F431307

General Info

Members Datasets Scaffolds Average Seq Length
389 285 288 697

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10000160|JGI25151J46595_1000016054
Length 761
Sequence MALATHRHDPAAPPVNAPIRPEFANPAPPYMTMDRAAAPAPCASVAAFLCSGSAMPVLPKTCQSLLLAAGLAAASASGAVIAKEATVTDDPYAWLEDVDGKRALDWVHARNAKTEAEYTDSAQFKQLEASILEILDSDAKIPDVQKIGDHYYNFWQDAQHPRGLWRRTTLAEYRKDKPAWETVLDLDALNAQENEQWVWHGAECLRPDFQRCLISLSRGGSDADVTREFDLLAKTWIKDGFYRPEAKGSLTWIDRDHVYVATDFGKGSMTSSGYARTVKLWTRGTPMAQATPVYEGKDSDMMVGAWHDPTPGFERDFVERTLAFYNNELFLRGADGKLSKLDLPNSANKEVRREWLLLELRDPYEAGGKKYPAGSLIATRLDDFQAGKRDFVSLFAPTDTSSLAGTTWTRHHLIINVLDDVKNKLTVLTPPGAGQGEWTRSALVGAPTFGTVMVGAVDGIDSDAVWLSAADYLTPTTLALAEPGQKPEVLKTMPSFFDASKDTIEQHFAKSQDGTRVPYFLVRPKDLKYDGKAPTLLYGYGGFEVSMTPKYSGGIGRGWLAKGGVYAVANIRGGGEYGPRWHQAALKANRHKAYEDFAAVGRDLIERKITSTPHLGVQGGSNGGLLTGNMLTQYPELFGAVVVQVPLLDMKRYSHLLAGASWMAEYGNPDTDDWSFIKTFSPYHLFDAKREYPPVIFMTSTKDDRVHPGHARKMAAKMLDAGKNVTYYENIEGGHGGAANNAQQAHMSALALTFLWQRLAP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
4 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
5 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
6 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
7 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
8 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
9 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
10 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
11 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
12 2643221559 Lysobacter sp. Root559 Isolate Unclassified
13 2643221573 Lysobacter sp. Root604 Isolate Unclassified
14 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
15 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
16 2643221586 Lysobacter sp. Root667 Isolate Unclassified
17 2643221593 Lysobacter sp. Root690 Isolate Unclassified
18 2643221612 Lysobacter sp. Root76 Isolate Unclassified
19 2643221613 Oerskovia sp. Root22 Isolate Unclassified
20 2643221695 Lysobacter sp. Root494 Isolate Unclassified
21 2643221720 Lysobacter sp. Root916 Isolate Unclassified
22 2643221721 Oerskovia sp. Root918 Isolate Unclassified
23 2643221727 Lysobacter sp. Root96 Isolate Unclassified
24 2643221728 Lysobacter sp. Root983 Isolate Unclassified
25 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
26 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
27 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
28 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
29 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
30 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
31 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
32 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
33 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
34 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
35 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
36 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
37 2808606394 Promicromonospora sp. C35 Isolate Unclassified
38 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
39 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
40 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
41 2818991457 Xanthomonas translucens 569 Isolate Unclassified
42 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
43 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
44 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
45 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
46 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
47 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
48 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
49 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
50 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
51 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
52 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
53 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
54 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
55 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
56 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
57 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
58 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
59 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
60 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
61 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
62 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
63 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
64 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
65 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
66 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
67 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
68 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
69 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
70 2919513703 Luteimonas sp. 3794 Isolate Unclassified
71 2919675420 Luteimonas terrae 4099 Isolate Unclassified
72 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
73 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
74 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
75 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
76 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
77 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
78 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
79 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
80 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
81 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
82 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
83 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
84 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
85 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
86 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
87 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
88 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
89 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
90 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
91 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
92 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
93 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
94 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
95 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
96 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
97 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
98 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
99 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
100 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
101 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
102 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
103 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
104 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
105 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
106 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
107 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
108 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
109 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
110 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
111 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
112 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
113 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
114 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
115 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
116 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
117 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
118 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
119 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
120 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
121 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
122 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
123 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
124 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
125 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
126 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
127 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
128 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
129 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
130 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
131 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
132 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
133 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
134 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
135 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
136 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
137 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
145 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
146 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
147 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
151 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
152 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
189 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
190 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
191 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
208 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
209 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
210 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
211 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
212 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
213 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
214 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
215 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
216 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
221 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
224 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
227 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
240 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
241 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
244 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
254 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
271 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
280 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
281 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
282 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
283 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
284 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
285 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.78
Metatranscriptomes 0.26
Isolates 25.96

