F431931

General Info

Members Datasets Scaffolds Average Seq Length
391 273 317 193

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100114421|Ga0070682_1001144213
Length 225
Sequence MRLEIRSNRKDFDLLDYLTSCFLLLKIIKKTKMKRITVFCASSFGTEKIYEEQAIALGKTLAEQNIELVYGGANVGLMGAVADGALNAGGKVIGVLPNFLRSKEIAHLGLTELILVESMHERKTKMNDLCDGVIALPGGFGTLEELFEMLTWAQLGLHKKPIAILNIDGFYDALIELLKVMVEKGLLKDVNASMVLVSDNIDDLLNKMRNYIPPTVGKWIDKEKS

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
5 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
6 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
7 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
8 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
9 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
10 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
11 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
12 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
13 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
14 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
15 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
16 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
17 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
18 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
19 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
20 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
21 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
22 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
23 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
24 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
25 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
26 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
27 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
28 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
29 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
30 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
31 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
32 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
33 2818991441 Niallia circulans 3243 Isolate Rhizosphere
34 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
35 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
36 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
37 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
38 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
39 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
40 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
41 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
42 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
43 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
44 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
45 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
46 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
47 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
48 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
49 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
50 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
51 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
52 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
53 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
54 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
55 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
56 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
57 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
58 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
59 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
60 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
61 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
62 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
63 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
64 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
65 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
66 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
67 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
68 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
69 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
70 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
71 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
72 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
73 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
74 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
75 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
76 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
77 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
78 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
79 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
80 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
81 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
82 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
83 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
84 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
85 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
86 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
87 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
88 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
89 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
90 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
91 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
92 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
93 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
94 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
95 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
96 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
108 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
109 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
153 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
154 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
178 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
191 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
200 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
228 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
244 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
245 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
250 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
251 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
252 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
253 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
260 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
261 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
262 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
263 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
264 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
265 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
266 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
270 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
271 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
272 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
273 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.56
Metatranscriptomes 0.51
Isolates 18.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 10.49
Nodule 1.53
Rhizoplane 2.3
Rhizosphere 65.73
Stem 0
Stem Tuber 0
Unclassified 19.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000228 3300002773 Bacteria 37959
2 JGI25150J39212_1000002 3300002774 Bacteria 537631
3 JGI25151J46595_10000003 3300003187 Bacteria 715330
