F430585

General Info

Members Datasets Scaffolds Average Seq Length
386 203 772 302

Family's Representative Sequence

Representative Sequence 3300042001|Ga0439441_009739|Ga0439441_009739_383_1345
Length 320
Sequence VVEVNVELVGYALEIAQAALALLLAPGLVGLVRWLKARLQNRRGAPVWQPYWDLAKLFQKEVVVSSNASWLFRVAPFVVFASTVAVTFLVPILAVPLPFDGVGDLLVVVYLLLLGTFFLSLAGLDPGSPFGGMGASREMTVAALAEPTVALAIFALALSAGSTNLGQIVARTMADPAAAVSPGHLLAFGALFVVTLAETGRLPIDNPATHLELTMIHEAMILEYSGRYLALIEWAAGLKLLIFFLLLGNLFVPWGVSVVLTPATLAVAVVSLLAKLVVLAGVVAVLETRIAKLRLFRVPELLSVSFVLALLAVTSSFLLR

Samples

Sample ID Description Type Environment
1 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
129 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
130 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
131 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
132 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
139 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
140 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
141 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
142 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
143 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 0.78
Rhizosphere 98.45
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439441_009739 3300042001 Bacteria 1598
2 Ga0065707_10017043 3300005295 Bacteria 2053
3 Ga0070676_10029215 3300005328 Bacteria 3136
4 Ga0070670_100225781 3300005331 Bacteria 1629
5 Ga0068869_100001719 3300005334 Bacteria 13073
6 Ga0068869_100044682 3300005334 Bacteria 3186
7 Ga0070680_100017383 3300005336 Bacteria 5671
8 Ga0070680_100017579 3300005336 Bacteria 5640
9 Ga0070660_100009473 3300005339 Bacteria 6852
10 Ga0070689_100018249 3300005340 Bacteria 5165
11 Ga0070691_10019404 3300005341 Bacteria 3138
12 Ga0070691_10025888 3300005341 Bacteria 2734
13 Ga0070661_100002730 3300005344 Bacteria 12099
14 Ga0070692_10015016 3300005345 Bacteria 3653
15 Ga0070669_100127880 3300005353 Bacteria 1946
16 Ga0070669_100131889 3300005353 Bacteria 1918
17 Ga0070675_100000288 3300005354 Bacteria 33540
18 Ga0070673_100016229 3300005364 Bacteria 5260
19 Ga0070688_100026525 3300005365 Bacteria 3443
20 Ga0070667_100073161 3300005367 Bacteria 2922
21 Ga0070703_10002388 3300005406 Bacteria 5419
22 Ga0070703_10014927 3300005406 Bacteria 2218
23 Ga0070705_100002339 3300005440 Bacteria 9563
24 Ga0070705_100036855 3300005440 Bacteria 2753
25 Ga0070705_100060538 3300005440 Bacteria 2246
26 Ga0070694_100008047 3300005444 Bacteria 6440
27 Ga0070694_100040270 3300005444 Bacteria 3114
28 Ga0070694_100113296 3300005444 Bacteria 1935
29 Ga0070708_100009553 3300005445 Bacteria 7820
30 Ga0070708_100082673 3300005445 Bacteria 2909
31 Ga0070708_100217914 3300005445 Bacteria 1789
32 Ga0070663_100004481 3300005455 Bacteria 8220
33 Ga0070681_10016149 3300005458 Bacteria 7443
34 Ga0068867_100006714 3300005459 Bacteria 8134
35 Ga0068867_100090199 3300005459 Bacteria 2325
36 Ga0068867_100189809 3300005459 Bacteria 1639
37 Ga0070706_100002788 3300005467 Bacteria 17471
38 Ga0070706_100011984 3300005467 Bacteria 8047
39 Ga0070706_100030829 3300005467 Bacteria 4944
40 Ga0070706_100038736 3300005467 Bacteria 4399
41 Ga0070706_100060305 3300005467 Bacteria 3502
42 Ga0070706_100183030 3300005467 Bacteria 1957
43 Ga0070707_100008273 3300005468 Bacteria 9653
44 Ga0070707_100012301 3300005468 Bacteria 7989
45 Ga0070707_100021372 3300005468 Bacteria 6116
46 Ga0070707_100027008 3300005468 Bacteria 5458
47 Ga0070707_100101439 3300005468 Bacteria 2789
48 Ga0070707_100235440 3300005468 Bacteria 1782
49 Ga0070698_100005945 3300005471 Bacteria 13309
50 Ga0070698_100006089 3300005471 Bacteria 13142
51 Ga0070698_100008316 3300005471 Bacteria 11218
52 Ga0070698_100139573 3300005471 Bacteria 2376
53 Ga0070698_100193010 3300005471 Bacteria 1974