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 18.77
Nodule 2.31
Rhizoplane 1.03
Rhizosphere 53.98
Stem 0
Stem Tuber 0
Unclassified 23.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3090002 2162886007 Bacteria 3831
2 JGI25152J39213_1000033 3300002773 Bacteria 95187
3 JGI25150J39212_1000216 3300002774 Bacteria 31473
4 JGI25150J39212_1000522 3300002774 Bacteria 15710
5 JGI25150J39212_1004573 3300002774 Bacteria 3057
6 JGI25151J46595_10000142 3300003187 Bacteria 95187
7 JGI25151J46595_10000160 3300003187 Bacteria 86811
8 JGI25151J46595_10016679 3300003187 Bacteria 3205
9 JGI25153J46596_10000107 3300003215 Bacteria 95187
10 Ga0055526_1000014 3300003771 Bacteria 233327
11 Ga0055526_1002302 3300003771 Bacteria 13032
12 Ga0055524_1000019 3300003775 Bacteria 233561
13 Ga0055524_1004153 3300003775 Bacteria 6770
14 Ga0055536_1003020 3300003781 Bacteria 9209
15 Ga0055536_1005331 3300003781 Bacteria 6317
16 Ga0055536_1006941 3300003781 Bacteria 5160
17 Ga0055536_1007122 3300003781 Bacteria 5069
18 Ga0055534_1000012 3300003784 Bacteria 153530
19 Ga0055534_1000112 3300003784 Bacteria 59920
20 Ga0055528_1000007 3300003790 Bacteria 233327
21 Ga0055528_1000305 3300003790 Bacteria 41733
22 Ga0055530_10001409 3300003791 Bacteria 17679
23 Ga0055530_10001757 3300003791 Bacteria 15137
24 Ga0055530_10001876 3300003791 Bacteria 14446
25 Ga0055531_10009010 3300003794 Bacteria 5160
26 Ga0055531_10009236 3300003794 Bacteria 5069
27 Ga0055531_10012472 3300003794 Bacteria 3995
28 Ga0058692_1000028 3300003856 Bacteria 193757
29 Ga0058692_1000053 3300003856 Bacteria 107166
30 Ga0065704_10080719 3300005289 Bacteria 3881
31 Ga0065704_10096844 3300005289 Bacteria 2421
32 Ga0065704_10099878 3300005289 Bacteria 2294
33 Ga0070658_10003170 3300005327 Bacteria 13580
34 Ga0070670_100004111 3300005331 Bacteria 12160
35 Ga0070666_10000099 3300005335 Bacteria 59763
36 Ga0070668_100002752 3300005347 Bacteria 12936
37 Ga0070668_100002795 3300005347 Bacteria 12838
38 Ga0070668_100007264 3300005347 Bacteria 8214
39 Ga0070668_100018143 3300005347 Bacteria 5279
40 Ga0070668_100038840 3300005347 Bacteria 3640
41 Ga0070669_100014104 3300005353 Bacteria 5685
42 Ga0070669_100058584 3300005353 Bacteria 2827
43 Ga0070667_100010485 3300005367 Bacteria 7654
44 Ga0070709_10000802 3300005434 Bacteria 17549
45 Ga0070714_100001005 3300005435 Bacteria 20110
46 Ga0070713_100000980 3300005436 Bacteria 18279
47 Ga0070710_10000603 3300005437 Bacteria 17140
48 Ga0070711_100002781 3300005439 Bacteria 10032
49 Ga0070681_10029330 3300005458 Bacteria 5525
50 Ga0070706_100004091 3300005467 Bacteria 14184
51 Ga0070706_100009568 3300005467 Bacteria 9013
52 Ga0070707_100004395 3300005468 Bacteria 13206
53 Ga0070698_100003069 3300005471 Bacteria 18410
54 Ga0070697_100011718 3300005536 Bacteria 6857
55 Ga0070672_100002566 3300005543 Bacteria 11588
56 Ga0068857_100008335 3300005577 Bacteria 8953
57 Ga0068860_100015097 3300005843 Bacteria 7549
58 Ga0081539_10047852 3300005985 Bacteria 2438
59 Ga0075364_10000199 3300006051 Bacteria 27820
60 Ga0070716_100000609 3300006173 Bacteria 15132
61 Ga0070712_100002034 3300006175 Bacteria 12394
62 Ga0075428_100066361 3300006844 Bacteria 3951
63 Ga0075433_10026823 3300006852 Bacteria 4881
64 Ga0075434_100038069 3300006871 Bacteria 4764
65 Ga0075435_100006218 3300007076 Bacteria 8427
66 Ga0105251_10000155 3300009011 Bacteria 69872
67 Ga0105251_10003814 3300009011 Bacteria 10742
68 Ga0105251_10004748 3300009011 Bacteria 9103
69 Ga0114129_10301532 3300009147 Bacteria 2135
70 Ga0105243_10001863 3300009148 Bacteria 18001
71 Ga0105238_10000428 3300009551 Bacteria 44396
72 Ga0105032_100347 3300009979 Bacteria 4714
73 Ga0163162_10000848 3300013306 Bacteria 28416
74 Ga0182008_10000204 3300014497 Bacteria 46716
75 Ga0182008_10004073 3300014497 Bacteria 8623
76 Ga0182006_1027078 3300015261 Bacteria 2343
77 Ga0182007_10000131 3300015262 Bacteria 52730
78 Ga0182005_1000437 3300015265 Bacteria 22152
79 Ga0182005_1006530 3300015265 Bacteria 3551
80 Ga0183360_10002 3300015689 Bacteria 953821
81 Ga0163161_10018796 3300017792 Bacteria 4844
82 Ga0224712_10009817 3300022467 Bacteria 2901
83 Ga0207425_1000064 3300025245 Bacteria 129075
84 Ga0209129_1000101 3300025258 Bacteria 161931
85 Ga0209565_1000001 3300025263 Bacteria 2950419
86 Ga0209565_1000060 3300025263 Bacteria 188543
87 Ga0209565_1004089 3300025263 Bacteria 4543
88 Ga0209673_1000001 3300025273 Bacteria 3176258
89 Ga0209673_1000047 3300025273 Bacteria 289276
90 Ga0209673_1006429 3300025273 Bacteria 5671
91 Ga0209130_1000907 3300025284 Bacteria 23906
92 Ga0209675_1000001 3300025291 Bacteria 2950293
93 Ga0209675_1000007 3300025291 Bacteria 683430
94 Ga0209675_1009011 3300025291 Bacteria 3580
95 Ga0209676_1000018 3300025292 Bacteria 631385
96 Ga0209676_1000052 3300025292 Bacteria 371539
97 Ga0209676_1000501 3300025292 Bacteria 62489
98 Ga0209676_1000507 3300025292 Bacteria 61441
99 Ga0209676_1000620 3300025292 Bacteria 51683
100 Ga0209676_1002422 3300025292 Bacteria 13292
101 Ga0209025_1000006 3300025294 Bacteria 1153444
102 Ga0209025_1000048 3300025294 Bacteria 335574
103 Ga0209025_1000467 3300025294 Bacteria 78947
104 Ga0209025_1001559 3300025294 Bacteria 29104
105 Ga0209564_1000001 3300025295 Bacteria 3176258
106 Ga0209564_1001294 3300025295 Bacteria 27156
107 Ga0209758_1000056 3300025297 Bacteria 335574
108 Ga0209758_1010976 3300025297 Bacteria 5323
109 Ga0209050_1000740 3300025298 Bacteria 47372
110 Ga0209050_1000870 3300025298 Bacteria 40796
111 Ga0209050_1002028 3300025298 Bacteria 18769
112 Ga0209256_1000006 3300025299 Bacteria 1250310
113 Ga0209256_1001986 3300025299 Bacteria 18396
114 Ga0209256_1002865 3300025299 Bacteria 13112
115 Ga0209256_1006371 3300025299 Bacteria 6284
116 Ga0209256_1009441 3300025299 Bacteria 4278
117 Ga0207426_1000141 3300025302 Bacteria 194453
118 Ga0209051_1004844 3300025303 Bacteria 8094
119 Ga0209257_1000035 3300025304 Bacteria 631463
120 Ga0209257_1000046 3300025304 Bacteria 477765
121 Ga0209257_1000067 3300025304 Bacteria 342468
122 Ga0209257_1001111 3300025304 Bacteria 34963