4 JGI25153J46596_10000003 3300003215 Bacteria 553253
5 JGI25153J46596_10024449 3300003215 Bacteria 2178
6 rootH2_10110486 3300003320 Bacteria 3870
7 rootH2_10156806 3300003320 Bacteria 7193
8 rootH1_10003474 3300003323 Bacteria 12389
9 rootH1_10007892 3300003323 Unclassified 3915
10 rootH1_10007895 3300003323 Bacteria 2127
11 rootH1_10172835 3300003323 Bacteria 9009
12 rootH1_10173600 3300003323 Bacteria 5144
13 rootH1_10205348 3300003323 Unclassified 1144
14 JGI25160J50197_1009196 3300003354 Bacteria 3687
15 Ga0006562J51391_1019353 3300003578 Bacteria 3810
16 Ga0055526_1018881 3300003771 Bacteria 2543
17 Ga0055528_1002185 3300003790 Bacteria 10699
18 Ga0055528_1008124 3300003790 Bacteria 4543
19 Ga0055530_10005005 3300003791 Bacteria 6535
20 Ga0055530_10005176 3300003791 Bacteria 6351
21 Ga0065165_1000012 3300005262 Bacteria 303241
22 Ga0065714_10004855 3300005288 Bacteria 6638
23 Ga0065714_10064451 3300005288 Bacteria 75830
24 Ga0065714_10236078 3300005288 Bacteria 805
25 Ga0065704_10072542 3300005289 Bacteria 8350
26 Ga0065704_10078045 3300005289 Bacteria 4542
27 Ga0065704_10080674 3300005289 Bacteria 3901
28 Ga0065704_10101449 3300005289 Bacteria 2237
29 Ga0065704_10108422 3300005289 Bacteria 2029
30 Ga0065715_10131644 3300005293 Bacteria 1993
31 Ga0065715_10274423 3300005293 Bacteria 1102
32 Ga0065715_10507581 3300005293 Bacteria 774
33 Ga0065707_10082837 3300005295 Bacteria 11792
34 Ga0070658_10632686 3300005327 Bacteria 928
35 Ga0070666_10065369 3300005335 Bacteria 2468
36 Ga0070682_100114421 3300005337 Bacteria 1803
37 Ga0070661_100217486 3300005344 Bacteria 1464
38 Ga0070668_100023450 3300005347 Bacteria 4668
39 Ga0070669_100123407 3300005353 Bacteria 1979
40 Ga0070671_100770234 3300005355 Bacteria 837
41 Ga0070659_100074747 3300005366 Bacteria 2700
42 Ga0070659_100134244 3300005366 Bacteria 2012
43 Ga0070681_10722812 3300005458 Bacteria 912
44 Ga0070697_101335959 3300005536 Bacteria 640
45 Ga0070665_100002523 3300005548 Bacteria 20118
46 Ga0068855_101673788 3300005563 Unclassified 649
47 Ga0068857_100126487 3300005577 Bacteria 2303
48 Ga0068854_100394673 3300005578 Bacteria 1143
49 Ga0068859_100765799 3300005617 Bacteria 1054
50 Ga0068861_100705326 3300005719 Unclassified 938
51 Ga0068860_100011241 3300005843 Bacteria 8822
52 Ga0068862_100355476 3300005844 Bacteria 1360
53 Ga0075370_10155697 3300006353 Bacteria 1340
54 Ga0097620_100765830 3300006931 Bacteria 1054
55 Ga0099824_1015388 3300006942 Bacteria 7258
56 Ga0079104_1000057 3300006946 Bacteria 165780
57 Ga0099826_10003884 3300006948 Bacteria 10310
58 Ga0105251_10310196 3300009011 Bacteria 716
59 Ga0105244_10000002 3300009036 Bacteria 495554
60 Ga0105244_10112002 3300009036 Bacteria 1327
61 Ga0105244_10245774 3300009036 Bacteria 835
62 Ga0105250_10000004 3300009092 Bacteria 438653
63 Ga0105250_10006369 3300009092 Bacteria 5163
64 Ga0105250_10034502 3300009092 Bacteria 2030
65 Ga0105243_10000004 3300009148 Bacteria 601266
66 Ga0105243_10000285 3300009148 Bacteria 56344
67 Ga0105237_10001853 3300009545 Bacteria 27135
68 Ga0157373_10000044 3300013100 Bacteria 113369
69 Ga0157373_10002209 3300013100 Bacteria 14730
70 Ga0157373_10125084 3300013100 Bacteria 1808
71 Ga0157371_10000093 3300013102 Bacteria 140564
72 Ga0157371_10018974 3300013102 Bacteria 5076
73 Ga0157371_10031498 3300013102 Bacteria 3820
74 Ga0157370_10000489 3300013104 Bacteria 49302
75 Ga0157370_10000529 3300013104 Bacteria 47798
76 Ga0157370_10007726 3300013104 Bacteria 11657
77 Ga0157370_10098443 3300013104 Bacteria 2742
78 Ga0157370_10293724 3300013104 Bacteria 1501
79 Ga0157370_10294243 3300013104 Bacteria 1499
80 Ga0157370_10357634 3300013104 Bacteria 1346
81 Ga0157369_10000941 3300013105 Bacteria 36976
82 Ga0157369_10069645 3300013105 Bacteria 3779
83 Ga0157378_10254511 3300013297 Bacteria 1682
84 Ga0157372_10929311 3300013307 Bacteria 1009
85 Ga0157375_10000205 3300013308 Bacteria 54739
86 Ga0157375_10084201 3300013308 Bacteria 3228
87 Ga0157375_10209424 3300013308 Bacteria 2107
88 Ga0157380_10047435 3300014326 Bacteria 3379
89 Ga0182008_10000016 3300014497 Bacteria 241246
90 Ga0182008_10001954 3300014497 Bacteria 13257
91 Ga0157379_10000729 3300014968 Bacteria 26640
92 Ga0157376_10004025 3300014969 Bacteria 10168
93 Ga0182006_1000038 3300015261 Bacteria 212127
94 Ga0182006_1000053 3300015261 Bacteria 180648
95 Ga0182006_1003222 3300015261 Bacteria 8475
96 Ga0182006_1005506 3300015261 Bacteria 6023
97 Ga0182006_1006302 3300015261 Bacteria 5529
98 Ga0182007_10000075 3300015262 Bacteria 77567
99 Ga0182005_1000031 3300015265 Bacteria 202902
100 Ga0182005_1000145 3300015265 Bacteria 49499
101 Ga0163161_10000043 3300017792 Bacteria 135014
102 Ga0163161_10007830 3300017792 Bacteria 7391
103 Ga0163161_10067304 3300017792 Bacteria 2616
104 Ga0163161_10172740 3300017792 Bacteria 1653
105 Ga0163161_10249997 3300017792 Bacteria 1382
106 Ga0163161_10421270 3300017792 Bacteria 1074
107 Ga0163161_11024267 3300017792 Bacteria 706
108 Ga0207425_1000004 3300025245 Bacteria 1092421
109 Ga0209129_1000005 3300025258 Bacteria 777812
110 Ga0209673_1000016 3300025273 Bacteria 506202
111 Ga0209673_1000111 3300025273 Bacteria 180094
112 Ga0209025_1000009 3300025294 Bacteria 1092561
113 Ga0209564_1013932 3300025295 Bacteria 3377
114 Ga0209564_1019926 3300025295 Bacteria 2482
115 Ga0209758_1000010 3300025297 Bacteria 1092782
116 Ga0209758_1009585 3300025297 Bacteria 5983
117 Ga0209758_1012184 3300025297 Bacteria 4849
118 Ga0209758_1051924 3300025297 Bacteria 1423
119 Ga0209050_1006822 3300025298 Bacteria 6643
120 Ga0209050_1007270 3300025298 Bacteria 6266
121 Ga0209050_1075705 3300025298 Bacteria 734
122 Ga0207426_1004171 3300025302 Bacteria 7216
123 Ga0207426_1028984 3300025302 Unclassified 1831
124 Ga0209051_1058451 3300025303 Bacteria 1229
125 Ga0209257_1002226 3300025304 Bacteria 19949
126 Ga0207696_1000056 3300025711 Bacteria 251959
127 Ga0207655_1000012 3300025728 Bacteria 640488
128 Ga0207705_10761024 3300025909 Bacteria 752
129 Ga0207671_10000126 3300025914 Bacteria 118967
130 Ga0207657_10247331 3300025919 Bacteria 1422
131 Ga0207681_10105937 3300025923 Bacteria 2036
132 Ga0207690_10096757 3300025932 Bacteria 2100
133 Ga0207690_10595889 3300025932 Bacteria 902
134 Ga0207709_10000010 3300025935 Bacteria 601305
135 Ga0207709_10000487 3300025935 Bacteria 36062
136 Ga0207679_10485375 3300025945 Bacteria 1101
137 Ga0207667_11452438 3300025949 Unclassified 658
138 Ga0207674_10098877 3300026116 Bacteria 2901
139 Ga0207698_10890086 3300026142 Unclassified 897
140 Ga0209281_1000372 3300027111 Bacteria 72453
141 Ga0209489_113788 3300027361 Bacteria 6214
142 Ga0209282_1010017 3300027666 Bacteria 5990
143 Ga0268266_10036376 3300028379 Bacteria 4190
144 Ga0268265_10348244 3300028380 Bacteria 1352
145 Ga0307515_10000744 3300028794 Bacteria 75412
146 Ga0307515_10056998 3300028794 Bacteria 5663
147 Ga0265760_10081881 3300031090 Bacteria 1001
148 Ga0265327_10000010 3300031251 Bacteria 566817
149 Ga0265327_10030195 3300031251 Bacteria 3068
150 Ga0307509_10042245 3300031507 Bacteria 4943
151 Ga0307509_10445021 3300031507 Bacteria 991
152 Ga0307408_100009286 3300031548 Bacteria 6483
153 Ga0307413_10000188 3300031824 Bacteria 17709
154 Ga0307410_10001347 3300031852 Bacteria 11015
155 Ga0307406_10000881 3300031901 Bacteria 16881
156 Ga0307407_10000808 3300031903 Bacteria 10373
157 Ga0307412_10000047 3300031911 Bacteria 163617
158 Ga0307412_10023131 3300031911 Bacteria 3820
159 Ga0307412_10023393 3300031911 Bacteria 3801
160 Ga0307416_100000074 3300032002 Bacteria 79881
