F430327

General Info

Members Datasets Scaffolds Average Seq Length
385 302 322 493

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_0093857|Ga0501081_0093857_235_1977
Length 547
Sequence VVVHVQDEVLAHDGEADQADVGDWLGHGSSFRMRGQVLQRDITVVSGVDPRRCGPHRTCFEPTACAGGGTGTYTAETWHDAAARVELRTQAFIDGAYVDAAGGDSFDCVSPIDGRVLARVAACGEADVDRAVAGARRAFEAGTWSRLAPKQRKRTLLRLAELVTDHLDELALLETLDMGKPIRDARAIDVPGAAECISYFGEAIDKVYDEIAPTDPSAVAMIVREPLGVVGCVVPWNFPLMMATWKIAPALAAGNSVVLKPAEQSPLTALRLAELAAEAGMPEGVLQVVPGFGETAGQAIGRHMDVDMVAFTGSTEVGKLFLRYAGESNMKRISLECGGKSPHIVMPDCADLDAAARAVAWGVFFNQGEVCNAGSRLLVHASLKDELLDRIVGVARKIQPGDPLDPKTRMGPLVDSAQLDRVLGYIEAGTREGASLHLGGARTRTETGGFYVEPTIFDRVSNGMTIARDEIFGPVLALAAGVWTSDINRAHRAARALRAGVVWVNTFDAGDITTPFGGFKQSGFGRDKSIHALEKYTDLKTIWIQLR

Samples

Sample ID Description Type Environment
1 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
2 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
3 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
4 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2643221660 Methylibium sp. Root1272 Isolate Unclassified
7 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
8 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
9 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
10 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
11 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
12 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
13 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
14 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
15 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
16 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
17 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
18 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
19 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
20 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
21 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
22 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
23 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
24 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
25 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
26 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
27 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
28 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
29 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
30 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
31 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
32 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
33 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
34 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
35 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
36 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
37 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
38 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
39 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
40 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
41 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
42 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
43 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
44 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
45 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
46 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
47 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
48 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
49 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
50 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
51 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
52 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
53 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
54 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
55 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
56 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
57 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
58 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
59 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
60 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
61 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
62 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
63 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
64 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
65 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
66 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
67 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
68 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
69 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
70 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
71 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
76 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
77 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
78 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
79 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
80 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
81 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
82 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
83 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
84 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
88 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
144 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
145 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
189 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
190 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
194 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
200 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
229 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
232 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
233 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