54 Ga0070699_100006924 3300005518 Bacteria 9857
55 Ga0070699_100007209 3300005518 Bacteria 9672
56 Ga0070699_100032257 3300005518 Bacteria 4522
57 Ga0070699_100047501 3300005518 Bacteria 3714
58 Ga0070699_100059324 3300005518 Bacteria 3315
59 Ga0070679_100026585 3300005530 Bacteria 5689
60 Ga0070697_100004663 3300005536 Bacteria 10514
61 Ga0070697_100005307 3300005536 Bacteria 9904
62 Ga0070697_100025374 3300005536 Bacteria 4729
63 Ga0070697_100047493 3300005536 Bacteria 3480
64 Ga0068853_100048205 3300005539 Bacteria 3658
65 Ga0070695_100000750 3300005545 Bacteria 17394
66 Ga0070695_100000844 3300005545 Bacteria 16508
67 Ga0070695_100005473 3300005545 Bacteria 7477
68 Ga0070695_100041126 3300005545 Bacteria 2929
69 Ga0070695_100094397 3300005545 Bacteria 2003
70 Ga0070696_100001758 3300005546 Bacteria 14211
71 Ga0070696_100039492 3300005546 Bacteria 3259
72 Ga0070693_100010138 3300005547 Bacteria 4709
73 Ga0070693_100041188 3300005547 Bacteria 2597
74 Ga0070693_100044925 3300005547 Bacteria 2501
75 Ga0070704_100018692 3300005549 Bacteria 4438
76 Ga0070704_100054746 3300005549 Bacteria 2825
77 Ga0068855_100040725 3300005563 Bacteria 5512
78 Ga0068857_100434941 3300005577 Bacteria 1225
79 Ga0068854_100016782 3300005578 Bacteria 4888
80 Ga0068856_100044857 3300005614 Bacteria 4351
81 Ga0070702_100013793 3300005615 Bacteria 4088
82 Ga0068859_100002217 3300005617 Bacteria 19713
83 Ga0068859_100007149 3300005617 Bacteria 11333
84 Ga0068859_100126289 3300005617 Bacteria 2627
85 Ga0068859_100318064 3300005617 Unclassified 1650
86 Ga0068864_100133993 3300005618 Bacteria 2229
87 Ga0068864_100179787 3300005618 Bacteria 1933
88 Ga0068866_10028057 3300005718 Bacteria 2679
89 Ga0068861_100202320 3300005719 Bacteria 1668
90 Ga0068870_10001829 3300005840 Bacteria 8737
91 Ga0068870_10259231 3300005840 Bacteria 1081
92 Ga0068858_100008608 3300005842 Bacteria 9801
93 Ga0068858_100023308 3300005842 Bacteria 5769
94 Ga0068858_100098105 3300005842 Bacteria 2732
95 Ga0068858_100230261 3300005842 Bacteria 1757
96 Ga0068860_100001111 3300005843 Bacteria 29613
97 Ga0068860_100008674 3300005843 Bacteria 10126
98 Ga0068860_100118041 3300005843 Bacteria 2539
99 Ga0068862_100011186 3300005844 Bacteria 7410
100 Ga0068862_100044467 3300005844 Bacteria 3788
101 Ga0068862_100264635 3300005844 Bacteria 1571
102 Ga0081455_10000416 3300005937 Bacteria 56066
103 Ga0070712_100004650 3300006175 Bacteria 8489
104 Ga0075428_100137516 3300006844 Bacteria 2656
105 Ga0075428_100157829 3300006844 Bacteria 2463
106 Ga0075430_100001387 3300006846 Bacteria 19662
107 Ga0075430_100132811 3300006846 Bacteria 2075
108 Ga0075431_100024853 3300006847 Bacteria 6142
109 Ga0075433_10016130 3300006852 Bacteria 6146
110 Ga0075433_10216788 3300006852 Bacteria 1701
111 Ga0075433_10311363 3300006852 Bacteria 1393
112 Ga0075434_100014642 3300006871 Bacteria 7502
113 Ga0075434_100025641 3300006871 Bacteria 5769
114 Ga0075434_100051259 3300006871 Bacteria 4101
115 Ga0075429_100041078 3300006880 Bacteria 4028
116 Ga0075429_100077215 3300006880 Bacteria 2902
117 Ga0068865_100195873 3300006881 Bacteria 1566
118 Ga0075436_100007823 3300006914 Bacteria 7313
119 Ga0075436_100052565 3300006914 Bacteria 2812
120 Ga0097620_100002216 3300006931 Bacteria 19713
121 Ga0097620_100007149 3300006931 Bacteria 11333
122 Ga0097620_100126291 3300006931 Bacteria 2627
123 Ga0097620_100318072 3300006931 Unclassified 1650
124 Ga0075435_100008013 3300007076 Bacteria 7560
125 Ga0075435_100011332 3300007076 Bacteria 6553
126 Ga0075435_100024744 3300007076 Bacteria 4665
127 Ga0075435_100045294 3300007076 Bacteria 3526
128 Ga0099794_10091883 3300007265 Bacteria 1507
129 Ga0111539_10034573 3300009094 Bacteria 6126
130 Ga0105245_10072639 3300009098 Bacteria 3126
131 Ga0114129_10021470 3300009147 Bacteria 9163