161 Ga0307416_100015008 3300032002 Bacteria 5333
162 Ga0307414_10000008 3300032004 Bacteria 375832
163 Ga0307414_10004907 3300032004 Bacteria 7312
164 Ga0307414_10022145 3300032004 Bacteria 4002
165 Ga0307414_10028330 3300032004 Bacteria 3632
166 Ga0307414_10033227 3300032004 Bacteria 3407
167 Ga0307414_10101437 3300032004 Bacteria 2167
168 Ga0307414_10444636 3300032004 Bacteria 1135
169 Ga0307414_10571068 3300032004 Bacteria 1011
170 Ga0307414_11299389 3300032004 Bacteria 675
171 Ga0307411_10000008 3300032005 Bacteria 321575
172 Ga0307411_10101129 3300032005 Bacteria 2039
173 Ga0307510_10067766 3300033180 Bacteria 3589
174 Ga0373927_0006310 3300035695 Bacteria 8083
175 Ga0395899_0036531 3300037312 Bacteria 3685
176 Ga0395900_0039085 3300037418 Bacteria 4890
177 Ga0395898_0042230 3300037466 Bacteria 4500
178 Ga0395901_0192914 3300038443 Bacteria 2136
179 Ga0395901_0467566 3300038443 Bacteria 1288
180 Ga0436361_0784200 3300039447 Bacteria 1082
181 Ga0439447_000827 3300041407 Bacteria 11348
182 Ga0439466_0001202 3300041411 Bacteria 10062
183 Ga0439465_0000509 3300041413 Bacteria 11591
184 Ga0451845_0986012 3300041501 Bacteria 1867
185 Ga0451853_3917480 3300041512 Bacteria 3672
186 Ga0439445_0000008 3300042004 Bacteria 25873
187 Ga0466969_0014911 3300044656 Bacteria 4078
188 Ga0466972_0010083 3300044658 Bacteria 4748
189 Ga0466966_0385398 3300044684 Unclassified 842
190 Ga0466961_0000306 3300044693 Bacteria 32555
191 Ga0466961_0081585 3300044693 Bacteria 2046
192 Ga0466971_0038638 3300044719 Bacteria 2142
193 Ga0466970_0254795 3300044765 Unclassified 984
194 Ga0466959_0018495 3300045049 Bacteria 5117
195 Ga0466959_0019145 3300045049 Bacteria 5033
196 Ga0466959_0318611 3300045049 Unclassified 1063
197 Ga0495627_000025 3300046453 Bacteria 248825
198 Ga0495627_006873 3300046453 Bacteria 4424
199 Ga0495627_012467 3300046453 Bacteria 3015
200 Ga0495596_0013313 3300046500 Bacteria 3493
201 Ga0495596_0108652 3300046500 Bacteria 1077
202 Ga0495607_0044344 3300046501 Bacteria 2623
203 Ga0495606_0292177 3300046507 Unclassified 886
204 Ga0495610_0000001 3300046512 Bacteria 1620061
205 Ga0495610_0101811 3300046512 Bacteria 1285
206 Ga0495632_0001326 3300046519 Bacteria 20836
207 Ga0495643_0002598 3300046522 Bacteria 14079
208 Ga0495643_0047410 3300046522 Bacteria 2327
209 Ga0495663_0000022 3300046525 Bacteria 109849
210 Ga0495654_0000008 3300046530 Bacteria 398340
211 Ga0495654_0007491 3300046530 Bacteria 6096
212 Ga0495609_0000010 3300046538 Bacteria 342605
213 Ga0495609_0055747 3300046538 Bacteria 1753
214 Ga0495597_0009795 3300046542 Bacteria 4716
215 Ga0495645_0081604 3300046543 Bacteria 2320
216 Ga0495622_0218294 3300046557 Bacteria 845
217 Ga0495633_0000123 3300046558 Bacteria 104682
218 Ga0495633_0000266 3300046558 Bacteria 61340
219 Ga0495633_0001940 3300046558 Bacteria 15037
220 Ga0495633_0008898 3300046558 Bacteria 5599
221 Ga0495634_0291985 3300046642 Bacteria 988
222 Ga0495625_0002628 3300046660 Bacteria 19190
223 Ga0495625_0078507 3300046660 Bacteria 2304
224 Ga0495625_0442282 3300046660 Bacteria 805
225 Ga0495661_0328529 3300046665 Bacteria 758
226 Ga0495686_0000317 3300047472 Bacteria 80748
227 Ga0495686_0001302 3300047472 Bacteria 28111
228 Ga0495626_0002187 3300048091 Bacteria 14057
229 Ga0496102_0254008 3300048905 Bacteria 1657
230 Ga0496107_0697883 3300048910 Bacteria 746
231 Ga0496108_0058352 3300048911 Bacteria 3244
232 Ga0496110_0108420 3300048913 Bacteria 2493
233 Ga0496110_0439806 3300048913 Bacteria 1188
234 Ga0496111_0131478 3300048914 Bacteria 1852
235 Ga0496112_0007346 3300048915 Bacteria 9775
236 Ga0496115_0389412 3300048918 Bacteria 1132
237 Ga0496116_0000004 3300048919 Bacteria 839841
238 Ga0496116_0000037 3300048919 Bacteria 374675
239 Ga0496116_0014437 3300048919 Bacteria 6307
240 Ga0496116_0027351 3300048919 Bacteria 4154
241 Ga0496117_0000032 3300048920 Bacteria 375533
242 Ga0496117_0000136 3300048920 Bacteria 160556
243 Ga0496118_0000027 3300048921 Bacteria 375533
244 Ga0496118_0000393 3300048921 Bacteria 74056
245 Ga0496118_0072206 3300048921 Bacteria 2480
246 Ga0496119_0000017 3300048922 Bacteria 309779
247 Ga0496120_0139046 3300048923 Bacteria 1235
248 Ga0496121_0000008 3300048924 Bacteria 843593
249 Ga0496121_0006384 3300048924 Bacteria 14674
250 Ga0496121_0113041 3300048924 Bacteria 2067
251 Ga0496121_0478319 3300048924 Unclassified 796
252 Ga0496122_0000152 3300048925 Bacteria 161395
253 Ga0496122_0000699 3300048925 Bacteria 66616
254 Ga0496122_0001539 3300048925 Bacteria 36647
255 Ga0496122_0003058 3300048925 Bacteria 22624
256 Ga0496122_0040200 3300048925 Bacteria 3721
257 Ga0496123_0000549 3300048926 Bacteria 64292
258 Ga0496123_0005288 3300048926 Bacteria 13082
259 Ga0496123_0029287 3300048926 Bacteria 4058
260 Ga0496123_0045145 3300048926 Bacteria 3005
261 Ga0496123_0211281 3300048926 Bacteria 986
262 Ga0496124_0001288 3300048927 Bacteria 38071
263 Ga0496124_0092238 3300048927 Bacteria 2467
264 Ga0496124_0230835 3300048927 Bacteria 1384
265 Ga0496125_0000012 3300048928 Bacteria 651142
266 Ga0496125_0011342 3300048928 Bacteria 8924
267 Ga0496126_0007543 3300048929 Bacteria 11904
268 Ga0496126_0165897 3300048929 Bacteria 1885
269 Ga0496126_0450184 3300048929 Bacteria 1036
270 Ga0495682_0008172 3300049460 Bacteria 4133
271 Ga0501298_032600 3300049521 Bacteria 1029
272 Ga0501032_0055629 3300049569 Bacteria 2662
273 Ga0501033_0004562 3300049570 Bacteria 11091
274 Ga0501033_0629720 3300049570 Bacteria 734
275 Ga0501034_0058267 3300049571 Bacteria 3881
276 Ga0501034_0077250 3300049571 Bacteria 3335
277 Ga0501036_0015495 3300049572 Bacteria 6368
278 Ga0501036_0781779 3300049572 Unclassified 787
279 Ga0501037_0014473 3300049573 Bacteria 5805
280 Ga0501038_0035757 3300049574 Bacteria 4360
281 Ga0501043_0027754 3300049579 Bacteria 4444
282 Ga0501046_0005216 3300049580 Bacteria 11623
283 Ga0501047_0007935 3300049581 Bacteria 10008
284 Ga0501048_0025933 3300049582 Bacteria 4270
285 Ga0501067_0020868 3300049583 Bacteria 3625
286 Ga0501069_0005779 3300049585 Bacteria 6446
287 Ga0501073_0005714 3300049589 Bacteria 9305
288 Ga0501074_0000407 3300049590 Bacteria 25724
289 Ga0501238_001291 3300049671 Bacteria 2874
290 Ga0501249_000054 3300049679 Bacteria 43438
291 Ga0501249_024468 3300049679 Bacteria 1330
292 Ga0501251_009257 3300049681 Bacteria 1131
293 Ga0501079_0005979 3300049741 Bacteria 9110
294 Ga0501080_0020752 3300049742 Bacteria 6083
295 Ga0501083_0005271 3300049744 Bacteria 9143
296 Ga0501241_000007 3300049758 Bacteria 148190
297 Ga0501262_004375 3300049759 Bacteria 1638
298 Ga0501266_000004 3300049763 Bacteria 356286
299 Ga0501269_000041 3300049766 Bacteria 39355
300 Ga0501280_000128 3300049776 Bacteria 19793
301 Ga0501035_0001228 3300049822 Bacteria 26669
302 nmdc:mga0k408_188524_c1 3300050493 Bacteria 1230
303 nmdc:mga07m45_193405_c1 3300050496 Bacteria 1183
304 nmdc:mga0qj67_707771_c1 3300050509 Bacteria 801
305 nmdc:mga08y16_28692_c1 3300050511 Bacteria 5865
306 Ga0495655_0097100 3300053083 Bacteria 867
307 Ga0500646_0023756 3300053090 Bacteria 1646
308 Ga0500651_0074749 3300053093 Bacteria 2106
309 Ga0500641_0000003 3300053096 Bacteria 284831
310 Ga0500641_0018819 3300053096 Bacteria 2603
311 Ga0500569_058543 3300053109 Bacteria 1183
312 Ga0500658_0000009 3300053134 Bacteria 270303
313 Ga0500589_060580 3300053147 Bacteria 1735
314 Ga0500584_040509 3300053726 Bacteria 2138
315 Ga0501084_0009764 3300054114 Bacteria 7935
316 Ga0501082_0002766 3300060353 Bacteria 15326
317 Ga0466962_0132322 3300061719 Bacteria 1206