281 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
282 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
283 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
284 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
285 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
286 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
287 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
288 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
289 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
290 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
291 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
292 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
293 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
294 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
299 641522639 Methylobacterium sp. 4-46 Isolate Nodule
300 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
301 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
302 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.12
Metatranscriptomes 0.52
Isolates 16.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 10.65
Nodule 12.73
Rhizoplane 6.23
Rhizosphere 61.56
Stem 0
Stem Tuber 0
Unclassified 8.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002951 3300001989 Bacteria 6521
2 JGI24737J22298_10002397 3300001990 Bacteria 6689
3 JGI24738J21930_10002698 3300002075 Bacteria 4572
4 JGI25156J39149_1000278 3300002705 Bacteria 34709
5 JGI25156J39149_1009392 3300002705 Bacteria 2383
6 JGI25154J39366_1000221 3300002738 Bacteria 38916
7 JGI25157J39369_1000049 3300002741 Bacteria 115611
8 rootH1_10001783 3300003323 Bacteria 3137
9 Ga0055533_1000010 3300003756 Bacteria 491196
10 Ga0055525_1000775 3300003759 Bacteria 10334
11 Ga0055535_1000121 3300003761 Bacteria 83760
12 Ga0055535_1000607 3300003761 Bacteria 29519
13 Ga0055535_1000906 3300003761 Bacteria 20145
14 Ga0055529_1000731 3300003763 Bacteria 21383
15 Ga0070683_100045679 3300005329 Bacteria 4043
16 Ga0070690_100007072 3300005330 Bacteria 6406
17 Ga0070670_100197896 3300005331 Bacteria 1746
18 Ga0070680_100038164 3300005336 Bacteria 3884
19 Ga0070682_100001938 3300005337 Bacteria 11550
20 Ga0070669_100026007 3300005353 Bacteria 4209
21 Ga0070675_100108135 3300005354 Bacteria 2349
22 Ga0070671_100012296 3300005355 Bacteria 6891
23 Ga0070671_100055655 3300005355 Bacteria 3290
24 Ga0070673_100006387 3300005364 Bacteria 7660
25 Ga0070673_100069955 3300005364 Bacteria 2815
26 Ga0070688_100009912 3300005365 Bacteria 5235
27 Ga0070659_100006834 3300005366 Bacteria 8262
28 Ga0070667_100114645 3300005367 Bacteria 2340
29 Ga0070701_10038729 3300005438 Bacteria 2414
30 Ga0070711_100066328 3300005439 Bacteria 2528
31 Ga0070711_100192417 3300005439 Bacteria 1569
32 Ga0070700_100062726 3300005441 Bacteria 2349
33 Ga0070694_100027338 3300005444 Bacteria 3704
34 Ga0070662_100003829 3300005457 Bacteria 9419
35 Ga0070662_100122781 3300005457 Bacteria 1992
36 Ga0068867_100000307 3300005459 Bacteria 32299
37 Ga0070706_100053307 3300005467 Bacteria 3733
38 Ga0070698_100069358 3300005471 Bacteria 3540
39 Ga0070679_100008627 3300005530 Bacteria 9607
40 Ga0070684_100007191 3300005535 Bacteria 8651
41 Ga0070684_100008152 3300005535 Bacteria 8179
42 Ga0070684_100017585 3300005535 Bacteria 5873
43 Ga0070684_100084235 3300005535 Bacteria 2818
44 Ga0068853_100088761 3300005539 Bacteria 2715
45 Ga0070665_100009675 3300005548 Bacteria 9744
46 Ga0070704_100009578 3300005549 Bacteria 5865
47 Ga0070704_100014858 3300005549 Bacteria 4872
48 Ga0070704_100040949 3300005549 Bacteria 3194
49 Ga0068855_100094963 3300005563 Bacteria 3437
50 Ga0070664_100013231 3300005564 Bacteria 6720
51 Ga0068857_100000924 3300005577 Bacteria 22245
52 Ga0068857_100215005 3300005577 Bacteria 1755
53 Ga0068856_100001783 3300005614 Bacteria 22491
54 Ga0068856_100107929 3300005614 Bacteria 2780
55 Ga0070702_100060301 3300005615 Bacteria 2205
56 Ga0070702_100076004 3300005615 Bacteria 1998
57 Ga0068852_100032437 3300005616 Bacteria 4325
58 Ga0068859_100296217 3300005617 Bacteria 1711
59 Ga0068864_100001062 3300005618 Bacteria 23035
60 Ga0068861_100074236 3300005719 Bacteria 2644
61 Ga0068870_10016243 3300005840 Bacteria 3552
62 Ga0068863_100001777 3300005841 Bacteria 21386
63 Ga0068863_100071798 3300005841 Bacteria 3275
64 Ga0068862_100016448 3300005844 Bacteria 6156
65 Ga0068862_100128598 3300005844 Bacteria 2239
66 Ga0075364_10017542 3300006051 Unclassified 4475
67 Ga0075364_10026056 3300006051 Bacteria 3727
68 Ga0075432_10007387 3300006058 Bacteria 3741
69 Ga0070712_100106974 3300006175 Bacteria 2080
70 Ga0097621_100172351 3300006237 Bacteria 1866
71 Ga0075370_10012686 3300006353 Bacteria 4462
72 Ga0075428_100002047 3300006844 Bacteria 21753
73 Ga0075429_100054299 3300006880 Bacteria 3485
74 Ga0097620_100296216 3300006931 Bacteria 1711
75 Ga0105251_10000388 3300009011 Bacteria 42962
76 Ga0105240_10169055 3300009093 Bacteria 2591
77 Ga0111539_10201901 3300009094 Bacteria 2318
78 Ga0105245_10001062 3300009098 Bacteria 24876
79 Ga0114129_10005183 3300009147 Bacteria 18351
80 Ga0105243_10000952 3300009148 Bacteria 27019
81 Ga0105243_10081244 3300009148 Bacteria 2646
82 Ga0105248_10012707 3300009177 Bacteria 9292
83 Ga0105237_10025522 3300009545 Bacteria 6043
84 Ga0105238_10016259 3300009551 Bacteria 7531
85 Ga0105239_10011156 3300010375 Bacteria 10029
86 Ga0105246_10106082 3300011119 Bacteria 2054
87 Ga0157370_10003213 3300013104 Bacteria 19314
88 Ga0157369_10003807 3300013105 Bacteria 17914
89 Ga0157369_10058086 3300013105 Bacteria 4173
90 Ga0157369_10068089 3300013105 Bacteria 3825
91 Ga0157378_10046293 3300013297 Bacteria 3867
92 Ga0157378_10066494 3300013297 Bacteria 3229
93 Ga0157372_10031220 3300013307 Bacteria 5833
94 Ga0157372_10084530 3300013307 Bacteria 3597
95 Ga0157372_10099130 3300013307 Bacteria 3324
96 Ga0157375_10174444 3300013308 Bacteria 2299