132 Ga0114129_10065957 3300009147 Bacteria 5050
133 Ga0114129_10194610 3300009147 Bacteria 2750
134 Ga0105243_10032049 3300009148 Bacteria 4057
135 Ga0105241_10000548 3300009174 Bacteria 28371
136 Ga0105248_10226093 3300009177 Bacteria 2106
137 Ga0105237_10007471 3300009545 Bacteria 11956
138 Ga0105237_10389274 3300009545 Bacteria 1399
139 Ga0105239_10216563 3300010375 Bacteria 2147
140 Ga0157373_10001517 3300013100 Bacteria 17700
141 Ga0157369_10013032 3300013105 Bacteria 9418
142 Ga0157374_10497378 3300013296 Bacteria 1224
143 Ga0157378_10070675 3300013297 Bacteria 3134
144 Ga0157372_10001082 3300013307 Bacteria 29657
145 Ga0157372_10053355 3300013307 Bacteria 4506
146 Ga0163163_10329016 3300014325 Bacteria 1582
147 Ga0157379_10040701 3300014968 Bacteria 4148
148 Ga0206353_11886314 3300020082 Bacteria 3736
149 Ga0207688_10041251 3300025901 Bacteria 2567
150 Ga0207647_10099836 3300025904 Bacteria 1723
151 Ga0207645_10020346 3300025907 Bacteria 4344
152 Ga0207643_10006168 3300025908 Bacteria 6413
153 Ga0207684_10000882 3300025910 Bacteria 34234
154 Ga0207684_10024481 3300025910 Bacteria 5146
155 Ga0207684_10026947 3300025910 Bacteria 4900
156 Ga0207684_10059532 3300025910 Bacteria 3243
157 Ga0207684_10275809 3300025910 Bacteria 1450
158 Ga0207654_10008964 3300025911 Bacteria 5075
159 Ga0207707_10000464 3300025912 Bacteria 42082
160 Ga0207671_10008141 3300025914 Bacteria 8945
161 Ga0207693_10005836 3300025915 Bacteria 10218
162 Ga0207663_10237487 3300025916 Bacteria 1335
163 Ga0207660_10001523 3300025917 Bacteria 15549
164 Ga0207662_10222105 3300025918 Bacteria 1231
165 Ga0207657_10000485 3300025919 Bacteria 41999
166 Ga0207649_10016785 3300025920 Bacteria 4139
167 Ga0207652_10017871 3300025921 Bacteria 5810
168 Ga0207652_10394386 3300025921 Bacteria 1249
169 Ga0207646_10001105 3300025922 Bacteria 34375
170 Ga0207646_10015917 3300025922 Bacteria 7072
171 Ga0207646_10035215 3300025922 Bacteria 4522
172 Ga0207646_10087442 3300025922 Bacteria 2789
173 Ga0207681_10024861 3300025923 Bacteria 3847
174 Ga0207650_10025611 3300025925 Bacteria 4203
175 Ga0207659_10000069 3300025926 Bacteria 65505
176 Ga0207706_10022223 3300025933 Bacteria 5692
177 Ga0207709_10129248 3300025935 Bacteria 1719
178 Ga0207689_10000342 3300025942 Bacteria 43552
179 Ga0207689_10004135 3300025942 Bacteria 13187
180 Ga0207689_10053052 3300025942 Bacteria 3340
181 Ga0207679_10002474 3300025945 Bacteria 11374
182 Ga0207667_10139183 3300025949 Bacteria 2499
183 Ga0207651_10064862 3300025960 Bacteria 2558
184 Ga0207640_10051253 3300025981 Bacteria 2682
185 Ga0207658_10128532 3300025986 Bacteria 2032
186 Ga0207703_10029070 3300026035 Bacteria 4360
187 Ga0207703_10067695 3300026035 Bacteria 2940
188 Ga0207639_10025850 3300026041 Bacteria 4260
189 Ga0207678_10000890 3300026067 Bacteria 27472
190 Ga0207641_10025767 3300026088 Bacteria 4850
191 Ga0207648_10007411 3300026089 Bacteria 10799
192 Ga0207648_10046717 3300026089 Bacteria 3796
193 Ga0207648_10101100 3300026089 Bacteria 2527
194 Ga0207648_10214913 3300026089 Bacteria 1708
195 Ga0207676_10051273 3300026095 Bacteria 3221
196 Ga0207676_10196685 3300026095 Bacteria 1778
197 Ga0207674_10011323 3300026116 Bacteria 10024
198 Ga0207674_10452475 3300026116 Bacteria 1241
199 Ga0207675_100117752 3300026118 Bacteria 2511
200 Ga0209967_1003277 3300027364 Bacteria 2131
201 Ga0210000_1008974 3300027462 Bacteria 1468
202 Ga0209588_1006944 3300027671 Bacteria 3314
203 Ga0209971_1000025 3300027682 Bacteria 55165
204 Ga0209966_1000094 3300027695 Bacteria 39116
205 Ga0209998_10000073 3300027717 Bacteria 40367
206 Ga0209974_10007766 3300027876 Bacteria 3688
207 Ga0207428_10184375 3300027907 Bacteria 1575
208 Ga0268265_10013040 3300028380 Bacteria 5644
209 Ga0268265_10155714 3300028380 Bacteria 1933
210 Ga0268264_10001912 3300028381 Bacteria 18818