123 Ga0209257_1001426 3300025304 Bacteria 28374
124 Ga0209257_1001475 3300025304 Bacteria 27666
125 Ga0209257_1004911 3300025304 Bacteria 9852
126 Ga0209257_1005671 3300025304 Bacteria 8608
127 Ga0207713_1001387 3300025735 Bacteria 19637
128 Ga0207713_1017967 3300025735 Bacteria 3518
129 Ga0207680_10000001 3300025903 Bacteria 1091453
130 Ga0207699_10012620 3300025906 Bacteria 4302
131 Ga0207684_10012040 3300025910 Bacteria 7534
132 Ga0207693_10002073 3300025915 Bacteria 17528
133 Ga0207663_10015069 3300025916 Bacteria 4254
134 Ga0207646_10001622 3300025922 Bacteria 27444
135 Ga0207646_10015969 3300025922 Bacteria 7059
136 Ga0207646_10031070 3300025922 Bacteria 4837
137 Ga0207681_10002164 3300025923 Bacteria 12520
138 Ga0207694_10000322 3300025924 Bacteria 45212
139 Ga0207650_10002717 3300025925 Bacteria 12212
140 Ga0207664_10002989 3300025929 Bacteria 11233
141 Ga0207709_10000732 3300025935 Bacteria 26258
142 Ga0207665_10000630 3300025939 Bacteria 23660
143 Ga0207691_10000291 3300025940 Bacteria 49560
144 Ga0207668_10005109 3300025972 Bacteria 7722
145 Ga0207668_10025414 3300025972 Bacteria 3833
146 Ga0207648_10033906 3300026089 Bacteria 4502
147 Ga0207674_10004049 3300026116 Bacteria 17790
148 Ga0209371_1000018 3300027312 Bacteria 614700
149 Ga0209371_1000025 3300027312 Bacteria 450640
150 Ga0209967_1002765 3300027364 Bacteria 2284
151 Ga0209971_1001387 3300027682 Bacteria 6021
152 Ga0209974_10004022 3300027876 Bacteria 5258
153 Ga0268266_10000148 3300028379 Bacteria 135001
154 Ga0268266_10067756 3300028379 Bacteria 3090
155 Ga0268264_10013215 3300028381 Bacteria 6795
156 Ga0268256_1000016 3300030500 Bacteria 614700
157 Ga0268256_1000027 3300030500 Bacteria 450640
158 Ga0316177_1165294 3300030731 Bacteria 10662
159 Ga0314311_1098491 3300030733 Bacteria 7848
160 Ga0316183_1170638 3300030742 Bacteria 7805
161 Ga0307513_10011438 3300031456 Bacteria 11031
162 Ga0316578_10023793 3300031728 Bacteria 3431
163 Ga0307410_10019652 3300031852 Bacteria 4114
164 Ga0307406_10002156 3300031901 Bacteria 10715
165 Ga0307412_10037568 3300031911 Bacteria 3113
166 Ga0307412_10079282 3300031911 Bacteria 2265
167 Ga0307409_100016898 3300031995 Bacteria 4845
168 Ga0307409_100026922 3300031995 Bacteria 4065
169 Ga0307414_10001239 3300032004 Bacteria 13148
170 Ga0307510_10006876 3300033180 Bacteria 13573
171 Ga0373942_0000316 3300035207 Bacteria 13118
172 Ga0373962_0002218 3300035242 Bacteria 4640
173 Ga0316574_0040687 3300035398 Bacteria 2862
174 Ga0373935_0036774 3300035692 Bacteria 3063
175 Ga0395899_0006985 3300037312 Bacteria 8747
176 Ga0395905_0004974 3300037471 Bacteria 13689
177 Ga0395901_0005541 3300038443 Bacteria 12780
178 Ga0237819_00128 3300038705 Bacteria 28583
179 Ga0400490_00793 3300038726 Bacteria 43470
180 Ga0237816_00230 3300039145 Bacteria 4664
181 Ga0439436_0008639 3300041404 Bacteria 3131
182 Ga0451800_0092611 3300041459 Bacteria 4708
183 Ga0451806_315449 3300041462 Bacteria 6095
184 Ga0451807_1312642 3300041486 Bacteria 6569
185 Ga0451843_1360598 3300041509 Bacteria 2886
186 Ga0439449_0001576 3300042007 Bacteria 8944
187 Ga0439449_0009583 3300042007 Bacteria 3667
188 Ga0439449_0013557 3300042007 Bacteria 3067
189 Ga0450898_003529 3300042134 Bacteria 2255
190 Ga0451577_0003965 3300042876 Bacteria 15963
191 Ga0453684_0002785 3300044712 Bacteria 41355
192 Ga0453684_0083749 3300044712 Bacteria 3969
193 Ga0451576_0000439 3300045051 Bacteria 94860
194 Ga0451576_0001398 3300045051 Bacteria 41476
195 Ga0495627_001432 3300046453 Bacteria 14015
196 Ga0495591_000467 3300046458 Bacteria 32328
197 Ga0495638_0000744 3300046460 Bacteria 34935
198 Ga0495638_0001133 3300046460 Bacteria 25778
199 Ga0495650_0001167 3300046471 Bacteria 28057
200 Ga0495607_0013704 3300046501 Bacteria 5299
201 Ga0495606_0002739 3300046507 Bacteria 19819
202 Ga0495606_0010276 3300046507 Bacteria 7794
203 Ga0495606_0017758 3300046507 Bacteria 5364
204 Ga0495610_0003191 3300046512 Bacteria 12991
205 Ga0495610_0004120 3300046512 Bacteria 10877
206 Ga0495610_0006208 3300046512 Bacteria 8295
207 Ga0495620_0000459 3300046515 Bacteria 26791
208 Ga0495628_0058144 3300046516 Bacteria 3040
209 Ga0495630_0057927 3300046517 Bacteria 2904
210 Ga0495631_0000804 3300046518 Bacteria 20024
211 Ga0495632_0000800 3300046519 Bacteria 27881
212 Ga0495643_0000886 3300046522 Bacteria 31881
213 Ga0495663_0001059 3300046525 Bacteria 8960
214 Ga0495598_0003446 3300046537 Bacteria 3362
215 Ga0495621_0016377 3300046539 Bacteria 2379
216 Ga0495633_0002188 3300046558 Bacteria 14012
217 Ga0495656_0000713 3300046615 Bacteria 10722
218 Ga0495625_0009844 3300046660 Bacteria 7953
219 Ga0495661_0000565 3300046665 Bacteria 38395
220 Ga0495671_0017825 3300046692 Bacteria 3777
221 Ga0495589_0000808 3300046794 Bacteria 19849
222 Ga0495672_0000411 3300047320 Bacteria 51888
223 Ga0495679_000914 3300047446 Bacteria 18496
224 Ga0495681_0001471 3300047470 Bacteria 17618
225 Ga0495686_0002063 3300047472 Bacteria 19765
226 Ga0495686_0014116 3300047472 Bacteria 5512
227 Ga0496109_0053081 3300048912 Bacteria 3696
228 Ga0496116_0025480 3300048919 Bacteria 4346
229 Ga0496117_0001004 3300048920 Bacteria 43156
230 Ga0496117_0001331 3300048920 Bacteria 36332
231 Ga0496117_0001505 3300048920 Bacteria 33389
232 Ga0496117_0001918 3300048920 Bacteria 27830
233 Ga0496117_0072951 3300048920 Bacteria 2292
234 Ga0496118_0000787 3300048921 Bacteria 50784
235 Ga0496118_0000945 3300048921 Bacteria 45446
236 Ga0496119_0000518 3300048922 Bacteria 52520
237 Ga0496119_0000719 3300048922 Bacteria 44523
238 Ga0496119_0004031 3300048922 Bacteria 14844
239 Ga0496120_0000630 3300048923 Bacteria 52559
240 Ga0496120_0001627 3300048923 Bacteria 26035
241 Ga0496120_0002849 3300048923 Bacteria 16657
242 Ga0496121_0001866 3300048924 Bacteria 33822
243 Ga0496122_0000791 3300048925 Bacteria 60779
244 Ga0496122_0001011 3300048925 Bacteria 49773
245 Ga0496122_0011698 3300048925 Bacteria 8844
246 Ga0496122_0042835 3300048925 Bacteria 3555
247 Ga0496123_0000658 3300048926 Bacteria 57055
248 Ga0496123_0001830 3300048926 Bacteria 27941