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041501 Ga0451845_0986012 Ga0451845_0986012_1153_1698 157
2 3300041512 Ga0451853_3917480 Ga0451853_3917480_3034_3579 160
3 3300005536 Ga0070697_101335959 Ga0070697_1013359591 165
4 3300031090 Ga0265760_10081881 Ga0265760_100818811 169
5 3300015262 Ga0182007_10000075 Ga0182007_1000007555 176
6 3300048924 Ga0496121_0113041 Ga0496121_0113041_1516_2046 176
7 3300005295 Ga0065707_10082837 Ga0065707_100828375 178
8 3300009092 Ga0105250_10000004 Ga0105250_100000043 178
9 3300014968 Ga0157379_10000729 Ga0157379_1000072927 178
10 3300025711 Ga0207696_1000056 Ga0207696_10000563 178
11 3300046500 Ga0495596_0108652 Ga0495596_0108652_333_932 178
12 3300053083 Ga0495655_0097100 Ga0495655_0097100_59_658 178
13 iso_pu_bacteria 2600255292 2601671833 178
14 iso_pu_bacteria 2857547612 2857552143 178
15 iso_pu_bacteria 2885080285 2885082870 178
16 iso_pu_bacteria 2932410948 2932413784 178
17 iso_pu_bacteria 2932416698 2932417844 178
18 3300046542 Ga0495597_0009795 Ga0495597_0009795_415_954 179
19 3300046660 Ga0495625_0442282 Ga0495625_0442282_29_568 179
20 3300046665 Ga0495661_0328529 Ga0495661_0328529_168_707 179
21 3300048091 Ga0495626_0002187 Ga0495626_0002187_2396_2935 179
22 3300014497 Ga0182008_10001954 Ga0182008_100019547 181
23 3300015261 Ga0182006_1000053 Ga0182006_100005375 181
24 3300015265 Ga0182005_1000031 Ga0182005_100003158 181
25 3300017792 Ga0163161_10007830 Ga0163161_100078302 181
26 3300017792 Ga0163161_10067304 Ga0163161_100673043 181
27 3300032004 Ga0307414_10004907 Ga0307414_100049078 181
28 3300046530 Ga0495654_0007491 Ga0495654_0007491_4458_5006 181
29 3300046557 Ga0495622_0218294 Ga0495622_0218294_72_620 181
30 3300046558 Ga0495633_0001940 Ga0495633_0001940_13227_13775 181
31 3300048919 Ga0496116_0027351 Ga0496116_0027351_2050_2598 181
32 3300048920 Ga0496117_0000032 Ga0496117_0000032_297027_297575 181
33 3300048921 Ga0496118_0000027 Ga0496118_0000027_77959_78507 181
34 3300048924 Ga0496121_0006384 Ga0496121_0006384_12630_13178 181
35 3300048925 Ga0496122_0001539 Ga0496122_0001539_34521_35069 181
36 3300048926 Ga0496123_0000549 Ga0496123_0000549_30085_30633 181
37 3300048927 Ga0496124_0092238 Ga0496124_0092238_208_756 181
38 3300049460 Ga0495682_0008172 Ga0495682_0008172_1855_2403 181
39 3300049759 Ga0501262_004375 Ga0501262_004375_835_1389 184
40 3300031507 Ga0307509_10042245 Ga0307509_100422453 186
41 3300038443 Ga0395901_0467566 Ga0395901_0467566_133_696 187
42 3300048918 Ga0496115_0389412 Ga0496115_0389412_529_1110 187
43 3300050509 nmdc:mga0qj67_707771_c1 nmdc:mga0qj67_707771_c1_116_679 187
44 3300005366 Ga0070659_100134244 Ga0070659_1001342442 188
45 3300025932 Ga0207690_10096757 Ga0207690_100967572 188
46 3300048905 Ga0496102_0254008 Ga0496102_0254008_825_1394 188
47 3300048910 Ga0496107_0697883 Ga0496107_0697883_93_662 188
48 3300048911 Ga0496108_0058352 Ga0496108_0058352_2072_2641 188
49 3300048913 Ga0496110_0108420 Ga0496110_0108420_1537_2106 188
50 3300048913 Ga0496110_0439806 Ga0496110_0439806_193_759 188
51 3300048914 Ga0496111_0131478 Ga0496111_0131478_491_1060 188
52 3300048915 Ga0496112_0007346 Ga0496112_0007346_6670_7239 188
53 3300048924 Ga0496121_0478319 Ga0496121_0478319_153_722 189
54 iso_pu_bacteria 2511231000 2511233840 189
55 iso_pu_bacteria 2513020052 2513235170 189
56 iso_pu_bacteria 2582581281 2585157491 189
57 iso_pu_bacteria 2582581282 2585161889 189
58 iso_pu_bacteria 2585428045 2587681006 189
59 iso_pu_bacteria 2585428060 2587749132 189
60 iso_pu_bacteria 2585428061 2587753217 189
61 iso_pu_bacteria 2585428095 2587868169 189
62 iso_pu_bacteria 2585428115 2587942298 189
63 iso_pu_bacteria 2585428183 2588216793 189
64 iso_pu_bacteria 2585428184 2588220867 189
65 iso_pu_bacteria 2585428185 2588221912 189
66 iso_pu_bacteria 2585428187 2588231263 189
67 iso_pu_bacteria 2588253712 2588445094 189
68 iso_pu_bacteria 2588254255 2590603378 189
69 iso_pu_bacteria 2588254257 2590610799 189
70 iso_pu_bacteria 2643221600 2644010025 189
71 iso_pu_bacteria 2643221667 2644373378 189
72 iso_pu_bacteria 2643221716 2644640401 189
73 iso_pu_bacteria 2728369107 2729202611 189
74 iso_pu_bacteria 2738541279 2738733488 189
75 iso_pu_bacteria 2738541285 2738766026 189
76 iso_pu_bacteria 2738543007 2739215069 189
77 iso_pu_bacteria 2739367857 2740002212 189
78 iso_pu_bacteria 2739367858 2740007028 189
79 iso_pu_bacteria 2775506739 2775673877 189
80 iso_pu_bacteria 2802428842 2802652577 189
81 iso_pu_bacteria 2816332188 2816875964 189
82 iso_pu_bacteria 2816332280 2817417181 189
83 iso_pu_bacteria 2818991441 2819571580 189
84 iso_pu_bacteria 2818991442 2819576954 189
85 iso_pu_bacteria 2821136567 2821142841 189
86 iso_pu_bacteria 2842083920 2842085485 189
87 iso_pu_bacteria 2857613821 2857616055 189
88 iso_pu_bacteria 2857618242 2857620180 189
89 iso_pu_bacteria 2881359912 2881362879 189
90 iso_pu_bacteria 2884791551 2884798163 189
91 iso_pu_bacteria 2896109856 2896114912 189
92 iso_pu_bacteria 2903895155 2903898093 189
93 iso_pu_bacteria 2904419702 2904422246 189
94 iso_pu_bacteria 2904467357 2904473721 189
95 iso_pu_bacteria 2904555929 2904558893 189
96 iso_pu_bacteria 2905999023 2906001360 189
97 iso_pu_bacteria 2919097161 2919100166 189
98 iso_pu_bacteria 2919191525 2919191869 189
99 iso_pu_bacteria 2919683626 2919688210 189
100 iso_pu_bacteria 2929150217 2929154476 189
101 iso_pu_bacteria 2929177148 2929182756 189
102 iso_pu_bacteria 2929239360 2929239691 189
103 iso_pu_bacteria 2945924605 2945928416 189
104 iso_pu_bacteria 2945977869 2945978709 189
105 iso_pu_bacteria 2946013367 2946015423 189
106 iso_pu_bacteria 2958458903 2958459315 189
107 iso_pu_bacteria 2958512119 2958512969 189
108 iso_pu_bacteria 2977268062 2977271327 189