97 Ga0163163_10030780 3300014325 Bacteria 5175
98 Ga0157380_10020284 3300014326 Bacteria 4967
99 Ga0157377_10000013 3300014745 Bacteria 267125
100 Ga0157377_10023609 3300014745 Bacteria 3262
101 Ga0157379_10172392 3300014968 Bacteria 1953
102 Ga0183365_10004 3300015684 Bacteria 333304
103 Ga0206356_11195712 3300020070 Bacteria 2350
104 Ga0213872_10000281 3300021361 Bacteria 43441
105 Ga0213875_10000307 3300021388 Bacteria 46789
106 Ga0224712_10050498 3300022467 Bacteria 1616
107 Ga0209674_100003 3300025226 Bacteria 2196646
108 Ga0209563_100049 3300025230 Bacteria 358472
109 Ga0207427_100280 3300025231 Bacteria 37213
110 Ga0209258_100163 3300025242 Bacteria 149677
111 Ga0209258_101256 3300025242 Bacteria 9694
112 Ga0209646_1000138 3300025246 Bacteria 114892
113 Ga0209026_1000021 3300025250 Bacteria 375165
114 Ga0209677_100145 3300025253 Bacteria 65577
115 Ga0209677_100209 3300025253 Bacteria 45370
116 Ga0209759_1000025 3300025256 Bacteria 317082
117 Ga0209759_1006806 3300025256 Bacteria 3784
118 Ga0209455_1000059 3300025272 Bacteria 339995
119 Ga0209455_1000236 3300025272 Bacteria 69542
120 Ga0209051_1008721 3300025303 Bacteria 5331
121 Ga0209051_1011267 3300025303 Bacteria 4431
122 Ga0207713_1013257 3300025735 Bacteria 4355
123 Ga0207710_10038283 3300025900 Bacteria 2120
124 Ga0207688_10009631 3300025901 Bacteria 5261
125 Ga0207688_10016789 3300025901 Bacteria 3974
126 Ga0207643_10022158 3300025908 Bacteria 3496
127 Ga0207654_10025522 3300025911 Bacteria 3188
128 Ga0207707_10011821 3300025912 Bacteria 7590
129 Ga0207695_10045005 3300025913 Bacteria 4689
130 Ga0207695_10109119 3300025913 Bacteria 2750
131 Ga0207693_10110331 3300025915 Bacteria 2157
132 Ga0207652_10001925 3300025921 Bacteria 17959
133 Ga0207652_10019237 3300025921 Bacteria 5613
134 Ga0207694_10023291 3300025924 Bacteria 4701
135 Ga0207687_10075728 3300025927 Bacteria 2416
136 Ga0207644_10022252 3300025931 Bacteria 4330
137 Ga0207706_10018983 3300025933 Bacteria 6183
138 Ga0207709_10001424 3300025935 Bacteria 16752
139 Ga0207670_10053562 3300025936 Bacteria 2719
140 Ga0207704_10102438 3300025938 Bacteria 1912
141 Ga0207711_10021776 3300025941 Bacteria 5353
142 Ga0207661_10000167 3300025944 Bacteria 42604
143 Ga0207661_10019894 3300025944 Bacteria 5010
144 Ga0207679_10024554 3300025945 Bacteria 4134
145 Ga0207667_10001539 3300025949 Bacteria 29007
146 Ga0207667_10006747 3300025949 Bacteria 13858
147 Ga0207651_10015661 3300025960 Bacteria 4415
148 Ga0207668_10035288 3300025972 Bacteria 3328
149 Ga0207639_10050402 3300026041 Bacteria 3161
150 Ga0207708_10039201 3300026075 Bacteria 3609
151 Ga0207708_10105514 3300026075 Bacteria 2184
152 Ga0207702_10000800 3300026078 Bacteria 33369
153 Ga0207641_10078776 3300026088 Bacteria 2855
154 Ga0207648_10000006 3300026089 Bacteria 223855
155 Ga0207676_10034870 3300026095 Bacteria 3812
156 Ga0207676_10040046 3300026095 Bacteria 3589
157 Ga0207676_10083016 3300026095 Bacteria 2608
158 Ga0207676_10101208 3300026095 Bacteria 2389
159 Ga0207674_10082754 3300026116 Bacteria 3210
160 Ga0207674_10186257 3300026116 Bacteria 2026
161 Ga0207675_100006373 3300026118 Bacteria 11188
162 Ga0207675_100058479 3300026118 Bacteria 3597
163 Ga0207683_10172695 3300026121 Bacteria 1958
164 Ga0209371_1013915 3300027312 Bacteria 2231
165 Ga0209983_1000536 3300027665 Bacteria 8182
166 Ga0209971_1001727 3300027682 Bacteria 5361
167 Ga0209998_10001326 3300027717 Bacteria 6019
168 Ga0209974_10002814 3300027876 Bacteria 6313
169 Ga0207428_10000078 3300027907 Bacteria 136571
170 Ga0207428_10000327 3300027907 Bacteria 61752
171 Ga0268266_10176518 3300028379 Bacteria 1942
172 Ga0268265_10092081 3300028380 Bacteria 2426
173 Ga0265319_1008999 3300028563 Bacteria 4309
174 Ga0265334_10001228 3300028573 Bacteria 12519
175 Ga0265336_10000006 3300028666 Bacteria 348453
176 Ga0307515_10000521 3300028794 Bacteria 91558
177 Ga0307515_10001063 3300028794 Bacteria 62886
178 Ga0307515_10009637 3300028794 Bacteria 18637
179 Ga0307515_10024488 3300028794 Bacteria 10515
180 Ga0265338_10047377 3300028800 Bacteria 3926
181 Ga0268256_1016054 3300030500 Bacteria 2160
182 Ga0307512_10033814 3300030522 Bacteria 4388
183 Ga0265339_10035440 3300031249 Bacteria 2800
184 Ga0265331_10002866 3300031250 Bacteria 11408
185 Ga0307509_10000120 3300031507 Bacteria 114238
186 Ga0307408_100000746 3300031548 Bacteria 26310
187 Ga0265313_10000298 3300031595 Bacteria 53738
188 Ga0265313_10000363 3300031595 Bacteria 49234
189 Ga0265313_10046449 3300031595 Bacteria 2108
190 Ga0307516_10000058 3300031730 Bacteria 121424
191 Ga0307516_10000878 3300031730 Bacteria 41335
192 Ga0307516_10002271 3300031730 Bacteria 25921
193 Ga0307412_10039900 3300031911 Bacteria 3034
194 Ga0307416_100313335 3300032002 Bacteria 1567
195 Ga0307414_10113554 3300032004 Bacteria 2068
196 Ga0307415_100108274 3300032126 Bacteria 2056
197 Ga0307510_10017786 3300033180 Bacteria 8375
198 Ga0307510_10039883 3300033180 Bacteria 5164
199 Ga0373943_0049645 3300035170 Bacteria 2060
200 Ga0373931_0001162 3300035691 Bacteria 11193
201 Ga0373937_0058965 3300036401 Bacteria 3527
202 Ga0395905_0001560 3300037471 Bacteria 27402
203 Ga0395905_0051786 3300037471 Bacteria 3845
204 Ga0436364_0822555 3300037853 Bacteria 215682
205 Ga0436361_0215147 3300039447 Bacteria 6736
206 Ga0436363_0690398 3300039450 Bacteria 2412
207 Ga0450920_006849 3300042122 Bacteria 2055
208 Ga0451577_0001772 3300042876 Bacteria 27758
209 Ga0466969_0013872 3300044656 Bacteria 4241
210 Ga0466965_0001550 3300044683 Bacteria 9349
211 Ga0466965_0017701 3300044683 Bacteria 3409
212 Ga0466966_0026592 3300044684 Bacteria 3778
213 Ga0466961_0019474 3300044693 Bacteria 4365
214 Ga0453684_0012554 3300044712 Bacteria 13945
215 Ga0453684_0097396 3300044712 Bacteria 3610
216 Ga0466971_0013794 3300044719 Bacteria 3552
217 Ga0466959_0033228 3300045049 Bacteria 3816
218 Ga0451576_0023113 3300045051 Bacteria 6736