211 Ga0268264_10085020 3300028381 Bacteria 2714
212 Ga0307515_10198197 3300028794 Bacteria 1893
213 Ga0265328_10010823 3300031239 Bacteria 3663
214 Ga0307513_10016715 3300031456 Bacteria 8830
215 Ga0307408_100039010 3300031548 Bacteria 3354
216 Ga0307408_100138710 3300031548 Bacteria 1906
217 Ga0307411_10026132 3300032005 Bacteria 3511
218 Ga0307415_100210774 3300032126 Bacteria 1550
219 Ga0373930_0012091 3300034816 Bacteria 1570
220 Ga0373948_0025664 3300034817 Bacteria 1157
221 Ga0373952_0018723 3300035092 Bacteria 1435
222 Ga0373960_0012391 3300035121 Bacteria 2118
223 Ga0373962_0024984 3300035242 Bacteria 1602
224 Ga0373931_0040136 3300035691 Bacteria 2455
225 Ga0373931_0041356 3300035691 Bacteria 2421
226 Ga0373931_0054385 3300035691 Bacteria 2139
227 Ga0395899_0005020 3300037312 Bacteria 10292
228 Ga0395900_0007726 3300037418 Bacteria 11091
229 Ga0395898_0004379 3300037466 Bacteria 15447
230 Ga0395901_0000392 3300038443 Bacteria 52263
231 Ga0439448_0046565 3300042005 Bacteria 1413
232 Ga0439448_0057050 3300042005 Bacteria 1286
233 Ga0439455_0031345 3300042012 Bacteria 1323
234 Ga0450889_003511 3300042144 Bacteria 1548
235 Ga0439446_0027850 3300042156 Bacteria 1624
236 Ga0439458_0002465 3300042157 Bacteria 4502
237 Ga0439459_0009473 3300042438 Bacteria 1685
238 Ga0439460_0001977 3300042461 Bacteria 4908
239 Ga0451577_0027522 3300042876 Bacteria 5147
240 Ga0451577_0122143 3300042876 Bacteria 2333
241 Ga0451577_0254044 3300042876 Bacteria 1591
242 Ga0451577_0485073 3300042876 Bacteria 1122
243 Ga0453683_0021631 3300044673 Bacteria 4104
244 Ga0453683_0054026 3300044673 Bacteria 2514
245 Ga0453683_0094862 3300044673 Bacteria 1872
246 Ga0453683_0196657 3300044673 Bacteria 1280
247 Ga0453684_0005041 3300044712 Bacteria 26781
248 Ga0453684_0007530 3300044712 Bacteria 19970
249 Ga0453684_0020736 3300044712 Bacteria 9888
250 Ga0453684_0024361 3300044712 Bacteria 8847
251 Ga0451576_0003281 3300045051 Bacteria 22468
252 Ga0451576_0048034 3300045051 Bacteria 4485
253 Ga0451576_0112871 3300045051 Bacteria 2828
254 Ga0451576_0129473 3300045051 Bacteria 2630
255 Ga0451576_0136059 3300045051 Bacteria 2562
256 Ga0451576_0675898 3300045051 Bacteria 1085
257 Ga0451576_0790549 3300045051 Bacteria 996
258 Ga0495603_0190950 3300046455 Bacteria 1184
259 Ga0495629_0000494 3300046459 Bacteria 32996
260 Ga0495641_0020993 3300046461 Bacteria 3296
261 Ga0495594_0013425 3300046499 Bacteria 4278
262 Ga0495586_0213174 3300046535 Bacteria 1096
263 Ga0495634_0013094 3300046642 Bacteria 5996
264 Ga0495635_0000925 3300046663 Bacteria 19345
265 Ga0495659_0018516 3300046664 Bacteria 2321
266 Ga0495658_0000192 3300046683 Bacteria 35221
267 Ga0495658_0003077 3300046683 Bacteria 8346
268 Ga0495613_0001234 3300046689 Bacteria 19554
269 Ga0495581_0000102 3300047315 Bacteria 35308
270 Ga0495680_0000914 3300047322 Bacteria 32786
271 Ga0495614_0000810 3300048089 Bacteria 13208
272 Ga0496102_0003731 3300048905 Bacteria 12875
273 Ga0496102_0027864 3300048905 Bacteria 5046
274 Ga0496110_0010046 3300048913 Bacteria 7682
275 Ga0501031_0031996 3300049568 Bacteria 3431
276 Ga0501033_0013691 3300049570 Bacteria 6171
277 Ga0501036_0013503 3300049572 Bacteria 6788
278 Ga0501036_0114233 3300049572 Bacteria 2282
279 Ga0501036_0277815 3300049572 Bacteria 1402
280 Ga0501036_0312802 3300049572 Bacteria 1313
281 Ga0501036_0404771 3300049572 Bacteria 1138
282 Ga0501038_0004927 3300049574 Bacteria 12398
283 Ga0501038_0043364 3300049574 Bacteria 3912
284 Ga0501039_0001145 3300049575 Bacteria 19562
285 Ga0501039_0151363 3300049575 Bacteria 1823
286 Ga0501040_0005094 3300049576 Bacteria 8493
287 Ga0501040_0052122 3300049576 Bacteria 2800
288 Ga0501040_0144968 3300049576 Bacteria 1674
289 Ga0501041_0000861 3300049577 Bacteria 16355