109 iso_pu_bacteria 2984572630 2984573103 189
110 iso_pu_bacteria 2984606641 2984610554 189
111 iso_pu_bacteria 2993372514 2993376490 189
112 iso_pu_bacteria 3003233435 3003233930 189
113 iso_pu_bacteria 8054307821 8054310733 189
114 iso_pu_bacteria 8055419101 8055422785 189
115 iso_pu_bacteria 8055592153 8055592553 189
116 iso_pu_bacteria 8056440228 8056441083 189
117 3300005458 Ga0070681_10722812 Ga0070681_107228121 190
118 iso_pu_bacteria 2919399522 2919401325 190
119 iso_pu_bacteria 2881955468 2881958046 191
120 3300044693 Ga0466961_0000306 Ga0466961_0000306_8340_8924 192
121 3300046453 Ga0495627_000025 Ga0495627_000025_42710_43333 192
122 iso_pu_bacteria 2721755487 2722727388 192
123 iso_pu_bacteria 2904780799 2904781835 192
124 iso_pu_bacteria 2919177583 2919181593 192
125 3300002773 JGI25152J39213_1000228 JGI25152J39213_100022829 193
126 3300002774 JGI25150J39212_1000002 JGI25150J39212_1000002167 193
127 3300003187 JGI25151J46595_10000003 JGI25151J46595_10000003489 193
128 3300003215 JGI25153J46596_10000003 JGI25153J46596_10000003321 193
129 3300003215 JGI25153J46596_10024449 JGI25153J46596_100244492 193
130 3300003320 rootH2_10110486 rootH2_101104862 193
131 3300003320 rootH2_10156806 rootH2_101568067 193
132 3300003323 rootH1_10003474 rootH1_100034749 193
133 3300003323 rootH1_10007892 rootH1_100078924 193
134 3300003323 rootH1_10007895 rootH1_100078952 193
135 3300003323 rootH1_10172835 rootH1_101728353 193
136 3300003323 rootH1_10173600 rootH1_101736002 193
137 3300003323 rootH1_10205348 rootH1_102053481 193
138 3300003354 JGI25160J50197_1009196 JGI25160J50197_10091962 193
139 3300003578 Ga0006562J51391_1019353 Ga0006562J51391_10193534 193
140 3300003771 Ga0055526_1018881 Ga0055526_10188811 193
141 3300003790 Ga0055528_1002185 Ga0055528_10021852 193
142 3300003790 Ga0055528_1008124 Ga0055528_10081242 193
143 3300003791 Ga0055530_10005005 Ga0055530_100050051 193
144 3300003791 Ga0055530_10005176 Ga0055530_100051763 193
145 3300005262 Ga0065165_1000012 Ga0065165_1000012157 193
146 3300005288 Ga0065714_10004855 Ga0065714_100048552 193
147 3300005288 Ga0065714_10064451 Ga0065714_1006445168 193
148 3300005288 Ga0065714_10236078 Ga0065714_102360781 193
149 3300005289 Ga0065704_10072542 Ga0065704_100725422 193
150 3300005289 Ga0065704_10078045 Ga0065704_100780455 193
151 3300005289 Ga0065704_10080674 Ga0065704_100806742 193
152 3300005289 Ga0065704_10101449 Ga0065704_101014492 193
153 3300005289 Ga0065704_10108422 Ga0065704_101084221 193
154 3300005293 Ga0065715_10131644 Ga0065715_101316443 193
155 3300005293 Ga0065715_10274423 Ga0065715_102744231 193
156 3300005293 Ga0065715_10507581 Ga0065715_105075811 193
157 3300005327 Ga0070658_10632686 Ga0070658_106326862 193
158 3300005335 Ga0070666_10065369 Ga0070666_100653694 193
159 3300005337 Ga0070682_100114421 Ga0070682_1001144213 193
160 3300005344 Ga0070661_100217486 Ga0070661_1002174861 193
161 3300005347 Ga0070668_100023450 Ga0070668_1000234504 193
162 3300005353 Ga0070669_100123407 Ga0070669_1001234071 193
163 3300005355 Ga0070671_100770234 Ga0070671_1007702341 193
164 3300005366 Ga0070659_100074747 Ga0070659_1000747472 193
165 3300005548 Ga0070665_100002523 Ga0070665_10000252322 193
166 3300005563 Ga0068855_101673788 Ga0068855_1016737881 193
167 3300005577 Ga0068857_100126487 Ga0068857_1001264872 193
168 3300005578 Ga0068854_100394673 Ga0068854_1003946732 193
169 3300005617 Ga0068859_100765799 Ga0068859_1007657991 193
170 3300005719 Ga0068861_100705326 Ga0068861_1007053262 193
171 3300005843 Ga0068860_100011241 Ga0068860_1000112417 193
172 3300005844 Ga0068862_100355476 Ga0068862_1003554762 193
173 3300006353 Ga0075370_10155697 Ga0075370_101556971 193
174 3300006931 Ga0097620_100765830 Ga0097620_1007658302 193
175 3300006942 Ga0099824_1015388 Ga0099824_10153884 193
176 3300006946 Ga0079104_1000057 Ga0079104_10000572 193
177 3300006948 Ga0099826_10003884 Ga0099826_1000388410 193
178 3300009011 Ga0105251_10310196 Ga0105251_103101961 193
179 3300009036 Ga0105244_10000002 Ga0105244_10000002177 193
180 3300009036 Ga0105244_10112002 Ga0105244_101120021 193
181 3300009036 Ga0105244_10245774 Ga0105244_102457741 193
182 3300009092 Ga0105250_10006369 Ga0105250_100063695 193
183 3300009092 Ga0105250_10034502 Ga0105250_100345021 193
184 3300009148 Ga0105243_10000004 Ga0105243_1000000446 193
185 3300009148 Ga0105243_10000285 Ga0105243_1000028533 193
186 3300009545 Ga0105237_10001853 Ga0105237_1000185320 193
187 3300013100 Ga0157373_10000044 Ga0157373_1000004440 193
188 3300013100 Ga0157373_10002209 Ga0157373_1000220912 193
189 3300013100 Ga0157373_10125084 Ga0157373_101250842 193
190 3300013102 Ga0157371_10000093 Ga0157371_1000009397 193
191 3300013102 Ga0157371_10018974 Ga0157371_100189743 193
192 3300013102 Ga0157371_10031498 Ga0157371_100314984 193
193 3300013104 Ga0157370_10000489 Ga0157370_1000048933 193
194 3300013104 Ga0157370_10000529 Ga0157370_1000052911 193
195 3300013104 Ga0157370_10007726 Ga0157370_1000772613 193
196 3300013104 Ga0157370_10098443 Ga0157370_100984431 193
197 3300013104 Ga0157370_10293724 Ga0157370_102937242 193
198 3300013104 Ga0157370_10294243 Ga0157370_102942432 193
199 3300013104 Ga0157370_10357634 Ga0157370_103576342 193
200 3300013105 Ga0157369_10000941 Ga0157369_100009415 193
201 3300013105 Ga0157369_10069645 Ga0157369_100696454 193
202 3300013297 Ga0157378_10254511 Ga0157378_102545111 193
203 3300013307 Ga0157372_10929311 Ga0157372_109293112 193
204 3300013308 Ga0157375_10000205 Ga0157375_1000020542 193
205 3300013308 Ga0157375_10084201 Ga0157375_100842013 193
206 3300013308 Ga0157375_10209424 Ga0157375_102094243 193
207 3300014326 Ga0157380_10047435 Ga0157380_100474354 193
208 3300014497 Ga0182008_10000016 Ga0182008_10000016191 193