219 Ga0466958_0049134 3300045836 Bacteria 2551
220 Ga0466967_0186754 3300045976 Bacteria 1957
221 Ga0495592_0000222 3300046454 Bacteria 48902
222 Ga0495650_0012179 3300046471 Bacteria 4644
223 Ga0495650_0019253 3300046471 Bacteria 3368
224 Ga0495585_0027056 3300046492 Bacteria 3274
225 Ga0495583_0000720 3300046506 Bacteria 42366
226 Ga0495583_0000927 3300046506 Bacteria 34448
227 Ga0495606_0003050 3300046507 Bacteria 18259
228 Ga0495610_0016777 3300046512 Bacteria 4202
229 Ga0495632_0000037 3300046519 Bacteria 158699
230 Ga0495632_0058045 3300046519 Bacteria 1887
231 Ga0495637_0003031 3300046520 Bacteria 8984
232 Ga0495656_0042688 3300046615 Bacteria 1900
233 Ga0495625_0003641 3300046660 Bacteria 15113
234 Ga0495625_0037622 3300046660 Bacteria 3548
235 Ga0495661_0000057 3300046665 Bacteria 135044
236 Ga0495649_0000464 3300046694 Bacteria 34868
237 Ga0495589_0074785 3300046794 Bacteria 1652
238 Ga0496101_0092358 3300048904 Bacteria 2253
239 Ga0496102_0008741 3300048905 Bacteria 8691
240 Ga0496102_0045707 3300048905 Bacteria 3976
241 Ga0496104_0079022 3300048907 Bacteria 3135
242 Ga0496104_0227028 3300048907 Bacteria 1779
243 Ga0496105_0131441 3300048908 Bacteria 2064
244 Ga0496106_0001526 3300048909 Bacteria 17402
245 Ga0496107_0031683 3300048910 Bacteria 3775
246 Ga0496108_0007021 3300048911 Bacteria 9119
247 Ga0496108_0027394 3300048911 Bacteria 4705
248 Ga0496109_0001184 3300048912 Bacteria 21648
249 Ga0496109_0008149 3300048912 Bacteria 8887
250 Ga0496109_0009835 3300048912 Bacteria 8162
251 Ga0496110_0000295 3300048913 Bacteria 32671
252 Ga0496110_0028059 3300048913 Bacteria 4831
253 Ga0496110_0266500 3300048913 Bacteria 1559
254 Ga0496111_0000688 3300048914 Bacteria 17832
255 Ga0496112_0054850 3300048915 Bacteria 3917
256 Ga0496112_0110096 3300048915 Bacteria 2724
257 Ga0496112_0152564 3300048915 Bacteria 2278
258 Ga0496112_0214363 3300048915 Bacteria 1882
259 Ga0496113_0070146 3300048916 Bacteria 2663
260 Ga0496114_0001838 3300048917 Bacteria 16072
261 Ga0496115_0097989 3300048918 Bacteria 2401
262 Ga0496124_0000919 3300048927 Bacteria 47561
263 Ga0496125_0004646 3300048928 Bacteria 15675
264 Ga0496126_0017893 3300048929 Bacteria 7051
265 Ga0501034_0084680 3300049571 Bacteria 3172
266 Ga0501039_0152494 3300049575 Bacteria 1815
267 Ga0501040_0006862 3300049576 Bacteria 7379
268 Ga0501040_0011091 3300049576 Bacteria 5892
269 Ga0501041_0053927 3300049577 Bacteria 2453
270 Ga0501042_0101417 3300049578 Bacteria 2070
271 Ga0501043_0073786 3300049579 Bacteria 2680
272 Ga0501048_0100360 3300049582 Bacteria 2042
273 Ga0501071_0007134 3300049587 Bacteria 7306
274 Ga0501071_0054120 3300049587 Bacteria 2896
275 Ga0501072_0031361 3300049588 Bacteria 4160
276 Ga0501075_0033006 3300049591 Bacteria 3850
277 Ga0501075_0066067 3300049591 Bacteria 2729
278 Ga0501075_0176032 3300049591 Bacteria 1632
279 Ga0501076_0014893 3300049592 Bacteria 5869
280 Ga0501076_0089752 3300049592 Bacteria 2471
281 Ga0501077_0013389 3300049593 Bacteria 5144
282 Ga0501079_0058000 3300049741 Bacteria 2987
283 Ga0501079_0125526 3300049741 Bacteria 1997
284 Ga0501080_0077771 3300049742 Bacteria 3086
285 Ga0501081_0033225 3300049743 Bacteria 3504
286 Ga0501081_0064902 3300049743 Bacteria 2536
287 Ga0501081_0093857 3300049743 Bacteria 2113
288 Ga0501035_0012559 3300049822 Bacteria 7825
289 Ga0501045_0065458 3300049824 Bacteria 2668
290 nmdc:mga00v17_6856_c1 3300050491 Bacteria 6054
291 nmdc:mga0yw44_16686_c1 3300050492 Bacteria 3975
292 nmdc:mga0k408_30964_c1 3300050493 Bacteria 3052
293 nmdc:mga07m45_3171_c1 3300050496 Bacteria 7890
294 nmdc:mga09592_78218_c1 3300050508 Bacteria 2815
295 nmdc:mga0qj67_57704_c1 3300050509 Bacteria 3078
296 nmdc:mga08y16_47694_c1 3300050511 Bacteria 4484
297 nmdc:mga08y16_66_c1 3300050511 Bacteria 87732
298 nmdc:mga08y16_76268_c1 3300050511 Bacteria 3494
299 nmdc:mga08x19_87532_c1 3300050514 Bacteria 2052
300 Ga0500635_0000017 3300053080 Bacteria 113720
301 Ga0500635_0000371 3300053080 Bacteria 14185
302 Ga0500635_0020021 3300053080 Bacteria 2043
303 Ga0500578_0001673 3300053086 Bacteria 21300
304 Ga0500644_0002308 3300053088 Bacteria 4801
305 Ga0500651_0039544 3300053093 Bacteria 2970
306 Ga0500593_000161 3300053117 Bacteria 26877
307 Ga0500608_017213 3300053122 Bacteria 3280
308 Ga0500652_010112 3300053131 Bacteria 3219
309 Ga0500658_0009664 3300053134 Bacteria 3558
310 Ga0500559_0000011 3300053136 Bacteria 164751
311 Ga0500568_0025187 3300053139 Bacteria 2513
312 Ga0500619_000022 3300053154 Bacteria 50600
313 Ga0500622_0017473 3300053156 Bacteria 3816
314 Ga0500636_0011907 3300053177 Bacteria 5095
315 Ga0500637_0000650 3300053178 Bacteria 13798
316 Ga0500645_003010 3300053730 Bacteria 7136
317 Ga0501084_0035625 3300054114 Bacteria 4161
318 Ga0501084_0049425 3300054114 Bacteria 3521
319 Ga0501084_0075532 3300054114 Bacteria 2823
320 Ga0590071_005243 3300059421 Bacteria 3123
321 Ga0501082_0016633 3300060353 Bacteria 6331
322 Ga0466962_0011668 3300061719 Bacteria 4231

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053080 Ga0500635_0020021 Ga0500635_0020021_33_1253 404
2 3300039450 Ga0436363_0690398 Ga0436363_0690398_764_2089 433
3 3300013307 Ga0157372_10084530 Ga0157372_100845303 455
4 3300025735 Ga0207713_1013257 Ga0207713_10132574 455
5 3300027312 Ga0209371_1013915 Ga0209371_10139152 455
6 3300030500 Ga0268256_1016054 Ga0268256_10160541 455
7 3300009011 Ga0105251_10000388 Ga0105251_100003882 456
8 3300005844 Ga0068862_100128598 Ga0068862_1001285982 459
9 3300028380 Ga0268265_10092081 Ga0268265_100920813 459
10 3300021388 Ga0213875_10000307 Ga0213875_1000030735 460
11 3300037853 Ga0436364_0822555 Ga0436364_0822555_83884_85365 460
12 3300053178 Ga0500637_0000650 Ga0500637_0000650_2690_4186 460
13 3300044712 Ga0453684_0012554 Ga0453684_0012554_4080_5579 461
14 3300059421 Ga0590071_005243 Ga0590071_005243_1567_3015 467