290 Ga0501041_0001480 3300049577 Bacteria 13002
291 Ga0501041_0078487 3300049577 Bacteria 2032
292 Ga0501041_0303483 3300049577 Bacteria 1006
293 Ga0501042_0002582 3300049578 Bacteria 11140
294 Ga0501042_0059177 3300049578 Bacteria 2736
295 Ga0501046_0000869 3300049580 Bacteria 29418
296 Ga0501046_0019175 3300049580 Bacteria 5674
297 Ga0501047_0159181 3300049581 Bacteria 2130
298 Ga0501048_0000841 3300049582 Bacteria 22604
299 Ga0501048_0044082 3300049582 Bacteria 3191
300 Ga0501048_0102675 3300049582 Bacteria 2018
301 Ga0501048_0137508 3300049582 Bacteria 1727
302 Ga0501070_0004730 3300049586 Bacteria 11656
303 Ga0501070_0011192 3300049586 Bacteria 7574
304 Ga0501071_0002906 3300049587 Bacteria 10568
305 Ga0501071_0135304 3300049587 Bacteria 1833
306 Ga0501071_0285086 3300049587 Bacteria 1250
307 Ga0501072_0000821 3300049588 Bacteria 22839
308 Ga0501072_0098218 3300049588 Bacteria 2328
309 Ga0501072_0159432 3300049588 Bacteria 1800
310 Ga0501073_0022771 3300049589 Bacteria 4507
311 Ga0501073_0082750 3300049589 Bacteria 2233
312 Ga0501074_0002554 3300049590 Bacteria 12704
313 Ga0501074_0018745 3300049590 Bacteria 5027
314 Ga0501075_0000605 3300049591 Bacteria 21962
315 Ga0501075_0002199 3300049591 Bacteria 12906
316 Ga0501075_0024479 3300049591 Bacteria 4428
317 Ga0501075_0063483 3300049591 Bacteria 2784
318 Ga0501075_0072582 3300049591 Bacteria 2602
319 Ga0501075_0075386 3300049591 Bacteria 2551
320 Ga0501075_0469322 3300049591 Bacteria 960
321 Ga0501076_0002902 3300049592 Bacteria 11869
322 Ga0501076_0078236 3300049592 Bacteria 2654
323 Ga0501076_0205182 3300049592 Bacteria 1610
324 Ga0501076_0255471 3300049592 Bacteria 1434
325 Ga0501077_0000240 3300049593 Bacteria 32375
326 Ga0501077_0009047 3300049593 Bacteria 6181
327 Ga0501077_0063177 3300049593 Bacteria 2349
328 Ga0501079_0000249 3300049741 Bacteria 32685
329 Ga0501079_0006964 3300049741 Bacteria 8519
330 Ga0501079_0023498 3300049741 Bacteria 4730
331 Ga0501079_0025344 3300049741 Bacteria 4549
332 Ga0501080_0005570 3300049742 Bacteria 11248
333 Ga0501080_0007814 3300049742 Bacteria 9673
334 Ga0501080_0032258 3300049742 Bacteria 4884
335 Ga0501081_0003287 3300049743 Bacteria 10272
336 Ga0501081_0003447 3300049743 Bacteria 10092
337 Ga0501081_0030994 3300049743 Bacteria 3623
338 Ga0501081_0113726 3300049743 Bacteria 1922
339 Ga0501081_0226970 3300049743 Bacteria 1359
340 Ga0501083_0009830 3300049744 Bacteria 6753
341 Ga0501083_0084253 3300049744 Bacteria 2105
342 Ga0501083_0136514 3300049744 Bacteria 1607
343 Ga0501035_0115771 3300049822 Bacteria 2346
344 Ga0501044_0074483 3300049823 Bacteria 3449
345 Ga0501045_0000480 3300049824 Bacteria 24743
346 Ga0501045_0000697 3300049824 Bacteria 21376
347 Ga0501045_0149808 3300049824 Bacteria 1735
348 nmdc:mga05p37_141875_c1 3300050507 Bacteria 2943
349 nmdc:mga05p37_153454_c1 3300050507 Bacteria 2816
350 nmdc:mga05p37_158283_c1 3300050507 Bacteria 2767
351 nmdc:mga05p37_27422_c1 3300050507 Bacteria 1766
352 nmdc:mga05p37_54742_c1 3300050507 Bacteria 4908
353 nmdc:mga09592_123029_c1 3300050508 Bacteria 2229
354 nmdc:mga09592_97863_c1 3300050508 Bacteria 939
355 nmdc:mga0qj67_1684_c1 3300050509 Bacteria 15573
356 nmdc:mga06r32_62911_c1 3300050510 Bacteria 3576
357 nmdc:mga08y16_26587_c1 3300050511 Bacteria 6100
358 nmdc:mga0n895_104062_c1 3300050512 Bacteria 2851
359 nmdc:mga0n895_1443_c1 3300050512 Bacteria 17764
360 nmdc:mga0n895_197153_c1 3300050512 Bacteria 2045
361 nmdc:mga0n895_34663_c1 3300050512 Bacteria 4861
362 nmdc:mga0n895_427100_c1 3300050512 Bacteria 1339
363 nmdc:mga0n895_737913_c1 3300050512 Bacteria 979
364 nmdc:mga0rr50_224624_c1 3300050513 Bacteria 1552
365 nmdc:mga0rr50_26828_c1 3300050513 Bacteria 4027
366 nmdc:mga0rr50_9794_c1 3300050513 Bacteria 6049
367 nmdc:mga08x19_16305_c1 3300050514 Bacteria 4529
