584	Ga0501068_0077535	Ga0501068_0077535_527_1258	241
260	3300049586	Ga0501070_0013267	Ga0501070_0013267_5214_5939	241
261	3300049586	Ga0501070_0283262	Ga0501070_0283262_76_807	241
262	3300049586	Ga0501070_0429152	Ga0501070_0429152_298_1026	241
263	3300049587	Ga0501071_0035121	Ga0501071_0035121_1109_1834	241
264	3300049587	Ga0501071_0568316	Ga0501071_0568316_19_747	241
265	3300049588	Ga0501072_0169828	Ga0501072_0169828_235_960	241
266	3300049589	Ga0501073_0010999	Ga0501073_0010999_1356_2081	241
267	3300049590	Ga0501074_0011331	Ga0501074_0011331_4553_5278	241
268	3300049591	Ga0501075_0034563	Ga0501075_0034563_1255_1980	241
269	3300049592	Ga0501076_0061628	Ga0501076_0061628_1199_1924	241
270	3300049592	Ga0501076_0074750	Ga0501076_0074750_170_898	241
271	3300049592	Ga0501076_0216614	Ga0501076_0216614_664_1392	241
272	3300049593	Ga0501077_0011082	Ga0501077_0011082_1192_1917	241
273	3300049742	Ga0501080_0014888	Ga0501080_0014888_5328_6053	241
274	3300049743	Ga0501081_0022683	Ga0501081_0022683_1737_2462	241
275	3300049744	Ga0501083_0042615	Ga0501083_0042615_1240_1965	241
276	3300049822	Ga0501035_0023499	Ga0501035_0023499_3983_4708	241
277	3300049823	Ga0501044_0073567	Ga0501044_0073567_885_1610	241
278	3300049823	Ga0501044_0147146	Ga0501044_0147146_666_1394	241
279	3300049823	Ga0501044_0150822	Ga0501044_0150822_393_1121	241
280	3300049824	Ga0501045_0013964	Ga0501045_0013964_3855_4580	241
281	3300049824	Ga0501045_0185658	Ga0501045_0185658_662_1390	241
282	3300050489	nmdc:mga03683_150147_c1	nmdc:mga03683_150147_c1_216_944	241
283	3300050489	nmdc:mga03683_472_c2	nmdc:mga03683_472_c2_7807_8535	241
284	3300050492	nmdc:mga0yw44_90923_c1	nmdc:mga0yw44_90923_c1_335_1063	241
285	3300050493	nmdc:mga0k408_57973_c1	nmdc:mga0k408_57973_c1_677_1405	241
286	3300050494	nmdc:mga06z11_30591_c1	nmdc:mga06z11_30591_c1_1335_2063	241
287	3300050509	nmdc:mga0qj67_165161_c1	nmdc:mga0qj67_165161_c1_525_1253	241
288	3300050511	nmdc:mga08y16_106285_c1	nmdc:mga08y16_106285_c1_1239_1967	241
289	3300050511	nmdc:mga08y16_510704_c1	nmdc:mga08y16_510704_c1_171_902	241
290	3300050514	nmdc:mga08x19_14811_c1	nmdc:mga08x19_14811_c1_183_908	241
291	3300050516	nmdc:mga0sz30_164084_c1	nmdc:mga0sz30_164084_c1_245_973	241
292	3300050516	nmdc:mga0sz30_946_c1	nmdc:mga0sz30_946_c1_8377_9105	241
293	3300053096	Ga0500641_0001394	Ga0500641_0001394_2731_3459	241
294	3300053119	Ga0500595_004230	Ga0500595_004230_3733_4458	241
295	3300053119	Ga0500595_056924	Ga0500595_056924_344_1072	241
296	3300053133	Ga0500655_048232	Ga0500655_048232_57_785	241
297	3300053139	Ga0500568_0016313	Ga0500568_0016313_524_1252	241
298	3300053153	Ga0500616_0005724	Ga0500616_0005724_1232_1960	241
299	3300053733	Ga0500552_000406	Ga0500552_000406_312_1040	241
300	3300054114	Ga0501084_0163221	Ga0501084_0163221_1062_1787	241
301	3300061734	Ga0530510_0056951	Ga0530510_0056951_970_1695	241
302	iso_pu_bacteria	2511231221	2512034785	241
303	iso_pu_bacteria	2842333319	2842335339	241
304	iso_pu_bacteria	2848858292	2848861166	241
305	iso_pu_bacteria	2897803580	2897808731	241
306	iso_pu_bacteria	8054002106	8054003771	241
307	3300005617	Ga0068859_100636306	Ga0068859_1006363062	242
308	3300005843	Ga0068860_100013755	Ga0068860_1000137557	242
309	3300006038	Ga0075365_10258670	Ga0075365_102586702	242
310	3300006852	Ga0075433_10002633	Ga0075433_100026335	242
311	3300006931	Ga0097620_100636193	Ga0097620_1006361932	242
312	3300009147	Ga0114129_10155344	Ga0114129_101553444	242
313	3300025933	Ga0207706_10106144	Ga0207706_101061444	242
314	3300028381	Ga0268264_10018176	Ga0268264_100181764	242
315	3300028381	Ga0268264_10654943	Ga0268264_106549432	242
316	3300031903	Ga0307407_10043185	Ga0307407_100431853	242
317	3300035083	Ga0373926_0061349	Ga0373926_0061349_303_1043	242
318	3300035116	Ga0373945_0056916	Ga0373945_0056916_376_1116	242
319	3300035170	Ga0373943_0026076	Ga0373943_0026076_60_800	242
320	3300035410	Ga0373924_0164724	Ga0373924_0164724_69_809	242
321	3300035692	Ga0373935_0047039	Ga0373935_0047039_939_1679	242
322	3300035725	Ga0373947_0101573	Ga0373947_0101573_814_1554	242
323	3300037068	Ga0373925_0023167	Ga0373925_0023167_2312_3052	242
324	3300046455	Ga0495603_0248137	Ga0495603_0248137_230_970	242
325	3300046472	Ga0495580_0036381	Ga0495580_0036381_1073_1813	242