209 3300014969 Ga0157376_10004025 Ga0157376_1000402513 193
210 3300015261 Ga0182006_1000038 Ga0182006_100003873 193
211 3300015261 Ga0182006_1003222 Ga0182006_10032221 193
212 3300015261 Ga0182006_1005506 Ga0182006_10055067 193
213 3300015261 Ga0182006_1006302 Ga0182006_10063026 193
214 3300015265 Ga0182005_1000145 Ga0182005_100014544 193
215 3300017792 Ga0163161_10000043 Ga0163161_10000043108 193
216 3300017792 Ga0163161_10172740 Ga0163161_101727402 193
217 3300017792 Ga0163161_10249997 Ga0163161_102499972 193
218 3300017792 Ga0163161_10421270 Ga0163161_104212702 193
219 3300017792 Ga0163161_11024267 Ga0163161_110242671 193
220 3300025245 Ga0207425_1000004 Ga0207425_1000004776 193
221 3300025258 Ga0209129_1000005 Ga0209129_1000005166 193
222 3300025273 Ga0209673_1000016 Ga0209673_1000016413 193
223 3300025273 Ga0209673_1000111 Ga0209673_100011131 193
224 3300025294 Ga0209025_1000009 Ga0209025_1000009776 193
225 3300025295 Ga0209564_1013932 Ga0209564_10139324 193
226 3300025295 Ga0209564_1019926 Ga0209564_10199262 193
227 3300025297 Ga0209758_1000010 Ga0209758_1000010777 193
228 3300025297 Ga0209758_1009585 Ga0209758_10095851 193
229 3300025297 Ga0209758_1012184 Ga0209758_10121842 193
230 3300025297 Ga0209758_1051924 Ga0209758_10519241 193
231 3300025298 Ga0209050_1006822 Ga0209050_10068228 193
232 3300025298 Ga0209050_1007270 Ga0209050_10072702 193
233 3300025298 Ga0209050_1075705 Ga0209050_10757051 193
234 3300025302 Ga0207426_1004171 Ga0207426_10041718 193
235 3300025302 Ga0207426_1028984 Ga0207426_10289842 193
236 3300025303 Ga0209051_1058451 Ga0209051_10584512 193
237 3300025304 Ga0209257_1002226 Ga0209257_100222619 193
238 3300025728 Ga0207655_1000012 Ga0207655_1000012209 193
239 3300025909 Ga0207705_10761024 Ga0207705_107610241 193
240 3300025914 Ga0207671_10000126 Ga0207671_1000012633 193
241 3300025919 Ga0207657_10247331 Ga0207657_102473312 193
242 3300025923 Ga0207681_10105937 Ga0207681_101059373 193
243 3300025932 Ga0207690_10595889 Ga0207690_105958892 193
244 3300025935 Ga0207709_10000010 Ga0207709_1000001047 193
245 3300025935 Ga0207709_10000487 Ga0207709_1000048722 193
246 3300025945 Ga0207679_10485375 Ga0207679_104853752 193
247 3300025949 Ga0207667_11452438 Ga0207667_114524381 193
248 3300026116 Ga0207674_10098877 Ga0207674_100988772 193
249 3300026142 Ga0207698_10890086 Ga0207698_108900862 193
250 3300027111 Ga0209281_1000372 Ga0209281_100037257 193
251 3300027361 Ga0209489_113788 Ga0209489_1137885 193
252 3300027666 Ga0209282_1010017 Ga0209282_10100175 193
253 3300028379 Ga0268266_10036376 Ga0268266_100363766 193
254 3300028380 Ga0268265_10348244 Ga0268265_103482441 193
255 3300028794 Ga0307515_10000744 Ga0307515_1000074456 193
256 3300028794 Ga0307515_10056998 Ga0307515_100569986 193
257 3300031251 Ga0265327_10000010 Ga0265327_10000010471 193
258 3300031251 Ga0265327_10030195 Ga0265327_100301952 193
259 3300031507 Ga0307509_10445021 Ga0307509_104450211 193
260 3300031548 Ga0307408_100009286 Ga0307408_1000092867 193
261 3300031824 Ga0307413_10000188 Ga0307413_100001882 193
262 3300031852 Ga0307410_10001347 Ga0307410_1000134712 193
263 3300031901 Ga0307406_10000881 Ga0307406_1000088114 193
264 3300031903 Ga0307407_10000808 Ga0307407_1000080812 193
265 3300031911 Ga0307412_10000047 Ga0307412_1000004797 193
266 3300031911 Ga0307412_10023131 Ga0307412_100231313 193
267 3300031911 Ga0307412_10023393 Ga0307412_100233932 193
268 3300032002 Ga0307416_100000074 Ga0307416_10000007470 193
269 3300032002 Ga0307416_100015008 Ga0307416_1000150084 193
270 3300032004 Ga0307414_10000008 Ga0307414_10000008253 193
271 3300032004 Ga0307414_10022145 Ga0307414_100221453 193
272 3300032004 Ga0307414_10028330 Ga0307414_100283303 193
273 3300032004 Ga0307414_10033227 Ga0307414_100332273 193
274 3300032004 Ga0307414_10101437 Ga0307414_101014373 193
275 3300032004 Ga0307414_10444636 Ga0307414_104446362 193
276 3300032004 Ga0307414_10571068 Ga0307414_105710681 193
277 3300032004 Ga0307414_11299389 Ga0307414_112993891 193
278 3300032005 Ga0307411_10000008 Ga0307411_10000008239 193
279 3300032005 Ga0307411_10101129 Ga0307411_101011292 193
280 3300033180 Ga0307510_10067766 Ga0307510_100677666 193
281 3300035695 Ga0373927_0006310 Ga0373927_0006310_3658_4245 193
282 3300037312 Ga0395899_0036531 Ga0395899_0036531_1117_1698 193
283 3300037418 Ga0395900_0039085 Ga0395900_0039085_2565_3146 193
284 3300037466 Ga0395898_0042230 Ga0395898_0042230_2175_2756 193
285 3300038443 Ga0395901_0192914 Ga0395901_0192914_1099_1680 193
286 3300039447 Ga0436361_0784200 Ga0436361_0784200_368_949 193
287 3300041407 Ga0439447_000827 Ga0439447_000827_2432_3013 193
288 3300041411 Ga0439466_0001202 Ga0439466_0001202_3457_4038 193
289 3300041413 Ga0439465_0000509 Ga0439465_0000509_1761_2342 193
290 3300042004 Ga0439445_0000008 Ga0439445_0000008_2689_3270 193
291 3300044656 Ga0466969_0014911 Ga0466969_0014911_3174_3761 193
292 3300044658 Ga0466972_0010083 Ga0466972_0010083_423_1004 193
293 3300044684 Ga0466966_0385398 Ga0466966_0385398_168_749 193
294 3300044693 Ga0466961_0081585 Ga0466961_0081585_173_754 193
295 3300044719 Ga0466971_0038638 Ga0466971_0038638_173_754 193
296 3300044765 Ga0466970_0254795 Ga0466970_0254795_284_865 193
297 3300045049 Ga0466959_0018495 Ga0466959_0018495_3355_3936 193
298 3300045049 Ga0466959_0019145 Ga0466959_0019145_2500_3081 193
299 3300045049 Ga0466959_0318611 Ga0466959_0318611_234_815 193
300 3300046453 Ga0495627_006873 Ga0495627_006873_3063_3644 193
301 3300046453 Ga0495627_012467 Ga0495627_012467_1660_2241 193
302 3300046500 Ga0495596_0013313 Ga0495596_0013313_1749_2330 193
303 3300046501 Ga0495607_0044344 Ga0495607_0044344_1797_2378 193
304 3300046507 Ga0495606_0292177 Ga0495606_0292177_20_601 193