368 nmdc:mga08x19_53590_c1 3300050514 Bacteria 2595
369 nmdc:mga0a205_112633_c1 3300050515 Bacteria 2620
370 nmdc:mga0a205_124193_c1 3300050515 Bacteria 2481
371 nmdc:mga0a205_168475_c1 3300050515 Bacteria 2086
372 nmdc:mga0a205_345218_c1 3300050515 Bacteria 1357
373 nmdc:mga0a205_6189_c1 3300050515 Bacteria 10801
374 Ga0495619_0000876 3300053085 Bacteria 19791
375 Ga0500559_0003200 3300053136 Bacteria 8140
376 Ga0501084_0003815 3300054114 Bacteria 12253
377 Ga0501084_0004795 3300054114 Bacteria 11057
378 Ga0501082_0000416 3300060353 Bacteria 37669
379 Ga0501082_0011928 3300060353 Bacteria 7473
380 Ga0501082_0073546 3300060353 Bacteria 2944
381 Ga0501082_0204636 3300060353 Bacteria 1717
382 Ga0530510_0002932 3300061734 Bacteria 11702
383 Ga0530510_0014171 3300061734 Bacteria 5620
384 Ga0530510_0015993 3300061734 Bacteria 5303
385 Ga0530510_0030939 3300061734 Bacteria 3846
386 Ga0530510_0111681 3300061734 Bacteria 2002
387 Ga0439441_009739
388 Ga0065707_10017043
389 Ga0070676_10029215
390 Ga0070670_100225781
391 Ga0068869_100001719
392 Ga0068869_100044682
393 Ga0070680_100017383
394 Ga0070680_100017579
395 Ga0070660_100009473
396 Ga0070689_100018249
397 Ga0070691_10019404
398 Ga0070691_10025888
399 Ga0070661_100002730
400 Ga0070692_10015016
401 Ga0070669_100127880
402 Ga0070669_100131889
403 Ga0070675_100000288
404 Ga0070673_100016229
405 Ga0070688_100026525
406 Ga0070667_100073161
407 Ga0070703_10002388
408 Ga0070703_10014927
409 Ga0070705_100002339
410 Ga0070705_100036855
411 Ga0070705_100060538
412 Ga0070694_100008047
413 Ga0070694_100040270
414 Ga0070694_100113296
415 Ga0070708_100009553
416 Ga0070708_100082673
417 Ga0070708_100217914
418 Ga0070663_100004481
419 Ga0070681_10016149
420 Ga0068867_100006714
421 Ga0068867_100090199
422 Ga0068867_100189809
423 Ga0070706_100002788
424 Ga0070706_100011984
425 Ga0070706_100030829
426 Ga0070706_100038736
427 Ga0070706_100060305
428 Ga0070706_100183030
429 Ga0070707_100008273
430 Ga0070707_100012301
431 Ga0070707_100021372
432 Ga0070707_100027008
433 Ga0070707_100101439
434 Ga0070707_100235440
435 Ga0070698_100005945
436 Ga0070698_100006089
437 Ga0070698_100008316
438 Ga0070698_100139573
439 Ga0070698_100193010
440 Ga0070699_100006924
441 Ga0070699_100007209
442 Ga0070699_100032257
443 Ga0070699_100047501
444 Ga0070699_100059324
445 Ga0070679_100026585
446 Ga0070697_100004663
447 Ga0070697_100005307
448 Ga0070697_100025374
449 Ga0070697_100047493
450 Ga0068853_100048205
451 Ga0070695_100000750
452 Ga0070695_100000844
453 Ga0070695_100005473
454 Ga0070695_100041126
455 Ga0070695_100094397
456 Ga0070696_100001758
457 Ga0070696_100039492
458 Ga0070693_100010138
459 Ga0070693_100041188
460 Ga0070693_100044925
461 Ga0070704_100018692
462 Ga0070704_100054746
463 Ga0068855_100040725
464 Ga0068857_100434941
465 Ga0068854_100016782
466 Ga0068856_100044857
467 Ga0070702_100013793
468 Ga0068859_100002217
469 Ga0068859_100007149
470 Ga0068859_100126289
471 Ga0068859_100318064
472 Ga0068864_100133993
473 Ga0068864_100179787
474 Ga0068866_10028057
475 Ga0068861_100202320
476 Ga0068870_10001829
477 Ga0068870_10259231
478 Ga0068858_100008608
479 Ga0068858_100023308
480 Ga0068858_100098105
481 Ga0068858_100230261
482 Ga0068860_100001111
483 Ga0068860_100008674
484 Ga0068860_100118041
485 Ga0068862_100011186
486 Ga0068862_100044467
487 Ga0068862_100264635
488 Ga0081455_10000416
489 Ga0070712_100004650
490 Ga0075428_100137516
491 Ga0075428_100157829
492 Ga0075430_100001387
493 Ga0075430_100132811
494 Ga0075431_100024853
495 Ga0075433_10016130
496 Ga0075433_10216788
497 Ga0075433_10311363
498 Ga0075434_100014642
499 Ga0075434_100025641
500 Ga0075434_100051259
501 Ga0075429_100041078
502 Ga0075429_100077215
503 Ga0068865_100195873
504 Ga0075436_100007823
505 Ga0075436_100052565
506 Ga0097620_100002216