249 Ga0496124_0000034 3300048927 Bacteria 325332
250 Ga0496124_0000219 3300048927 Bacteria 111562
251 Ga0496124_0001080 3300048927 Bacteria 43080
252 Ga0496125_0000465 3300048928 Bacteria 72631
253 Ga0496125_0014267 3300048928 Bacteria 7743
254 Ga0496126_0001265 3300048929 Bacteria 40729
255 Ga0496126_0003926 3300048929 Bacteria 18218
256 Ga0496126_0006381 3300048929 Bacteria 13157
257 Ga0496126_0059464 3300048929 Bacteria 3441
258 Ga0501290_000209 3300049513 Bacteria 9673
259 Ga0501031_0016057 3300049568 Bacteria 4862
260 Ga0501033_0001118 3300049570 Bacteria 24355
261 Ga0501033_0059470 3300049570 Bacteria 2822
262 Ga0501034_0001210 3300049571 Bacteria 35418
263 Ga0501034_0002264 3300049571 Bacteria 23614
264 Ga0501034_0003371 3300049571 Bacteria 18236
265 Ga0501034_0048572 3300049571 Bacteria 4283
266 Ga0501037_0007888 3300049573 Bacteria 7799
267 Ga0501038_0006615 3300049574 Bacteria 10719
268 Ga0501038_0012792 3300049574 Bacteria 7663
269 Ga0501038_0065795 3300049574 Bacteria 3088
270 Ga0501039_0042170 3300049575 Bacteria 3526
271 Ga0501047_0010250 3300049581 Bacteria 8865
272 Ga0501068_0028293 3300049584 Bacteria 3314
273 Ga0501073_0016342 3300049589 Bacteria 5379
274 Ga0501225_0004580 3300049705 Bacteria 4112
275 Ga0501080_0016985 3300049742 Bacteria 6720
276 Ga0501265_000238 3300049762 Bacteria 5482
277 Ga0501275_000344 3300049772 Bacteria 5319
278 Ga0501035_0010134 3300049822 Bacteria 8746
279 Ga0501035_0054493 3300049822 Bacteria 3573
280 Ga0501044_0026228 3300049823 Bacteria 6170
281 Ga0501044_0028892 3300049823 Bacteria 5848
282 Ga0501044_0048436 3300049823 Bacteria 4390
283 nmdc:mga00v17_574_c1 3300050491 Bacteria 20546
284 nmdc:mga0n895_35104_c1 3300050512 Bacteria 4833
285 nmdc:mga0rr50_24148_c1 3300050513 Bacteria 4207
286 nmdc:mga0a205_140136_c1 3300050515 Bacteria 2319
287 Ga0495601_0024887 3300053077 Bacteria 3688
288 Ga0500634_0016898 3300053161 Bacteria 3901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2998344455 2998345420 655
2 3300005434 Ga0070709_10000802 Ga0070709_100008026 658
3 3300005435 Ga0070714_100001005 Ga0070714_1000010058 658
4 3300005436 Ga0070713_100000980 Ga0070713_10000098013 658
5 3300005437 Ga0070710_10000603 Ga0070710_1000060312 658
6 3300005439 Ga0070711_100002781 Ga0070711_1000027814 658
7 3300006173 Ga0070716_100000609 Ga0070716_10000060911 658
8 3300006175 Ga0070712_100002034 Ga0070712_10000203412 658
9 3300025906 Ga0207699_10012620 Ga0207699_100126203 658
10 3300025915 Ga0207693_10002073 Ga0207693_100020731 658
11 3300025916 Ga0207663_10015069 Ga0207663_100150692 658
12 3300025929 Ga0207664_10002989 Ga0207664_1000298910 658
13 3300025939 Ga0207665_10000630 Ga0207665_1000063010 658
14 3300005468 Ga0070707_100004395 Ga0070707_1000043955 661
15 3300005471 Ga0070698_100003069 Ga0070698_1000030695 661
16 3300025922 Ga0207646_10001622 Ga0207646_100016225 661
17 3300005467 Ga0070706_100004091 Ga0070706_1000040915 663
18 3300025910 Ga0207684_10012040 Ga0207684_100120404 663
19 3300025922 Ga0207646_10031070 Ga0207646_100310704 664
20 3300005467 Ga0070706_100009568 Ga0070706_1000095688 665
21 3300005536 Ga0070697_100011718 Ga0070697_1000117186 665
22 3300005985 Ga0081539_10047852 Ga0081539_100478521 666
23 iso_pu_bacteria 2939660829 2939663515 666
24 3300035242 Ga0373962_0002218 Ga0373962_0002218_2121_4142 667
25 iso_pu_bacteria 2513237141 2513894898 667
26 iso_pu_bacteria 2524023209 2524463128 667
27 iso_pu_bacteria 2615840626 2616313074 667
28 iso_pu_bacteria 2775507266 2778178767 667
29 iso_pu_bacteria 2838029111 2838035327 667
30 iso_pu_bacteria 2842475841 2842482086 667
31 iso_pu_bacteria 2842482326 2842488780 667
32 iso_pu_bacteria 2842502639 2842508471 667
33 iso_pu_bacteria 2870782633 2870786806 667
34 iso_pu_bacteria 2974315732 2974315926 667
35 iso_pu_bacteria 2984523437 2984524089 667
36 3300025922 Ga0207646_10015969 Ga0207646_100159694 668
37 iso_pu_bacteria 2887443736 2887444631 668
38 iso_pu_bacteria 2523231044 2523386125 669
39 iso_pu_bacteria 2856858025 2856858040 669
40 iso_pu_bacteria 2867312974 2867316359 669
41 iso_pu_bacteria 2867319477 2867321229 669
42 3300031911 Ga0307412_10037568 Ga0307412_100375682 670
43 3300035207 Ga0373942_0000316 Ga0373942_0000316_122_2149 670
44 3300049574 Ga0501038_0012792 Ga0501038_0012792_2535_4589 670
45 3300049575 Ga0501039_0042170 Ga0501039_0042170_221_2275 670
46 3300049823 Ga0501044_0048436 Ga0501044_0048436_2106_4160 670
47 iso_pu_bacteria 2687453129 2687577364 670
48 3300006844 Ga0075428_100066361 Ga0075428_1000663612 671
49 3300031901 Ga0307406_10002156 Ga0307406_1000215610 671
50 3300035692 Ga0373935_0036774 Ga0373935_0036774_412_2463 671
51 3300044712 Ga0453684_0083749 Ga0453684_0083749_1920_3953 672
52 iso_pu_bacteria 2919130084 2919131000 672
53 iso_pu_bacteria 2929195423 2929196237 672
54 3300006871 Ga0075434_100038069 Ga0075434_1000380695 673
55 3300007076 Ga0075435_100006218 Ga0075435_1000062186 673
56 3300044712 Ga0453684_0002785 Ga0453684_0002785_18241_20271 673
57 3300045051 Ga0451576_0001398 Ga0451576_0001398_21085_23115 673
58 3300048920 Ga0496117_0072951 Ga0496117_0072951_166_2256 673
59 3300050512 nmdc:mga0n895_35104_c1 nmdc:mga0n895_35104_c1_2180_4213 673
60 3300050513 nmdc:mga0rr50_24148_c1 nmdc:mga0rr50_24148_c1_2035_4068 673
61 3300050515 nmdc:mga0a205_140136_c1 nmdc:mga0a205_140136_c1_227_2260 673
62 iso_pu_bacteria 2945961074 2945962368 673
63 3300022467 Ga0224712_10009817 Ga0224712_100098172 674
64 3300046516 Ga0495628_0058144 Ga0495628_0058144_118_2154 674
65 3300046517 Ga0495630_0057927 Ga0495630_0057927_550_2586 674
66 3300053077 Ga0495601_0024887 Ga0495601_0024887_320_2356 674
67 iso_pu_bacteria 2739367654 2739609737 674
68 iso_pu_bacteria 2773857762 2774393713 674
69 iso_pu_bacteria 2808606394 2809030007 674
70 iso_pu_bacteria 2808606439 2809195403 674
71 iso_pu_bacteria 2811994878 2812350279 674
72 iso_pu_bacteria 2891968417 2891972095 674
73 3300005347 Ga0070668_100007264 Ga0070668_1000072642 675
74 3300009011 Ga0105251_10004748 Ga0105251_100047488 675
75 3300025284 Ga0209130_1000907 Ga0209130_100090718 675