326	3300046499	Ga0495594_0152999	Ga0495594_0152999_499_1239	242
327	3300048090	Ga0495615_0026141	Ga0495615_0026141_577_1320	242
328	3300050492	nmdc:mga0yw44_244910_c1	nmdc:mga0yw44_244910_c1_294_1028	242
329	3300050515	nmdc:mga0a205_15640_c1	nmdc:mga0a205_15640_c1_4496_5230	242
330	3300005536	Ga0070697_100043451	Ga0070697_1000434514	243
331	3300006173	Ga0070716_100141522	Ga0070716_1001415222	243
332	3300007076	Ga0075435_100120302	Ga0075435_1001203024	243
333	3300021388	Ga0213875_10028441	Ga0213875_100284413	243
334	3300025939	Ga0207665_10137102	Ga0207665_101371022	243
335	3300031995	Ga0307409_100880933	Ga0307409_1008809331	243
336	3300037853	Ga0436364_1240134	Ga0436364_1240134_1150_1899	243
337	3300049572	Ga0501036_0006342	Ga0501036_0006342_2777_3514	243
338	3300049573	Ga0501037_0214484	Ga0501037_0214484_184_921	243
339	3300049574	Ga0501038_0013497	Ga0501038_0013497_202_939	243
340	3300049575	Ga0501039_0004564	Ga0501039_0004564_240_977	243
341	3300049575	Ga0501039_0062509	Ga0501039_0062509_1712_2506	243
342	3300049576	Ga0501040_0006529	Ga0501040_0006529_6517_7254	243
343	3300049577	Ga0501041_0011444	Ga0501041_0011444_207_944	243
344	3300049578	Ga0501042_0013495	Ga0501042_0013495_1809_2546	243
345	3300049580	Ga0501046_0173824	Ga0501046_0173824_549_1343	243
346	3300049580	Ga0501046_0257925	Ga0501046_0257925_368_1105	243
347	3300049584	Ga0501068_0220360	Ga0501068_0220360_42_836	243
348	3300049586	Ga0501070_0364380	Ga0501070_0364380_303_1040	243
349	3300049587	Ga0501071_0006536	Ga0501071_0006536_3912_4649	243
350	3300049587	Ga0501071_0073337	Ga0501071_0073337_1494_2288	243
351	3300049588	Ga0501072_0009536	Ga0501072_0009536_6524_7261	243
352	3300049590	Ga0501074_0008472	Ga0501074_0008472_680_1417	243
353	3300049591	Ga0501075_0022165	Ga0501075_0022165_3096_3890	243
354	3300049592	Ga0501076_0000646	Ga0501076_0000646_19741_20478	243
355	3300049593	Ga0501077_0002411	Ga0501077_0002411_4024_4761	243
356	3300049741	Ga0501079_0002961	Ga0501079_0002961_6514_7251	243
357	3300049741	Ga0501079_0041346	Ga0501079_0041346_122_916	243
358	3300049742	Ga0501080_0029108	Ga0501080_0029108_2019_2756	243
359	3300049743	Ga0501081_0006728	Ga0501081_0006728_5752_6489	243
360	3300049744	Ga0501083_0207650	Ga0501083_0207650_144_881	243
361	3300049822	Ga0501035_0079779	Ga0501035_0079779_611_1348	243
362	3300050507	nmdc:mga05p37_94940_c1	nmdc:mga05p37_94940_c1_2607_3347	243
363	3300050515	nmdc:mga0a205_413302_c1	nmdc:mga0a205_413302_c1_202_939	243
364	3300054114	Ga0501084_0000817	Ga0501084_0000817_6526_7263	243
365	3300054114	Ga0501084_0022203	Ga0501084_0022203_740_1534	243
366	3300060353	Ga0501082_0015517	Ga0501082_0015517_1809_2546	243
367	3300060353	Ga0501082_0241908	Ga0501082_0241908_216_1010	243
368	3300061734	Ga0530510_0001034	Ga0530510_0001034_4959_5696	243
369	3300061734	Ga0530510_0014493	Ga0530510_0014493_986_1780	243
370	iso_pu_bacteria	2597490356	2599102803	243
371	iso_pu_bacteria	2821443989	2821450262	243
372	iso_pu_bacteria	2844533157	2844538790	243
373	iso_pu_bacteria	2846952575	2846952677	243
374	3300031250	Ga0265331_10002631	Ga0265331_100026315	245
375	3300031344	Ga0265316_10019064	Ga0265316_100190646	245
376	3300031852	Ga0307410_10498039	Ga0307410_104980391	245
377	3300031995	Ga0307409_100329838	Ga0307409_1003298382	245
378	3300048925	Ga0496122_0173593	Ga0496122_0173593_78_824	245
379	3300059493	Ga0587077_020500	Ga0587077_020500_320_1066	245
380	3300060346	Ga0587111_0019129	Ga0587111_0019129_92_838	245
381	3300003187	JGI25151J46595_10000240	JGI25151J46595_1000024056	247
382	3300003215	JGI25153J46596_10058464	JGI25153J46596_100584642	247
383	3300005834	Ga0068851_10231785	Ga0068851_102317852	247
384	3300005937	Ga0081455_10128056	Ga0081455_101280563	247
385	3300005983	Ga0081540_1045900	Ga0081540_10459003	247
386	3300025294	Ga0209025_1000179	Ga0209025_100017984	247
387	3300025297	Ga0209758_1002547	Ga0209758_10025471	247
388	3300045976	Ga0466967_0183289	Ga0466967_0183289_772_1515	247
389	3300046512	Ga0495610_0027427	Ga0495610_0027427_1904_2662	247
390	3300047469	Ga0495673_0092050	Ga0495673_0092050_127_870	247
391	3300050493	nmdc:mga0k408_329084_c1	nmdc:mga0k408_329084_c1_72_815	247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