507 Ga0097620_100007149
508 Ga0097620_100126291
509 Ga0097620_100318072
510 Ga0075435_100008013
511 Ga0075435_100011332
512 Ga0075435_100024744
513 Ga0075435_100045294
514 Ga0099794_10091883
515 Ga0111539_10034573
516 Ga0105245_10072639
517 Ga0114129_10021470
518 Ga0114129_10065957
519 Ga0114129_10194610
520 Ga0105243_10032049
521 Ga0105241_10000548
522 Ga0105248_10226093
523 Ga0105237_10007471
524 Ga0105237_10389274
525 Ga0105239_10216563
526 Ga0157373_10001517
527 Ga0157369_10013032
528 Ga0157374_10497378
529 Ga0157378_10070675
530 Ga0157372_10001082
531 Ga0157372_10053355
532 Ga0163163_10329016
533 Ga0157379_10040701
534 Ga0206353_11886314
535 Ga0207688_10041251
536 Ga0207647_10099836
537 Ga0207645_10020346
538 Ga0207643_10006168
539 Ga0207684_10000882
540 Ga0207684_10024481
541 Ga0207684_10026947
542 Ga0207684_10059532
543 Ga0207684_10275809
544 Ga0207654_10008964
545 Ga0207707_10000464
546 Ga0207671_10008141
547 Ga0207693_10005836
548 Ga0207663_10237487
549 Ga0207660_10001523
550 Ga0207662_10222105
551 Ga0207657_10000485
552 Ga0207649_10016785
553 Ga0207652_10017871
554 Ga0207652_10394386
555 Ga0207646_10001105
556 Ga0207646_10015917
557 Ga0207646_10035215
558 Ga0207646_10087442
559 Ga0207681_10024861
560 Ga0207650_10025611
561 Ga0207659_10000069
562 Ga0207706_10022223
563 Ga0207709_10129248
564 Ga0207689_10000342
565 Ga0207689_10004135
566 Ga0207689_10053052
567 Ga0207679_10002474
568 Ga0207667_10139183
569 Ga0207651_10064862
570 Ga0207640_10051253
571 Ga0207658_10128532
572 Ga0207703_10029070
573 Ga0207703_10067695
574 Ga0207639_10025850
575 Ga0207678_10000890
576 Ga0207641_10025767
577 Ga0207648_10007411
578 Ga0207648_10046717
579 Ga0207648_10101100
580 Ga0207648_10214913
581 Ga0207676_10051273
582 Ga0207676_10196685
583 Ga0207674_10011323
584 Ga0207674_10452475
585 Ga0207675_100117752
586 Ga0209967_1003277
587 Ga0210000_1008974
588 Ga0209588_1006944
589 Ga0209971_1000025
590 Ga0209966_1000094
591 Ga0209998_10000073
592 Ga0209974_10007766
593 Ga0207428_10184375
594 Ga0268265_10013040
595 Ga0268265_10155714
596 Ga0268264_10001912
597 Ga0268264_10085020
598 Ga0307515_10198197
599 Ga0265328_10010823
600 Ga0307513_10016715
601 Ga0307408_100039010
602 Ga0307408_100138710
603 Ga0307411_10026132
604 Ga0307415_100210774
605 Ga0373930_0012091
606 Ga0373948_0025664
607 Ga0373952_0018723
608 Ga0373960_0012391
609 Ga0373962_0024984
610 Ga0373931_0040136
611 Ga0373931_0041356
612 Ga0373931_0054385
613 Ga0395899_0005020
614 Ga0395900_0007726
615 Ga0395898_0004379
616 Ga0395901_0000392
617 Ga0439448_0046565
618 Ga0439448_0057050
619 Ga0439455_0031345
620 Ga0450889_003511
621 Ga0439446_0027850
622 Ga0439458_0002465
623 Ga0439459_0009473
624 Ga0439460_0001977
625 Ga0451577_0027522
626 Ga0451577_0122143
627 Ga0451577_0254044
628 Ga0451577_0485073
629 Ga0453683_0021631
630 Ga0453683_0054026
631 Ga0453683_0094862
632 Ga0453683_0196657
633 Ga0453684_0005041
634 Ga0453684_0007530
635 Ga0453684_0020736
636 Ga0453684_0024361
637 Ga0451576_0003281
638 Ga0451576_0048034
639 Ga0451576_0112871
640 Ga0451576_0129473
641 Ga0451576_0136059
642 Ga0451576_0675898
643 Ga0451576_0790549
644 Ga0495603_0190950
645 Ga0495629_0000494
646 Ga0495641_0020993
647 Ga0495594_0013425
648 Ga0495586_0213174
649 Ga0495634_0013094
650 Ga0495635_0000925
651 Ga0495659_0018516
652 Ga0495658_0000192
653 Ga0495658_0003077
654 Ga0495613_0001234
655 Ga0495581_0000102
656 Ga0495680_0000914
657 Ga0495614_0000810
658 Ga0496102_0003731
659 Ga0496102_0027864
660 Ga0496110_0010046
661 Ga0501031_0031996
662 Ga0501033_0013691
663 Ga0501036_0013503
664 Ga0501036_0114233
665 Ga0501036_0277815
666 Ga0501036_0312802
667 Ga0501036_0404771
668 Ga0501038_0004927
669 Ga0501038_0043364
670 Ga0501039_0001145
671 Ga0501039_0151363
672 Ga0501040_0005094
673 Ga0501040_0052122