76 3300025298 Ga0209050_1000870 Ga0209050_100087021 675
77 3300025302 Ga0207426_1000141 Ga0207426_100014124 675
78 3300025735 Ga0207713_1017967 Ga0207713_10179672 675
79 3300027364 Ga0209967_1002765 Ga0209967_10027651 676
80 3300046512 Ga0495610_0006208 Ga0495610_0006208_6205_8238 676
81 iso_pu_bacteria 2738541272 2738697396 676
82 iso_pu_bacteria 2738543027 2739328223 676
83 iso_pu_bacteria 2848551377 2848551654 676
84 iso_pu_bacteria 2946006987 2946010044 676
85 3300005347 Ga0070668_100018143 Ga0070668_1000181432 677
86 3300009011 Ga0105251_10003814 Ga0105251_100038147 677
87 3300027876 Ga0209974_10004022 Ga0209974_100040224 677
88 3300038726 Ga0400490_00793 Ga0400490_00793_28104_30179 677
89 3300046453 Ga0495627_001432 Ga0495627_001432_11409_13454 677
90 3300046458 Ga0495591_000467 Ga0495591_000467_18804_20849 677
91 3300046501 Ga0495607_0013704 Ga0495607_0013704_369_2414 677
92 3300046507 Ga0495606_0002739 Ga0495606_0002739_11220_13265 677
93 3300046512 Ga0495610_0004120 Ga0495610_0004120_5300_7345 677
94 3300046515 Ga0495620_0000459 Ga0495620_0000459_4820_6865 677
95 3300046519 Ga0495632_0000800 Ga0495632_0000800_11403_13448 677
96 3300046665 Ga0495661_0000565 Ga0495661_0000565_24865_26910 677
97 3300046794 Ga0495589_0000808 Ga0495589_0000808_6743_8788 677
98 3300047446 Ga0495679_000914 Ga0495679_000914_6451_8496 677
99 3300047470 Ga0495681_0001471 Ga0495681_0001471_5335_7380 677
100 3300048920 Ga0496117_0001331 Ga0496117_0001331_13106_15151 677
101 3300048922 Ga0496119_0004031 Ga0496119_0004031_9308_11353 677
102 3300048923 Ga0496120_0002849 Ga0496120_0002849_5513_7558 677
103 3300048927 Ga0496124_0001080 Ga0496124_0001080_20076_22121 677
104 3300048928 Ga0496125_0000465 Ga0496125_0000465_33433_35478 677
105 3300048929 Ga0496126_0059464 Ga0496126_0059464_788_2833 677
106 iso_pu_bacteria 2758568621 2760625144 677
107 3300009147 Ga0114129_10301532 Ga0114129_103015321 678
108 3300031728 Ga0316578_10023793 Ga0316578_100237933 679
109 iso_pu_bacteria 8056579771 8056580556 679
110 3300046507 Ga0495606_0010276 Ga0495606_0010276_3029_5083 680
111 3300046507 Ga0495606_0017758 Ga0495606_0017758_2603_4672 680
112 3300047472 Ga0495686_0002063 Ga0495686_0002063_8675_10786 680
113 3300048925 Ga0496122_0011698 Ga0496122_0011698_2821_4875 680
114 iso_pu_bacteria 2515154155 2515853054 680
115 3300006852 Ga0075433_10026823 Ga0075433_100268233 681
116 3300009979 Ga0105032_100347 Ga0105032_1003474 681
117 3300031852 Ga0307410_10019652 Ga0307410_100196524 681
118 3300031995 Ga0307409_100016898 Ga0307409_1000168984 681
119 iso_pu_bacteria 2835188231 2835189575 681
120 iso_pu_bacteria 2839986021 2839986808 681
121 iso_pu_bacteria 2643221613 2644083494 682
122 iso_pu_bacteria 2643221721 2644664311 682
123 iso_pu_bacteria 2935890801 2935892911 682
124 3300005327 Ga0070658_10003170 Ga0070658_100031702 683
125 3300005335 Ga0070666_10000099 Ga0070666_1000009933 683
126 3300005367 Ga0070667_100010485 Ga0070667_1000104856 683
127 3300005843 Ga0068860_100015097 Ga0068860_1000150975 683
128 3300009551 Ga0105238_10000428 Ga0105238_100004281 683
129 3300013306 Ga0163162_10000848 Ga0163162_100008485 683
130 3300025903 Ga0207680_10000001 Ga0207680_10000001742 683
131 3300025924 Ga0207694_10000322 Ga0207694_100003229 683
132 3300028379 Ga0268266_10000148 Ga0268266_1000014860 683
133 3300028381 Ga0268264_10013215 Ga0268264_100132152 683
134 3300048929 Ga0496126_0006381 Ga0496126_0006381_8992_11076 683
135 iso_pu_bacteria 2932431166 2932433304 683
136 3300005353 Ga0070669_100014104 Ga0070669_1000141043 685
137 3300014497 Ga0182008_10004073 Ga0182008_100040733 685
138 3300025923 Ga0207681_10002164 Ga0207681_100021649 685
139 3300035398 Ga0316574_0040687 Ga0316574_0040687_523_2697 685
140 3300042007 Ga0439449_0009583 Ga0439449_0009583_1194_3362 685
141 3300046522 Ga0495643_0000886 Ga0495643_0000886_18805_20871 685
142 3300047320 Ga0495672_0000411 Ga0495672_0000411_30270_32336 685
143 3300047472 Ga0495686_0014116 Ga0495686_0014116_1164_3230 685
144 iso_pu_bacteria 2842780639 2842781933 686
145 3300005347 Ga0070668_100002752 Ga0070668_1000027526 687
146 3300025294 Ga0209025_1000467 Ga0209025_100046716 687
147 3300025972 Ga0207668_10025414 Ga0207668_100254142 687
148 3300026089 Ga0207648_10033906 Ga0207648_100339065 687
149 3300028379 Ga0268266_10067756 Ga0268266_100677561 687
150 3300049570 Ga0501033_0001118 Ga0501033_0001118_15880_17952 687
151 3300031911 Ga0307412_10079282 Ga0307412_100792821 688
152 3300041404 Ga0439436_0008639 Ga0439436_0008639_691_2826 688
153 3300046460 Ga0495638_0001133 Ga0495638_0001133_19998_22121 688
154 3300048927 Ga0496124_0000034 Ga0496124_0000034_81044_83146 689
155 iso_pu_bacteria 2524614729 2525557369 689
156 iso_pu_bacteria 2627854209 2630648960 689
157 3300025273 Ga0209673_1006429 Ga0209673_10064293 690
158 3300025291 Ga0209675_1009011 Ga0209675_10090112 690
159 3300027682 Ga0209971_1001387 Ga0209971_10013875 690
160 3300048912 Ga0496109_0053081 Ga0496109_0053081_908_3043 690
161 3300049568 Ga0501031_0016057 Ga0501031_0016057_2041_4161 690
162 3300049570 Ga0501033_0059470 Ga0501033_0059470_639_2759 690
163 3300049571 Ga0501034_0003371 Ga0501034_0003371_13118_15235 690
164 3300049573 Ga0501037_0007888 Ga0501037_0007888_536_2656 690
165 3300049574 Ga0501038_0006615 Ga0501038_0006615_4190_6310 690
166 3300049581 Ga0501047_0010250 Ga0501047_0010250_4744_6864 690
167 3300049584 Ga0501068_0028293 Ga0501068_0028293_1132_3252 690
168 3300049589 Ga0501073_0016342 Ga0501073_0016342_2084_4204 690
169 3300049742 Ga0501080_0016985 Ga0501080_0016985_439_2559 690
170 3300049822 Ga0501035_0010134 Ga0501035_0010134_4439_6559 690
171 3300049823 Ga0501044_0028892 Ga0501044_0028892_1700_3820 690
172 iso_pu_bacteria 2547132130 2547501621 690
173 iso_pu_bacteria 2576861471 2578456928 690
174 iso_pu_bacteria 2747842428 2747948651 690
175 iso_pu_bacteria 2765235840 2765580575 690
176 iso_pu_bacteria 2816332141 2816518402 690
177 iso_pu_bacteria 2842391507 2842394489 690
178 iso_pu_bacteria 2857442823 2857444230 690