5

235

0.99 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4tx9-assembly1.cif.gz_A	crystal structure of hisap from streptomyces sviceus with degraded profar	0.9649	1	241
4x2r-assembly1.cif.gz_A	crystal structure of pria from actinomyces urogenitalis	0.9567	1	242
2vep-assembly1.cif.gz_A	crystal structure of the full length bifunctional enzyme pria	0.9519	1	239
4w9t-assembly1.cif.gz_A	crystal structure of hisap from streptomyces sp. mg1	0.9513	1	241
2x30-assembly1.cif.gz_A	crystal structure of the r139n mutant of a bifunctional enzyme pria	0.947	1	239

ID	Description	Score	Start	End	Superfamily
4x2rA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9565	1	242	3.20.20.70
af_Q58927_1_237_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9527	1	241	3.20.20.70
af_Q2FUU2_4_232_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9517	4	229	3.20.20.70
af_Q58927_1_237_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9488	1	241	3.20.20.70
af_P10371_1_245_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9403	2	240	3.20.20.70

ID	Description	Score	Start	End	GO Terms
AF-A0A401TMM0-F1-model_v4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamideisomerase (EC 5.3.1.16)	1.001	1	144	GO:0000105 GO:0000162 GO:0003949 GO:0005737
AF-A0A6P1BZP6-F1-model_v4	1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (EC 5.3.1.16)	0.9996	40	155	GO:0000105 GO:0000162 GO:0003949 GO:0005737
AF-A0A257XKY7-F1-model_v4	deleted	0.9994	1	116
AF-A0A259JWS5-F1-model_v4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamideisomerase (EC 5.3.1.16)	0.9991	1	171	GO:0000105 GO:0000162 GO:0003949 GO:0005737
AF-A0A3B8XYM1-F1-model_v4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamideisomerase (EC 5.3.1.16)	0.9989	1	165	GO:0000105 GO:0000162 GO:0003949 GO:0005737

Feature Viewer

pLDDT	pTM	Quality
93.16	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F432164

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00977

His_biosynth

Histidine biosynthesis protein

5

235

0.99

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map