305 3300046512 Ga0495610_0000001 Ga0495610_0000001_272830_273411 193
306 3300046512 Ga0495610_0101811 Ga0495610_0101811_398_979 193
307 3300046519 Ga0495632_0001326 Ga0495632_0001326_11073_11654 193
308 3300046522 Ga0495643_0002598 Ga0495643_0002598_10434_11015 193
309 3300046522 Ga0495643_0047410 Ga0495643_0047410_1461_2042 193
310 3300046525 Ga0495663_0000022 Ga0495663_0000022_41209_41790 193
311 3300046530 Ga0495654_0000008 Ga0495654_0000008_105640_106266 193
312 3300046538 Ga0495609_0000010 Ga0495609_0000010_330939_331520 193
313 3300046538 Ga0495609_0055747 Ga0495609_0055747_1141_1722 193
314 3300046543 Ga0495645_0081604 Ga0495645_0081604_910_1494 193
315 3300046558 Ga0495633_0000123 Ga0495633_0000123_58648_59229 193
316 3300046558 Ga0495633_0000266 Ga0495633_0000266_4669_5250 193
317 3300046558 Ga0495633_0008898 Ga0495633_0008898_1087_1668 193
318 3300046642 Ga0495634_0291985 Ga0495634_0291985_373_960 193
319 3300046660 Ga0495625_0002628 Ga0495625_0002628_11628_12209 193
320 3300046660 Ga0495625_0078507 Ga0495625_0078507_711_1292 193
321 3300047472 Ga0495686_0000317 Ga0495686_0000317_76899_77480 193
322 3300047472 Ga0495686_0001302 Ga0495686_0001302_10433_11014 193
323 3300048919 Ga0496116_0000004 Ga0496116_0000004_439646_440323 193
324 3300048919 Ga0496116_0000037 Ga0496116_0000037_274043_274669 193
325 3300048919 Ga0496116_0014437 Ga0496116_0014437_3333_3923 193
326 3300048920 Ga0496117_0000136 Ga0496117_0000136_60564_61190 193
327 3300048921 Ga0496118_0000393 Ga0496118_0000393_58580_59206 193
328 3300048921 Ga0496118_0072206 Ga0496118_0072206_1508_2089 193
329 3300048922 Ga0496119_0000017 Ga0496119_0000017_247499_248125 193
330 3300048923 Ga0496120_0139046 Ga0496120_0139046_264_890 193
331 3300048924 Ga0496121_0000008 Ga0496121_0000008_412882_413463 193
332 3300048925 Ga0496122_0000152 Ga0496122_0000152_88191_88772 193
333 3300048925 Ga0496122_0000699 Ga0496122_0000699_60877_61503 193
334 3300048925 Ga0496122_0003058 Ga0496122_0003058_16618_17199 193
335 3300048925 Ga0496122_0040200 Ga0496122_0040200_636_1226 193
336 3300048926 Ga0496123_0005288 Ga0496123_0005288_3935_4561 193
337 3300048926 Ga0496123_0029287 Ga0496123_0029287_565_1146 193
338 3300048926 Ga0496123_0045145 Ga0496123_0045145_1294_1884 193
339 3300048926 Ga0496123_0211281 Ga0496123_0211281_180_761 193
340 3300048927 Ga0496124_0001288 Ga0496124_0001288_26369_26995 193
341 3300048927 Ga0496124_0230835 Ga0496124_0230835_638_1219 193
342 3300048928 Ga0496125_0000012 Ga0496125_0000012_436864_437445 193
343 3300048928 Ga0496125_0011342 Ga0496125_0011342_4734_5360 193
344 3300048929 Ga0496126_0007543 Ga0496126_0007543_3728_4345 193
345 3300048929 Ga0496126_0165897 Ga0496126_0165897_590_1171 193
346 3300048929 Ga0496126_0450184 Ga0496126_0450184_91_768 193
347 3300049521 Ga0501298_032600 Ga0501298_032600_417_998 193
348 3300049569 Ga0501032_0055629 Ga0501032_0055629_1398_1979 193
349 3300049570 Ga0501033_0004562 Ga0501033_0004562_3875_4471 193
350 3300049570 Ga0501033_0629720 Ga0501033_0629720_119_700 193
351 3300049571 Ga0501034_0058267 Ga0501034_0058267_476_1072 193
352 3300049571 Ga0501034_0077250 Ga0501034_0077250_1402_1983 193
353 3300049572 Ga0501036_0015495 Ga0501036_0015495_1376_1972 193
354 3300049572 Ga0501036_0781779 Ga0501036_0781779_113_694 193
355 3300049573 Ga0501037_0014473 Ga0501037_0014473_2257_2853 193
356 3300049574 Ga0501038_0035757 Ga0501038_0035757_2218_2814 193
357 3300049579 Ga0501043_0027754 Ga0501043_0027754_1493_2089 193
358 3300049580 Ga0501046_0005216 Ga0501046_0005216_5140_5736 193
359 3300049581 Ga0501047_0007935 Ga0501047_0007935_1657_2253 193
360 3300049582 Ga0501048_0025933 Ga0501048_0025933_1474_2070 193
361 3300049583 Ga0501067_0020868 Ga0501067_0020868_1578_2174 193
362 3300049585 Ga0501069_0005779 Ga0501069_0005779_4029_4625 193
363 3300049589 Ga0501073_0005714 Ga0501073_0005714_4261_4857 193
364 3300049590 Ga0501074_0000407 Ga0501074_0000407_18386_18982 193
365 3300049671 Ga0501238_001291 Ga0501238_001291_2095_2676 193
366 3300049679 Ga0501249_000054 Ga0501249_000054_21142_21723 193
367 3300049679 Ga0501249_024468 Ga0501249_024468_163_744 193
368 3300049681 Ga0501251_009257 Ga0501251_009257_461_1042 193
369 3300049741 Ga0501079_0005979 Ga0501079_0005979_5146_5742 193
370 3300049742 Ga0501080_0020752 Ga0501080_0020752_2118_2714 193
371 3300049744 Ga0501083_0005271 Ga0501083_0005271_4673_5269 193
372 3300049758 Ga0501241_000007 Ga0501241_000007_64881_65462 193
373 3300049763 Ga0501266_000004 Ga0501266_000004_325773_326354 193
374 3300049766 Ga0501269_000041 Ga0501269_000041_10768_11349 193
375 3300049776 Ga0501280_000128 Ga0501280_000128_19146_19727 193
376 3300049822 Ga0501035_0001228 Ga0501035_0001228_13351_13947 193
377 3300050493 nmdc:mga0k408_188524_c1 nmdc:mga0k408_188524_c1_628_1209 193
378 3300050496 nmdc:mga07m45_193405_c1 nmdc:mga07m45_193405_c1_50_631 193
379 3300050511 nmdc:mga08y16_28692_c1 nmdc:mga08y16_28692_c1_5031_5612 193
380 3300053090 Ga0500646_0023756 Ga0500646_0023756_881_1462 193
381 3300053093 Ga0500651_0074749 Ga0500651_0074749_577_1158 193
382 3300053096 Ga0500641_0000003 Ga0500641_0000003_168887_169468 193
383 3300053096 Ga0500641_0018819 Ga0500641_0018819_1791_2372 193
384 3300053109 Ga0500569_058543 Ga0500569_058543_70_681 193
385 3300053134 Ga0500658_0000009 Ga0500658_0000009_149028_149609 193
386 3300053147 Ga0500589_060580 Ga0500589_060580_846_1427 193
387 3300053726 Ga0500584_040509 Ga0500584_040509_226_807 193
388 3300054114 Ga0501084_0009764 Ga0501084_0009764_6546_7142 193
389 3300060353 Ga0501082_0002766 Ga0501082_0002766_10418_11014 193
390 3300061719 Ga0466962_0132322 Ga0466962_0132322_546_1127 193
391 iso_pu_bacteria 2519899754 2520882132 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