674 Ga0501040_0144968
675 Ga0501041_0000861
676 Ga0501041_0001480
677 Ga0501041_0078487
678 Ga0501041_0303483
679 Ga0501042_0002582
680 Ga0501042_0059177
681 Ga0501046_0000869
682 Ga0501046_0019175
683 Ga0501047_0159181
684 Ga0501048_0000841
685 Ga0501048_0044082
686 Ga0501048_0102675
687 Ga0501048_0137508
688 Ga0501070_0004730
689 Ga0501070_0011192
690 Ga0501071_0002906
691 Ga0501071_0135304
692 Ga0501071_0285086
693 Ga0501072_0000821
694 Ga0501072_0098218
695 Ga0501072_0159432
696 Ga0501073_0022771
697 Ga0501073_0082750
698 Ga0501074_0002554
699 Ga0501074_0018745
700 Ga0501075_0000605
701 Ga0501075_0002199
702 Ga0501075_0024479
703 Ga0501075_0063483
704 Ga0501075_0072582
705 Ga0501075_0075386
706 Ga0501075_0469322
707 Ga0501076_0002902
708 Ga0501076_0078236
709 Ga0501076_0205182
710 Ga0501076_0255471
711 Ga0501077_0000240
712 Ga0501077_0009047
713 Ga0501077_0063177
714 Ga0501079_0000249
715 Ga0501079_0006964
716 Ga0501079_0023498
717 Ga0501079_0025344
718 Ga0501080_0005570
719 Ga0501080_0007814
720 Ga0501080_0032258
721 Ga0501081_0003287
722 Ga0501081_0003447
723 Ga0501081_0030994
724 Ga0501081_0113726
725 Ga0501081_0226970
726 Ga0501083_0009830
727 Ga0501083_0084253
728 Ga0501083_0136514
729 Ga0501035_0115771
730 Ga0501044_0074483
731 Ga0501045_0000480
732 Ga0501045_0000697
733 Ga0501045_0149808
734 nmdc:mga05p37_141875_c1
735 nmdc:mga05p37_153454_c1
736 nmdc:mga05p37_158283_c1
737 nmdc:mga05p37_27422_c1
738 nmdc:mga05p37_54742_c1
739 nmdc:mga09592_123029_c1
740 nmdc:mga09592_97863_c1
741 nmdc:mga0qj67_1684_c1
742 nmdc:mga06r32_62911_c1
743 nmdc:mga08y16_26587_c1
744 nmdc:mga0n895_104062_c1
745 nmdc:mga0n895_1443_c1
746 nmdc:mga0n895_197153_c1
747 nmdc:mga0n895_34663_c1
748 nmdc:mga0n895_427100_c1
749 nmdc:mga0n895_737913_c1
750 nmdc:mga0rr50_224624_c1
751 nmdc:mga0rr50_26828_c1
752 nmdc:mga0rr50_9794_c1
753 nmdc:mga08x19_16305_c1
754 nmdc:mga08x19_53590_c1
755 nmdc:mga0a205_112633_c1
756 nmdc:mga0a205_124193_c1
757 nmdc:mga0a205_168475_c1
758 nmdc:mga0a205_345218_c1
759 nmdc:mga0a205_6189_c1
760 Ga0495619_0000876
761 Ga0500559_0003200
762 Ga0501084_0003815
763 Ga0501084_0004795
764 Ga0501082_0000416
765 Ga0501082_0011928
766 Ga0501082_0073546
767 Ga0501082_0204636
768 Ga0530510_0002932
769 Ga0530510_0014171
770 Ga0530510_0015993
771 Ga0530510_0030939
772 Ga0530510_0111681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00146

NADHdh

NADH dehydrogenase

13

317

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z0t-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) 0.9198 7 313
7z0t-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) 0.9047 7 313
7z0s-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) 0.8925 7 313
7z0s-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) 0.8788 7 313
7o71-assembly1.cif.gz_1 cryo-em structure of a respiratory complex i 0.7827 1 312
ID Description Score Start End Superfamily
af_Q03795_25_200_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3197 134 307 1.20.1250.20
af_A4IA48_423_647_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3086 14 313 1.20.1250.20
af_Q9VEY1_253_667_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3009 63 311 1.20.1250.20
af_O94572_43_249_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2964 63 310 1.20.1250.20
af_P9WJW9_9_219_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2941 62 311 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3D5YBI4-F1-model_v4 Formate hydrogenlyase 0.964 2 111 GO:0005886
GO:0016829
AF-A0A7C5KMA6-F1-model_v4 Formate hydrogenlyase 0.9555 3 113 GO:0005886
AF-A0A377XN63-F1-model_v4 Formate hydrogenlyase subunit 4 0.9503 3 115 GO:0005886
GO:0016829
AF-A0A534DSG4-F1-model_v4 deleted 0.949 1 150
AF-A0A376TTV5-F1-model_v4 Formate hydrogenlyase subunit 4 0.9477 7 166 GO:0005886
GO:0016829

Map