15 3300014326 Ga0157380_10020284 Ga0157380_100202842 468
16 3300025938 Ga0207704_10102438 Ga0207704_101024382 468
17 3300042122 Ga0450920_006849 Ga0450920_006849_453_1958 468
18 3300048908 Ga0496105_0131441 Ga0496105_0131441_498_1982 468
19 3300050511 nmdc:mga08y16_76268_c1 nmdc:mga08y16_76268_c1_906_2411 468
20 3300032004 Ga0307414_10113554 Ga0307414_101135542 473
21 3300050492 nmdc:mga0yw44_16686_c1 nmdc:mga0yw44_16686_c1_1688_3193 473
22 3300005354 Ga0070675_100108135 Ga0070675_1001081351 475
23 3300006051 Ga0075364_10026056 Ga0075364_100260562 475
24 3300011119 Ga0105246_10106082 Ga0105246_101060822 475
25 3300048909 Ga0496106_0001526 Ga0496106_0001526_11200_12684 475
26 3300048910 Ga0496107_0031683 Ga0496107_0031683_264_1748 475
27 3300005444 Ga0070694_100027338 Ga0070694_1000273385 476
28 3300005549 Ga0070704_100014858 Ga0070704_1000148587 476
29 3300049578 Ga0501042_0101417 Ga0501042_0101417_314_1816 476
30 3300049587 Ga0501071_0054120 Ga0501071_0054120_1125_2627 476
31 3300049591 Ga0501075_0033006 Ga0501075_0033006_2047_3549 476
32 3300049592 Ga0501076_0014893 Ga0501076_0014893_3793_5295 476
33 3300049742 Ga0501080_0077771 Ga0501080_0077771_888_2390 476
34 3300049743 Ga0501081_0033225 Ga0501081_0033225_554_2056 476
35 3300060353 Ga0501082_0016633 Ga0501082_0016633_978_2480 476
36 3300005367 Ga0070667_100114645 Ga0070667_1001146452 477
37 3300049743 Ga0501081_0093857 Ga0501081_0093857_235_1977 477
38 3300054114 Ga0501084_0035625 Ga0501084_0035625_2179_3921 477
39 3300049592 Ga0501076_0089752 Ga0501076_0089752_922_2424 478
40 3300049741 Ga0501079_0125526 Ga0501079_0125526_442_1938 478
41 3300054114 Ga0501084_0075532 Ga0501084_0075532_1137_2639 478
42 3300005331 Ga0070670_100197896 Ga0070670_1001978961 479
43 3300005355 Ga0070671_100055655 Ga0070671_1000556554 479
44 3300005617 Ga0068859_100296217 Ga0068859_1002962172 479
45 3300006931 Ga0097620_100296216 Ga0097620_1002962162 479
46 3300013307 Ga0157372_10099130 Ga0157372_100991303 479
47 3300025931 Ga0207644_10022252 Ga0207644_100222523 479
48 3300026088 Ga0207641_10078776 Ga0207641_100787764 479
49 3300026095 Ga0207676_10083016 Ga0207676_100830161 479
50 3300049577 Ga0501041_0053927 Ga0501041_0053927_650_2152 479
51 3300005337 Ga0070682_100001938 Ga0070682_1000019384 480
52 3300005364 Ga0070673_100069955 Ga0070673_1000699553 480
53 3300005530 Ga0070679_100008627 Ga0070679_1000086278 480
54 3300005535 Ga0070684_100007191 Ga0070684_1000071916 480
55 3300005535 Ga0070684_100017585 Ga0070684_1000175855 480
56 3300005548 Ga0070665_100009675 Ga0070665_1000096754 480
57 3300005549 Ga0070704_100040949 Ga0070704_1000409493 480
58 3300005564 Ga0070664_100013231 Ga0070664_1000132315 480
59 3300005614 Ga0068856_100107929 Ga0068856_1001079294 480
60 3300013105 Ga0157369_10058086 Ga0157369_100580862 480
61 3300013307 Ga0157372_10031220 Ga0157372_100312201 480
62 3300013308 Ga0157375_10174444 Ga0157375_101744442 480
63 3300020070 Ga0206356_11195712 Ga0206356_111957122 480
64 3300022467 Ga0224712_10050498 Ga0224712_100504981 480
65 3300025912 Ga0207707_10011821 Ga0207707_100118218 480
66 3300025921 Ga0207652_10001925 Ga0207652_100019254 480
67 3300025944 Ga0207661_10000167 Ga0207661_1000016713 480
68 3300025945 Ga0207679_10024554 Ga0207679_100245543 480
69 3300026116 Ga0207674_10082754 Ga0207674_100827543 480
70 3300028379 Ga0268266_10176518 Ga0268266_101765182 480
71 3300048911 Ga0496108_0007021 Ga0496108_0007021_7031_8536 480
72 3300048912 Ga0496109_0001184 Ga0496109_0001184_7682_9187 480
73 3300048913 Ga0496110_0000295 Ga0496110_0000295_2619_4124 480
74 3300048914 Ga0496111_0000688 Ga0496111_0000688_10485_11990 480
75 3300048915 Ga0496112_0214363 Ga0496112_0214363_184_1692 480
76 3300006237 Ga0097621_100172351 Ga0097621_1001723512 481
77 iso_pu_bacteria 2791355123 2792751520 482
78 iso_pu_bacteria 2885305155 2885309146 482
79 3300027907 Ga0207428_10000078 Ga0207428_1000007837 483
80 3300046615 Ga0495656_0042688 Ga0495656_0042688_399_1862 483
81 3300050511 nmdc:mga08y16_66_c1 nmdc:mga08y16_66_c1_7736_9235 483
82 3300053156 Ga0500622_0017473 Ga0500622_0017473_2343_3797 483
83 3300009148 Ga0105243_10081244 Ga0105243_100812443 484
84 3300032126 Ga0307415_100108274 Ga0307415_1001082742 484
85 3300045051 Ga0451576_0023113 Ga0451576_0023113_3991_5493 484
86 3300048905 Ga0496102_0045707 Ga0496102_0045707_1846_3330 484
87 3300048912 Ga0496109_0008149 Ga0496109_0008149_130_1614 484
88 3300048913 Ga0496110_0028059 Ga0496110_0028059_1955_3439 484
89 3300048917 Ga0496114_0001838 Ga0496114_0001838_6123_7607 484
90 3300005841 Ga0068863_100071798 Ga0068863_1000717983 485
91 3300002705 JGI25156J39149_1009392 JGI25156J39149_10093922 487
92 3300032002 Ga0307416_100313335 Ga0307416_1003133351 488
93 3300025921 Ga0207652_10019237 Ga0207652_100192374 489
94 3300048918 Ga0496115_0097989 Ga0496115_0097989_433_1905 489
95 3300035170 Ga0373943_0049645 Ga0373943_0049645_267_1775 490
96 3300048907 Ga0496104_0079022 Ga0496104_0079022_941_2428 490
97 3300048915 Ga0496112_0054850 Ga0496112_0054850_2389_3876 490
98 3300048915 Ga0496112_0152564 Ga0496112_0152564_675_2165 490
99 iso_pu_bacteria 2856314179 2856320155 491
100 iso_pu_bacteria 2856320880 2856321669 491
101 iso_pu_bacteria 2856364286 2856371647 491
102 iso_pu_bacteria 2857349434 2857357413 491
103 iso_pu_bacteria 2869278585 2869284479 491
104 iso_pu_bacteria 2869285874 2869289431 491
105 iso_pu_bacteria 2871429161 2871431498 491
106 iso_pu_bacteria 2871488783 2871491414 491
107 iso_pu_bacteria 2874146452 2874154635 491
108 iso_pu_bacteria 2874155637 2874162020 491
109 iso_pu_bacteria 2876413966 2876420204 491
110 iso_pu_bacteria 2878035449 2878042463 491
111 iso_pu_bacteria 2878745973 2878748103 491
112 iso_pu_bacteria 2878753008 2878759527 491
113 iso_pu_bacteria 2881861095 2881861667 491
114 iso_pu_bacteria 2885342637 2885343660 491
115 iso_pu_bacteria 2885350715 2885357294 491