78

208

0.99

PF18306

LDcluster4

SLOG cluster4 family

33

194

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zbk-assembly1.cif.gz_A-2 crystal structure of type-i log from pseudomonas aeruginosa pao1 in complex with amp 0.9852 2 180
5zbj-assembly1.cif.gz_A-2 crystal structure of type-i log from pseudomonas aeruginosa pao1 0.984 2 181
5zbl-assembly2.cif.gz_C crystal structure of type-i log from corynebacterium glutamicum in complex with amp 0.9817 1 182
5zbl-assembly2.cif.gz_D crystal structure of type-i log from corynebacterium glutamicum in complex with amp 0.9803 2 182
5its-assembly2.cif.gz_C crystal structure of log from corynebacterium glutamicum 0.9791 1 180
ID Description Score Start End Superfamily
af_Q2G0B7_1_186_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9896 1 181 3.40.50.450
af_A0A1D6K2U3_1_187_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9653 2 177 3.40.50.450
3sbxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9595 1 174 3.40.50.450
af_Q2G0B7_1_186_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9581 1 181 3.40.50.450
5zblB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9497 2 188 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A519XJQ3-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9972 1 169 GO:0005829
GO:0009691
GO:0016799
AF-A0A344LXI1-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9954 1 186 GO:0005829
GO:0009691
GO:0016799
AF-A0A7U8GRU3-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9948 1 183 GO:0005829
GO:0009691
GO:0016799
AF-A0A2D5PIV7-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9932 3 182 GO:0005829
GO:0008714
GO:0009691
AF-A0A7V8VYP7-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.993 2 176 GO:0005829
GO:0009691
GO:0016799

Feature Viewer

pLDDT pTM Quality
93.48 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map