179 iso_pu_bacteria 2874220319 2874223242 690
180 iso_pu_bacteria 2919089067 2919092319 690
181 iso_pu_bacteria 2919134579 2919137038 690
182 iso_pu_bacteria 2928496128 2928499908 690
183 iso_pu_bacteria 2931380184 2931383321 690
184 iso_pu_bacteria 2937610967 2937614294 690
185 iso_pu_bacteria 2939589442 2939589871 690
186 iso_pu_bacteria 2939622612 2939624990 690
187 iso_pu_bacteria 2939626828 2939629196 690
188 iso_pu_bacteria 2961047084 2961050006 690
189 iso_pu_bacteria 2961064222 2961064836 690
190 iso_pu_bacteria 2974307012 2974307584 690
191 iso_pu_bacteria 2977247770 2977248295 690
192 iso_pu_bacteria 2984514374 2984517212 690
193 3300025299 Ga0209256_1006371 Ga0209256_10063712 691
194 3300033180 Ga0307510_10006876 Ga0307510_100068769 691
195 3300037312 Ga0395899_0006985 Ga0395899_0006985_3297_5438 691
196 3300037471 Ga0395905_0004974 Ga0395905_0004974_10152_12293 691
197 3300038443 Ga0395901_0005541 Ga0395901_0005541_4430_6571 691
198 3300046471 Ga0495650_0001167 Ga0495650_0001167_3524_5734 691
199 3300046660 Ga0495625_0009844 Ga0495625_0009844_1335_3545 691
200 iso_pu_bacteria 2643221559 2643818220 691
201 iso_pu_bacteria 2643221573 2643880408 691
202 iso_pu_bacteria 2643221586 2643937889 691
203 iso_pu_bacteria 2643221612 2644078798 691
204 iso_pu_bacteria 2643221720 2644660983 691
205 iso_pu_bacteria 2643221727 2644693575 691
206 iso_pu_bacteria 2643221728 2644699065 691
207 iso_pu_bacteria 2852649853 2852652084 691
208 iso_pu_bacteria 2919513703 2919515562 691
209 iso_pu_bacteria 2919675420 2919678434 691
210 iso_pu_bacteria 2941475908 2941478703 691
211 iso_pu_bacteria 2987605356 2987608184 691
212 3300003791 Ga0055530_10001409 Ga0055530_100014097 692
213 3300031995 Ga0307409_100026922 Ga0307409_1000269222 692
214 3300045051 Ga0451576_0000439 Ga0451576_0000439_43743_45854 692
215 3300049574 Ga0501038_0065795 Ga0501038_0065795_720_2894 692
216 3300049822 Ga0501035_0054493 Ga0501035_0054493_1185_3359 692
217 3300049823 Ga0501044_0026228 Ga0501044_0026228_2734_4908 692
218 iso_pu_bacteria 2758568522 2760306398 692
219 iso_pu_bacteria 2842757796 2842758943 692
220 3300030733 Ga0314311_1098491 Ga0314311_10984912 693
221 iso_pu_bacteria 2643221579 2643906669 693
222 iso_pu_bacteria 2643221581 2643913831 693
223 iso_pu_bacteria 2643221593 2643973442 693
224 iso_pu_bacteria 2687453341 2688390868 693
225 iso_pu_bacteria 2747842501 2748018764 693
226 iso_pu_bacteria 2894414249 2894414318 693
227 iso_pu_bacteria 2895498888 2895502849 693
228 iso_pu_bacteria 2895511927 2895512891 693
229 iso_pu_bacteria 2895522137 2895522899 693
230 iso_pu_bacteria 2895525241 2895525330 693
231 iso_pu_bacteria 2923516293 2923519740 693
232 iso_pu_bacteria 2941489479 2941493648 693
233 iso_pu_bacteria 2995948881 2995949573 693
234 iso_pu_bacteria 8002869464 8002870911 693
235 iso_pu_bacteria 8003014200 8003015500 693
236 3300003771 Ga0055526_1002302 Ga0055526_10023021 694
237 3300003775 Ga0055524_1004153 Ga0055524_10041532 694
238 3300003781 Ga0055536_1005331 Ga0055536_10053314 694
239 3300003781 Ga0055536_1006941 Ga0055536_10069415 694
240 3300003781 Ga0055536_1007122 Ga0055536_10071225 694
241 3300003784 Ga0055534_1000112 Ga0055534_100011233 694
242 3300003790 Ga0055528_1000305 Ga0055528_100030531 694
243 3300003791 Ga0055530_10001876 Ga0055530_1000187610 694
244 3300003794 Ga0055531_10009010 Ga0055531_100090105 694
245 3300003794 Ga0055531_10009236 Ga0055531_100092365 694
246 3300003794 Ga0055531_10012472 Ga0055531_100124722 694
247 3300003856 Ga0058692_1000053 Ga0058692_100005335 694
248 3300005289 Ga0065704_10096844 Ga0065704_100968442 694
249 3300005347 Ga0070668_100002795 Ga0070668_1000027959 694
250 3300014497 Ga0182008_10000204 Ga0182008_1000020410 694
251 3300017792 Ga0163161_10018796 Ga0163161_100187962 694
252 3300025263 Ga0209565_1000060 Ga0209565_1000060151 694
253 3300025273 Ga0209673_1000047 Ga0209673_100004711 694
254 3300025291 Ga0209675_1000007 Ga0209675_1000007529 694
255 3300025292 Ga0209676_1000018 Ga0209676_100001862 694
256 3300025292 Ga0209676_1000507 Ga0209676_100050716 694
257 3300025292 Ga0209676_1000620 Ga0209676_100062021 694
258 3300025295 Ga0209564_1001294 Ga0209564_100129413 694
259 3300025298 Ga0209050_1000740 Ga0209050_100074018 694
260 3300025299 Ga0209256_1002865 Ga0209256_10028655 694
261 3300025299 Ga0209256_1009441 Ga0209256_10094412 694
262 3300025303 Ga0209051_1004844 Ga0209051_10048445 694
263 3300025304 Ga0209257_1000035 Ga0209257_100003562 694
264 3300025304 Ga0209257_1001111 Ga0209257_100111118 694
265 3300025304 Ga0209257_1001426 Ga0209257_100142621 694
266 3300025304 Ga0209257_1004911 Ga0209257_10049114 694
267 3300025935 Ga0207709_10000732 Ga0207709_1000073222 694
268 3300025972 Ga0207668_10005109 Ga0207668_100051095 694
269 3300027312 Ga0209371_1000018 Ga0209371_1000018500 694
270 3300030500 Ga0268256_1000016 Ga0268256_1000016500 694
271 3300030731 Ga0316177_1165294 Ga0316177_11652947 694
272 3300030742 Ga0316183_1170638 Ga0316183_11706383 694
273 3300042134 Ga0450898_003529 Ga0450898_003529_22_2151 694
274 3300046460 Ga0495638_0000744 Ga0495638_0000744_9319_11412 694
275 3300046512 Ga0495610_0003191 Ga0495610_0003191_10269_12362 694
276 3300046518 Ga0495631_0000804 Ga0495631_0000804_10257_12350 694
277 3300046692 Ga0495671_0017825 Ga0495671_0017825_110_2239 694
278 3300048919 Ga0496116_0025480 Ga0496116_0025480_2226_4322 694
279 3300048920 Ga0496117_0001918 Ga0496117_0001918_25172_27265 694
280 3300048921 Ga0496118_0000945 Ga0496118_0000945_9838_11931 694
281 3300048925 Ga0496122_0042835 Ga0496122_0042835_347_2440 694
282 3300049571 Ga0501034_0001210 Ga0501034_0001210_32582_34732 694
283 3300005347 Ga0070668_100038840 Ga0070668_1000388402 695
284 3300005458 Ga0070681_10029330 Ga0070681_100293302 695
285 3300005577 Ga0068857_100008335 Ga0068857_1000083353 695
286 3300015261 Ga0182006_1027078 Ga0182006_10270781 695
287 3300015262 Ga0182007_10000131 Ga0182007_1000013119 695
288 3300015265 Ga0182005_1000437 Ga0182005_10004373 695
289 3300026116 Ga0207674_10004049 Ga0207674_1000404911 695