116 iso_pu_bacteria 2903492973 2903493507 491
117 iso_pu_bacteria 2903492973 2903494521 491
118 iso_pu_bacteria 2906308376 2906311720 491
119 iso_pu_bacteria 2906321335 2906323459 491
120 iso_pu_bacteria 2906414383 2906421066 491
121 iso_pu_bacteria 2924784321 2924786152 491
122 iso_pu_bacteria 2937813078 2937818460 491
123 iso_pu_bacteria 2937877337 2937883725 491
124 iso_pu_bacteria 2958034702 2958038907 491
125 iso_pu_bacteria 2958041894 2958056187 491
126 iso_pu_bacteria 2958084443 2958091003 491
127 iso_pu_bacteria 2958130278 2958133805 491
128 iso_pu_bacteria 2958179912 2958183451 491
129 iso_pu_bacteria 2961077736 2961081416 491
130 iso_pu_bacteria 2961170736 2961171007 491
131 iso_pu_bacteria 2965062239 2965070245 491
132 iso_pu_bacteria 2965119406 2965124771 491
133 iso_pu_bacteria 2968003550 2968010302 491
134 iso_pu_bacteria 2968091066 2968092026 491
135 iso_pu_bacteria 2970503327 2970503601 491
136 iso_pu_bacteria 2970593180 2970599094 491
137 iso_pu_bacteria 2977821940 2977828050 491
138 iso_pu_bacteria 2977843712 2977850789 491
139 iso_pu_bacteria 2977942078 2977949246 491
140 iso_pu_bacteria 2979808191 2979808237 491
141 iso_pu_bacteria 2987636660 2987644802 491
142 iso_pu_bacteria 3000135777 3000136929 491
143 iso_pu_bacteria 3004203850 3004211050 491
144 iso_pu_bacteria 8004374579 8004381030 491
145 iso_pu_bacteria 8004387939 8004391309 491
146 iso_pu_bacteria 8004714634 8004716679 491
147 3300013297 Ga0157378_10066494 Ga0157378_100664942 492
148 3300045976 Ga0466967_0186754 Ga0466967_0186754_399_1880 492
149 3300053139 Ga0500568_0025187 Ga0500568_0025187_14_1495 492
150 iso_pu_bacteria 2510065055 2510294634 492
151 iso_pu_bacteria 2510065058 2510311226 492
152 iso_pu_bacteria 2545555834 2545676602 492
153 iso_pu_bacteria 2585428062 2587755057 492
154 iso_pu_bacteria 2773857672 2774129462 492
155 iso_pu_bacteria 2974298342 2974302131 492
156 iso_pu_bacteria 2984499530 2984500297 492
157 iso_pu_bacteria 641522639 641644024 492
158 3300028794 Ga0307515_10000521 Ga0307515_1000052136 493
159 iso_pu_bacteria 2510917026 2511173516 493
160 iso_pu_bacteria 2643221660 2644337810 493
161 iso_pu_bacteria 2883354860 2883357438 493
162 3300005618 Ga0068864_100001062 Ga0068864_10000106211 494
163 3300005841 Ga0068863_100001777 Ga0068863_1000017772 494
164 3300014325 Ga0163163_10030780 Ga0163163_100307804 494
165 3300026095 Ga0207676_10034870 Ga0207676_100348703 494
166 3300028573 Ga0265334_10001228 Ga0265334_1000122811 494
167 3300028794 Ga0307515_10001063 Ga0307515_1000106346 494
168 3300028794 Ga0307515_10024488 Ga0307515_100244888 494
169 3300028800 Ga0265338_10047377 Ga0265338_100473773 494
170 3300030522 Ga0307512_10033814 Ga0307512_100338142 494
171 3300031595 Ga0265313_10046449 Ga0265313_100464493 494
172 3300031730 Ga0307516_10000058 Ga0307516_1000005886 494
173 3300031730 Ga0307516_10000878 Ga0307516_100008788 494
174 3300042876 Ga0451577_0001772 Ga0451577_0001772_13891_15378 494
175 3300044683 Ga0466965_0017701 Ga0466965_0017701_270_1757 494
176 3300044712 Ga0453684_0097396 Ga0453684_0097396_583_2079 494
177 3300048927 Ga0496124_0000919 Ga0496124_0000919_23441_24928 494
178 3300048928 Ga0496125_0004646 Ga0496125_0004646_3459_4946 494
179 iso_pu_bacteria 2883291878 2883294922 494
180 iso_pu_bacteria 2883354860 2883356592 494
181 3300003761 Ga0055535_1000121 Ga0055535_10001214 495
182 3300003761 Ga0055535_1000607 Ga0055535_100060714 495
183 3300003761 Ga0055535_1000906 Ga0055535_10009064 495
184 3300003763 Ga0055529_1000731 Ga0055529_100073115 495
185 3300005459 Ga0068867_100000307 Ga0068867_10000030716 495
186 3300009148 Ga0105243_10000952 Ga0105243_100009529 495
187 3300009545 Ga0105237_10025522 Ga0105237_100255224 495
188 3300014745 Ga0157377_10000013 Ga0157377_1000001351 495
189 3300025242 Ga0209258_100163 Ga0209258_10016315 495
190 3300025272 Ga0209455_1000059 Ga0209455_1000059279 495
191 3300025935 Ga0207709_10001424 Ga0207709_100014248 495
192 3300026089 Ga0207648_10000006 Ga0207648_10000006201 495
193 3300031507 Ga0307509_10000120 Ga0307509_1000012040 495
194 3300031730 Ga0307516_10002271 Ga0307516_1000227122 495
195 3300033180 Ga0307510_10017786 Ga0307510_100177865 495
196 3300033180 Ga0307510_10039883 Ga0307510_100398833 495
197 3300037471 Ga0395905_0001560 Ga0395905_0001560_18417_19916 495
198 3300037471 Ga0395905_0051786 Ga0395905_0051786_1534_3024 495
199 3300046454 Ga0495592_0000222 Ga0495592_0000222_16542_18032 495
200 3300046471 Ga0495650_0012179 Ga0495650_0012179_655_2151 495
201 3300046506 Ga0495583_0000927 Ga0495583_0000927_17034_18530 495
202 3300046507 Ga0495606_0003050 Ga0495606_0003050_16_1512 495
203 3300046660 Ga0495625_0037622 Ga0495625_0037622_1881_3377 495
204 3300046694 Ga0495649_0000464 Ga0495649_0000464_17459_18955 495
205 3300046794 Ga0495589_0074785 Ga0495589_0074785_79_1575 495
206 3300053080 Ga0500635_0000017 Ga0500635_0000017_99955_101451 495
207 3300053086 Ga0500578_0001673 Ga0500578_0001673_14015_15505 495
208 3300053088 Ga0500644_0002308 Ga0500644_0002308_118_1608 495
209 3300053093 Ga0500651_0039544 Ga0500651_0039544_1405_2895 495
210 3300053131 Ga0500652_010112 Ga0500652_010112_1151_2644 495
211 3300053136 Ga0500559_0000011 Ga0500559_0000011_24286_25776 495
212 3300053154 Ga0500619_000022 Ga0500619_000022_25930_27420 495
213 3300053177 Ga0500636_0011907 Ga0500636_0011907_1809_3302 495
214 3300053730 Ga0500645_003010 Ga0500645_003010_2436_3926 495
215 3300002705 JGI25156J39149_1000278 JGI25156J39149_100027820 496
216 3300002738 JGI25154J39366_1000221 JGI25154J39366_10002213 496
217 3300002741 JGI25157J39369_1000049 JGI25157J39369_100004939 496
218 3300003323 rootH1_10001783 rootH1_100017833 496
219 3300003756 Ga0055533_1000010 Ga0055533_1000010205 496
220 3300003759 Ga0055525_1000775 Ga0055525_10007758 496
221 3300005330 Ga0070690_100007072 Ga0070690_1000070723 496
222 3300005535 Ga0070684_100084235 Ga0070684_1000842351 496
223 3300005577 Ga0068857_100000924 Ga0068857_10000092421 496
224 3300005614 Ga0068856_100001783 Ga0068856_1000017833 496
225 3300006353 Ga0075370_10012686 Ga0075370_100126862 496
226 3300013105 Ga0157369_10068089 Ga0157369_100680892 496
227 3300013297 Ga0157378_10046293 Ga0157378_100462932 496
228 3300021361 Ga0213872_10000281 Ga0213872_100002818 496
229 3300025226 Ga0209674_100003 Ga0209674_1000031541 496
230 3300025230 Ga0209563_100049 Ga0209563_1000493 496
231 3300025231 Ga0207427_100280 Ga0207427_10028015 496
232 3300025242 Ga0209258_101256 Ga0209258_1012562 496
233 3300025246 Ga0209646_1000138 Ga0209646_100013870 496
234 3300025250 Ga0209026_1000021 Ga0209026_1000021229 496
235 3300025253 Ga0209677_100145 Ga0209677_10014518 496
236 3300025253 Ga0209677_100209 Ga0209677_10020921 496
237 3300025256 Ga0209759_1000025 Ga0209759_1000025229 496
238 3300025303 Ga0209051_1011267 Ga0209051_10112672 496
239 3300025911 Ga0207654_10025522 Ga0207654_100255221 496
240 3300025924 Ga0207694_10023291 Ga0207694_100232911 496
241 3300025949 Ga0207667_10001539 Ga0207667_1000153924 496
242 3300026078 Ga0207702_10000800 Ga0207702_1000080010 496
243 3300026095 Ga0207676_10101208 Ga0207676_101012082 496
244 3300026121 Ga0207683_10172695 Ga0207683_101726951 496
245 3300028666 Ga0265336_10000006 Ga0265336_1000000632 496
246 3300048905 Ga0496102_0008741 Ga0496102_0008741_4482_5975 496
247 3300050493 nmdc:mga0k408_30964_c1 nmdc:mga0k408_30964_c1_907_2406 496
248 3300050496 nmdc:mga07m45_3171_c1 nmdc:mga07m45_3171_c1_6161_7657 496
249 3300005549 Ga0070704_100009578 Ga0070704_1000095785 497
250 3300006051 Ga0075364_10017542 Ga0075364_100175423 497
251 3300015684 Ga0183365_10004 Ga0183365_10004168 497
252 3300025272 Ga0209455_1000236 Ga0209455_100023662 497
253 3300025303 Ga0209051_1008721 Ga0209051_10087212 497
254 3300025913 Ga0207695_10109119 Ga0207695_101091192 497
255 3300028794 Ga0307515_10009637 Ga0307515_100096372 497
256 3300031249 Ga0265339_10035440 Ga0265339_100354402 497
257 3300031250 Ga0265331_10002866 Ga0265331_100028663 497
258 3300031595 Ga0265313_10000363 Ga0265313_1000036342 497
259 3300035691 Ga0373931_0001162 Ga0373931_0001162_2546_4048 497
260 3300036401 Ga0373937_0058965 Ga0373937_0058965_1843_3342 497
261 3300046471 Ga0495650_0019253 Ga0495650_0019253_1790_3283 497
262 3300046506 Ga0495583_0000720 Ga0495583_0000720_24165_25658 497
263 3300046512 Ga0495610_0016777 Ga0495610_0016777_2133_3629 497
264 3300046519 Ga0495632_0000037 Ga0495632_0000037_59935_61428 497
265 3300046519 Ga0495632_0058045 Ga0495632_0058045_332_1828 497
266 3300046520 Ga0495637_0003031 Ga0495637_0003031_1433_2926 497
267 3300046660 Ga0495625_0003641 Ga0495625_0003641_5944_7452 497
268 3300046665 Ga0495661_0000057 Ga0495661_0000057_34213_35706 497
269 3300048929 Ga0496126_0017893 Ga0496126_0017893_2137_3657 497
270 3300049571 Ga0501034_0084680 Ga0501034_0084680_1288_2805 497
271 3300049576 Ga0501040_0011091 Ga0501040_0011091_1541_3040 497
272 3300049588 Ga0501072_0031361 Ga0501072_0031361_71_1570 497
273 3300049591 Ga0501075_0176032 Ga0501075_0176032_101_1600 497
274 3300050491 nmdc:mga00v17_6856_c1 nmdc:mga00v17_6856_c1_1071_2573 497
275 3300053080 Ga0500635_0000371 Ga0500635_0000371_4454_5971 497
276 3300053117 Ga0500593_000161 Ga0500593_000161_10870_12366 497
277 3300053122 Ga0500608_017213 Ga0500608_017213_1531_3048 497
278 3300053134 Ga0500658_0009664 Ga0500658_0009664_1028_2524 497
279 3300054114 Ga0501084_0049425 Ga0501084_0049425_976_2475 497
280 3300001989 JGI24739J22299_10002951 JGI24739J22299_100029515 498
281 3300001990 JGI24737J22298_10002397 JGI24737J22298_100023977 498
282 3300002075 JGI24738J21930_10002698 JGI24738J21930_100026984 498
283 3300005329 Ga0070683_100045679 Ga0070683_1000456793 498
284 3300005336 Ga0070680_100038164 Ga0070680_1000381642 498
285 3300005353 Ga0070669_100026007 Ga0070669_1000260073 498
286 3300005355 Ga0070671_100012296 Ga0070671_1000122962 498
287 3300005364 Ga0070673_100006387 Ga0070673_1000063875 498
288 3300005365 Ga0070688_100009912 Ga0070688_1000099124 498
289 3300005366 Ga0070659_100006834 Ga0070659_1000068342 498
290 3300005438 Ga0070701_10038729 Ga0070701_100387292 498
291 3300005439 Ga0070711_100066328 Ga0070711_1000663282 498
292 3300005439 Ga0070711_100192417 Ga0070711_1001924171 498
293 3300005441 Ga0070700_100062726 Ga0070700_1000627262 498
294 3300005457 Ga0070662_100003829 Ga0070662_1000038292 498
295 3300005457 Ga0070662_100122781 Ga0070662_1001227812 498
296 3300005467 Ga0070706_100053307 Ga0070706_1000533072 498
297 3300005471 Ga0070698_100069358 Ga0070698_1000693582 498
298 3300005535 Ga0070684_100008152 Ga0070684_1000081525 498
299 3300005539 Ga0068853_100088761 Ga0068853_1000887612 498
300 3300005563 Ga0068855_100094963 Ga0068855_1000949632 498
301 3300005577 Ga0068857_100215005 Ga0068857_1002150052 498
302 3300005615 Ga0070702_100060301 Ga0070702_1000603012 498
303 3300005615 Ga0070702_100076004 Ga0070702_1000760042 498
304 3300005616 Ga0068852_100032437 Ga0068852_1000324374 498
305 3300005719 Ga0068861_100074236 Ga0068861_1000742362 498
306 3300005840 Ga0068870_10016243 Ga0068870_100162432 498
307 3300005844 Ga0068862_100016448 Ga0068862_1000164481 498
308 3300006058 Ga0075432_10007387 Ga0075432_100073873 498
309 3300006175 Ga0070712_100106974 Ga0070712_1001069742 498
310 3300006844 Ga0075428_100002047 Ga0075428_1000020475 498
311 3300006880 Ga0075429_100054299 Ga0075429_1000542993 498
312 3300009093 Ga0105240_10169055 Ga0105240_101690552 498
313 3300009094 Ga0111539_10201901 Ga0111539_102019011 498
314 3300009098 Ga0105245_10001062 Ga0105245_100010625 498
315 3300009147 Ga0114129_10005183 Ga0114129_100051834 498
316 3300009177 Ga0105248_10012707 Ga0105248_100127074 498
317 3300009551 Ga0105238_10016259 Ga0105238_100162595 498
318 3300010375 Ga0105239_10011156 Ga0105239_100111562 498
319 3300013104 Ga0157370_10003213 Ga0157370_100032138 498