290 3300042876 Ga0451577_0003965 Ga0451577_0003965_11954_14125 695
291 3300046537 Ga0495598_0003446 Ga0495598_0003446_524_2680 695
292 3300046539 Ga0495621_0016377 Ga0495621_0016377_187_2343 695
293 3300048920 Ga0496117_0001004 Ga0496117_0001004_20300_22396 695
294 3300048921 Ga0496118_0000787 Ga0496118_0000787_20315_22411 695
295 3300048922 Ga0496119_0000518 Ga0496119_0000518_18444_20540 695
296 3300048923 Ga0496120_0000630 Ga0496120_0000630_32017_34113 695
297 3300048925 Ga0496122_0000791 Ga0496122_0000791_16787_18886 695
298 3300048926 Ga0496123_0000658 Ga0496123_0000658_41890_43989 695
299 3300048928 Ga0496125_0014267 Ga0496125_0014267_3030_5126 695
300 3300048929 Ga0496126_0001265 Ga0496126_0001265_20199_22295 695
301 3300049571 Ga0501034_0048572 Ga0501034_0048572_309_2453 695
302 3300049705 Ga0501225_0004580 Ga0501225_0004580_1657_3777 695
303 iso_pu_bacteria 2571042365 2572254271 695
304 iso_pu_bacteria 2643221695 2644528132 695
305 3300003187 JGI25151J46595_10016679 JGI25151J46595_100166792 696
306 3300003791 Ga0055530_10001757 Ga0055530_100017577 696
307 3300005353 Ga0070669_100058584 Ga0070669_1000585842 696
308 3300005543 Ga0070672_100002566 Ga0070672_1000025667 696
309 3300025294 Ga0209025_1001559 Ga0209025_10015599 696
310 3300025297 Ga0209758_1010976 Ga0209758_10109764 696
311 3300025298 Ga0209050_1002028 Ga0209050_100202810 696
312 3300025299 Ga0209256_1001986 Ga0209256_100198615 696
313 3300025304 Ga0209257_1000067 Ga0209257_1000067219 696
314 3300025304 Ga0209257_1001475 Ga0209257_100147522 696
315 3300025940 Ga0207691_10000291 Ga0207691_100002915 696
316 3300042007 Ga0439449_0001576 Ga0439449_0001576_4288_6399 696
317 3300046558 Ga0495633_0002188 Ga0495633_0002188_6910_9012 696
318 3300046615 Ga0495656_0000713 Ga0495656_0000713_985_3120 696
319 3300048929 Ga0496126_0003926 Ga0496126_0003926_10729_12825 696
320 3300049513 Ga0501290_000209 Ga0501290_000209_6555_8705 696
321 3300049762 Ga0501265_000238 Ga0501265_000238_154_2304 696
322 3300049772 Ga0501275_000344 Ga0501275_000344_308_2458 696
323 3300053161 Ga0500634_0016898 Ga0500634_0016898_632_2722 696
324 3300002773 JGI25152J39213_1000033 JGI25152J39213_10000331 697
325 3300002774 JGI25150J39212_1000216 JGI25150J39212_100021628 697
326 3300002774 JGI25150J39212_1000522 JGI25150J39212_10005221 697
327 3300002774 JGI25150J39212_1004573 JGI25150J39212_10045731 697
328 3300003187 JGI25151J46595_10000142 JGI25151J46595_1000014282 697
329 3300003187 JGI25151J46595_10000160 JGI25151J46595_1000016054 697
330 3300003215 JGI25153J46596_10000107 JGI25153J46596_100001071 697
331 3300003771 Ga0055526_1000014 Ga0055526_100001493 697
332 3300003775 Ga0055524_1000019 Ga0055524_1000019123 697
333 3300003781 Ga0055536_1003020 Ga0055536_10030205 697
334 3300003784 Ga0055534_1000012 Ga0055534_100001293 697
335 3300003790 Ga0055528_1000007 Ga0055528_100000793 697
336 3300005289 Ga0065704_10099878 Ga0065704_100998781 697
337 3300006051 Ga0075364_10000199 Ga0075364_1000019912 697
338 3300015689 Ga0183360_10002 Ga0183360_10002714 697
339 3300025245 Ga0207425_1000064 Ga0207425_100006432 697
340 3300025258 Ga0209129_1000101 Ga0209129_100010132 697
341 3300025263 Ga0209565_1000001 Ga0209565_1000001365 697
342 3300025263 Ga0209565_1004089 Ga0209565_10040892 697
343 3300025273 Ga0209673_1000001 Ga0209673_1000001365 697
344 3300025291 Ga0209675_1000001 Ga0209675_10000012166 697
345 3300025292 Ga0209676_1000052 Ga0209676_1000052247 697
346 3300025292 Ga0209676_1000501 Ga0209676_100050124 697
347 3300025292 Ga0209676_1002422 Ga0209676_10024226 697
348 3300025294 Ga0209025_1000006 Ga0209025_1000006712 697
349 3300025294 Ga0209025_1000048 Ga0209025_1000048214 697
350 3300025295 Ga0209564_1000001 Ga0209564_10000012328 697
351 3300025297 Ga0209758_1000056 Ga0209758_1000056214 697
352 3300025299 Ga0209256_1000006 Ga0209256_1000006764 697
353 3300025304 Ga0209257_1000046 Ga0209257_1000046316 697
354 3300025304 Ga0209257_1005671 Ga0209257_10056715 697
355 3300031456 Ga0307513_10011438 Ga0307513_100114386 697
356 3300032004 Ga0307414_10001239 Ga0307414_1000123910 697
357 3300038705 Ga0237819_00128 Ga0237819_00128_26439_28541 697
358 3300039145 Ga0237816_00230 Ga0237816_00230_82_2196 697
359 3300042007 Ga0439449_0013557 Ga0439449_0013557_718_2850 697
360 3300046525 Ga0495663_0001059 Ga0495663_0001059_2372_4504 697
361 3300048924 Ga0496121_0001866 Ga0496121_0001866_7807_9924 697
362 3300049571 Ga0501034_0002264 Ga0501034_0002264_10640_12745 697
363 3300050491 nmdc:mga00v17_574_c1 nmdc:mga00v17_574_c1_9521_11620 697
364 iso_pu_bacteria 2818991457 2819661373 697
365 iso_pu_bacteria 2852684882 2852687243 697
366 3300041509 Ga0451843_1360598 Ga0451843_1360598_16_2133 699
367 3300003856 Ga0058692_1000028 Ga0058692_1000028176 701
368 3300009148 Ga0105243_10001863 Ga0105243_100018635 701
369 3300015265 Ga0182005_1006530 Ga0182005_10065304 701
370 3300027312 Ga0209371_1000025 Ga0209371_100002587 701
371 3300030500 Ga0268256_1000027 Ga0268256_100002787 701
372 iso_pu_bacteria 8021622325 8021625506 701
373 iso_pu_bacteria 8021626552 8021628659 701
374 iso_pu_bacteria 8021648035 8021650857 701
375 2162886007 SwRhRL2b_contig_3090002 SwRhRL2b_0217.00001460 703
376 3300005289 Ga0065704_10080719 Ga0065704_100807191 703
377 3300005331 Ga0070670_100004111 Ga0070670_1000041119 703
378 3300009011 Ga0105251_10000155 Ga0105251_1000015517 703
379 3300025735 Ga0207713_1001387 Ga0207713_100138715 703
380 3300025925 Ga0207650_10002717 Ga0207650_100027177 703
381 3300041459 Ga0451800_0092611 Ga0451800_0092611_2304_4460 703
382 3300041462 Ga0451806_315449 Ga0451806_315449_192_2348 703
383 3300041486 Ga0451807_1312642 Ga0451807_1312642_173_2329 703
384 3300048920 Ga0496117_0001505 Ga0496117_0001505_26513_28624 703
385 3300048922 Ga0496119_0000719 Ga0496119_0000719_10244_12355 703
386 3300048923 Ga0496120_0001627 Ga0496120_0001627_4150_6261 703
387 3300048925 Ga0496122_0001011 Ga0496122_0001011_21566_23677 703
388 3300048926 Ga0496123_0001830 Ga0496123_0001830_21671_23782 703
389 3300048927 Ga0496124_0000219 Ga0496124_0000219_10219_12330 703