320 3300013105 Ga0157369_10003807 Ga0157369_1000380711 498
321 3300014745 Ga0157377_10023609 Ga0157377_100236092 498
322 3300014968 Ga0157379_10172392 Ga0157379_101723922 498
323 3300025256 Ga0209759_1006806 Ga0209759_10068062 498
324 3300025900 Ga0207710_10038283 Ga0207710_100382831 498
325 3300025901 Ga0207688_10009631 Ga0207688_100096314 498
326 3300025901 Ga0207688_10016789 Ga0207688_100167894 498
327 3300025908 Ga0207643_10022158 Ga0207643_100221582 498
328 3300025913 Ga0207695_10045005 Ga0207695_100450053 498
329 3300025915 Ga0207693_10110331 Ga0207693_101103312 498
330 3300025927 Ga0207687_10075728 Ga0207687_100757282 498
331 3300025933 Ga0207706_10018983 Ga0207706_100189832 498
332 3300025936 Ga0207670_10053562 Ga0207670_100535622 498
333 3300025941 Ga0207711_10021776 Ga0207711_100217763 498
334 3300025944 Ga0207661_10019894 Ga0207661_100198944 498
335 3300025949 Ga0207667_10006747 Ga0207667_100067474 498
336 3300025960 Ga0207651_10015661 Ga0207651_100156612 498
337 3300025972 Ga0207668_10035288 Ga0207668_100352883 498
338 3300026041 Ga0207639_10050402 Ga0207639_100504024 498
339 3300026075 Ga0207708_10039201 Ga0207708_100392012 498
340 3300026075 Ga0207708_10105514 Ga0207708_101055142 498
341 3300026095 Ga0207676_10040046 Ga0207676_100400461 498
342 3300026116 Ga0207674_10186257 Ga0207674_101862571 498
343 3300026118 Ga0207675_100006373 Ga0207675_1000063737 498
344 3300026118 Ga0207675_100058479 Ga0207675_1000584792 498
345 3300027665 Ga0209983_1000536 Ga0209983_10005365 498
346 3300027682 Ga0209971_1001727 Ga0209971_10017273 498
347 3300027717 Ga0209998_10001326 Ga0209998_100013262 498
348 3300027876 Ga0209974_10002814 Ga0209974_100028141 498
349 3300027907 Ga0207428_10000327 Ga0207428_1000032771 498
350 3300028563 Ga0265319_1008999 Ga0265319_10089992 498
351 3300031548 Ga0307408_100000746 Ga0307408_10000074612 498
352 3300031595 Ga0265313_10000298 Ga0265313_1000029829 498
353 3300031911 Ga0307412_10039900 Ga0307412_100399002 498
354 3300039447 Ga0436361_0215147 Ga0436361_0215147_5208_6722 498
355 3300044656 Ga0466969_0013872 Ga0466969_0013872_103_1614 498
356 3300044683 Ga0466965_0001550 Ga0466965_0001550_91_1602 498
357 3300044684 Ga0466966_0026592 Ga0466966_0026592_250_1761 498
358 3300044693 Ga0466961_0019474 Ga0466961_0019474_34_1545 498
359 3300044719 Ga0466971_0013794 Ga0466971_0013794_1118_2629 498
360 3300045049 Ga0466959_0033228 Ga0466959_0033228_393_1904 498
361 3300045836 Ga0466958_0049134 Ga0466958_0049134_110_1621 498
362 3300046492 Ga0495585_0027056 Ga0495585_0027056_1728_3236 498
363 3300048904 Ga0496101_0092358 Ga0496101_0092358_80_1582 498
364 3300048907 Ga0496104_0227028 Ga0496104_0227028_250_1752 498
365 3300048911 Ga0496108_0027394 Ga0496108_0027394_310_1812 498
366 3300048912 Ga0496109_0009835 Ga0496109_0009835_5884_7386 498
367 3300048913 Ga0496110_0266500 Ga0496110_0266500_30_1532 498
368 3300048915 Ga0496112_0110096 Ga0496112_0110096_434_1936 498
369 3300048916 Ga0496113_0070146 Ga0496113_0070146_1103_2611 498
370 3300049575 Ga0501039_0152494 Ga0501039_0152494_142_1647 498
371 3300049576 Ga0501040_0006862 Ga0501040_0006862_743_2248 498
372 3300049579 Ga0501043_0073786 Ga0501043_0073786_79_1593 498
373 3300049582 Ga0501048_0100360 Ga0501048_0100360_523_2028 498
374 3300049587 Ga0501071_0007134 Ga0501071_0007134_1642_3147 498
375 3300049591 Ga0501075_0066067 Ga0501075_0066067_298_1803 498
376 3300049593 Ga0501077_0013389 Ga0501077_0013389_36_1541 498
377 3300049741 Ga0501079_0058000 Ga0501079_0058000_141_1646 498
378 3300049743 Ga0501081_0064902 Ga0501081_0064902_256_1761 498
379 3300049822 Ga0501035_0012559 Ga0501035_0012559_2454_3968 498
380 3300049824 Ga0501045_0065458 Ga0501045_0065458_1094_2599 498
381 3300050508 nmdc:mga09592_78218_c1 nmdc:mga09592_78218_c1_256_1758 498
382 3300050509 nmdc:mga0qj67_57704_c1 nmdc:mga0qj67_57704_c1_109_1611 498
383 3300050511 nmdc:mga08y16_47694_c1 nmdc:mga08y16_47694_c1_2667_4172 498
384 3300050514 nmdc:mga08x19_87532_c1 nmdc:mga08x19_87532_c1_158_1660 498
385 3300061719 Ga0466962_0011668 Ga0466962_0011668_2375_3886 498

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

97

542

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b4r-assembly1.cif.gz_D the crystal structure of the aldehyde dehydrogenase kaub from pseudomonas aeruginosa 0.9932 9 496
5iuv-assembly1.cif.gz_A crystal structure of indole-3-acetaldehyde dehydrogenase in complexed with nad+ 0.9931 9 496
7jso-assembly1.cif.gz_A p. syringae alda indole-3-acetaldehyde dehydrogenase c302a mutant in complex with nad+ and iaa 0.993 9 496
7uyy-assembly1.cif.gz_A the crystal structure of the pseudomonas aeruginosa aldehyde dehydrogenase encoded by the pa4189 gene in complex with nadh 0.988 9 497
7mjc-assembly1.cif.gz_B crystal structure analysis of aldh1b1 0.987 19 497
ID Description Score Start End Superfamily
4lihA01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9928 9 269 3.40.605.10
af_A0A0G2KZR6_2_316_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9911 175 490 3.40.605.10
af_P23883_36_487_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9911 36 490 3.30.420.40
af_P23883_36_487_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9889 36 490 3.30.420.40
af_A0A1D6LSK8_32_301_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9882 19 271 3.40.605.10
ID Description Score Start End GO Terms
AF-A0A7K2YNS7-F1-model_v4 Aldehyde dehydrogenase family protein 0.9971 156 494 GO:0016620
AF-A0A502NGL9-F1-model_v4 deleted 0.996 9 498
AF-X1PM67-F1-model_v4 Aldehyde dehydrogenase domain-containing protein 0.9948 51 296 GO:0016491
AF-A0A2Z5V886-F1-model_v4 Aldehyde dehydrogenase 1 family, member A2 0.9932 157 481 GO:0005737
GO:0006629
GO:0016620
AF-A0A5R8QMT2-F1-model_v4 deleted 0.9927 204 494

Feature Viewer

pLDDT pTM Quality
95.36 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map