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00326

Peptidase_S9

Prolyl oligopeptidase family

557

761

0.94

PF02897

Peptidase_S9_N

Prolyl oligopeptidase, N-terminal beta-propeller domain

73

487

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hvt-assembly1.cif.gz_A structure of a post-proline cleaving enzyme from rickettsia typhi 0.9511 31 701
4hvt-assembly1.cif.gz_A structure of a post-proline cleaving enzyme from rickettsia typhi 0.9229 31 701
2bkl-assembly1.cif.gz_A structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity 0.9002 29 703
7y1x-assembly1.cif.gz_A crystal structure of prolyl oligopeptidase from microbulbifer arenaceous complex with peg400 and mes 0.8932 29 703
2bkl-assembly1.cif.gz_A structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity 0.8735 29 703
ID Description Score Start End Superfamily
af_O07178_411_672_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.988 440 701 3.40.50.1820
af_O07178_411_672_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9806 440 701 3.40.50.1820
4hvtA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9806 439 701 3.40.50.1820
af_O07178_69_406_2.130.10.120 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain 0.9748 89 434 2.130.10.120
af_O07178_69_406_2.130.10.120 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain 0.9663 89 434 2.130.10.120
ID Description Score Start End GO Terms
AF-A0A5D8YR29-F1-model_v4 S9 family peptidase 0.9934 26 703 GO:0004252
GO:0005829
GO:0006508
GO:0070012
AF-A0A5D8YR29-F1-model_v4 S9 family peptidase 0.9905 26 703 GO:0004252
GO:0005829
GO:0006508
GO:0070012
AF-A0A1I8AI13-F1-model_v4 Prolyl endopeptidase (EC 3.4.21.-) 0.9878 512 629 GO:0004252
GO:0005829
GO:0006508
GO:0070012
AF-A0A354EWB3-F1-model_v4 S9 family peptidase 0.9874 494 696 GO:0004252
GO:0005829
GO:0006508
GO:0070012
AF-A0A356J7E4-F1-model_v4 S9 family peptidase 0.987 498 703 GO:0004252
GO:0005829
GO:0006508
GO:0070012

Feature Viewer

pLDDT pTM Quality
93.58 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map